Renal epithelial cells

Aging and Senescence

Comparison		UniProtIds		Protein Description		Genes		Log2 Ratio		Std. Dev.		PValue		QValue		GO Biological Process		GO Molecular Process		GO Cellular Process					Ratios	Unique Peptides	Elution Groups	Elution Group
SEN / CTL		P54886		Delta-1-pyrroline-5-carboxylate synthase		ALDH18A1		2.91		1.06		0.0417		0.0171		glutamate metabolic process,proline biosynthetic p... [More]		glutamate 5-kinase activity,glutamate-5-semialdehy... [More]		cytoplasm,mitochondrion,mitochondrial inner membra... [More]					3	48	83	MIDLIIPR.2\|M[Oxi]IDLIIPR.2\|LGSAVVTR.2\|QALHSGQNQLK.... [More]
SEN / CTL		P42771 P42772		Cyclin-dependent kinase inhibitor 2A;Cyclin-dependent kinase 4 inhibitor B		CDKN2A CDKN2B		2.74		0.54		0.0134		0.00676		G1/S transition of mitotic cell cycle,negative reg... [More]		cyclin-dependent protein serine/threonine kinase i... [More]		nucleus,cytoplasm,cytosol,senescence-associated he... [More]					3	1	2	EGFLDTLVVLHR.3\|EGFLDTLVVLHR.2
SEN / CTL		Q969X5		Endoplasmic reticulum-Golgi intermediate compartment protein 1		ERGIC1		2.67		0.95		0.00163		0.00116		ER to Golgi vesicle-mediated transport		protein binding		Golgi membrane,endoplasmic reticulum membrane,endo... [More]					6	14	19	IIPAIWFR.2\|LTSNPLASHDYILK.3\|LTSNPLASHDYILK.2\|IVPTV... [More]
SEN / CTL		Q9Y277		Voltage-dependent anion-selective channel protein 3		VDAC3		2.2		0.99		0.0567		0.0224		anion transport,adenine transport,transmembrane tr... [More]		nucleotide binding,voltage-gated anion channel act... [More]		nucleus,mitochondrion,mitochondrial outer membrane... [More]					3	18	27	LTLSALIDGK.2\|ASGNLETK.2\|LSQNNFALGYK.3\|LSQNNFALGYK.... [More]
SEN / CTL		Q13045		Protein flightless-1 homolog		FLII		2.08		0.4		4.87e-7		8.71e-7		transcription, DNA-templated,regulation of transcr... [More]		actin binding,protein binding		nucleoplasm,cytoplasm,microtubule organizing cente... [More]					9	58	77	ADLTALFLPR.2\|FVFLLDR.2\|GLDIYVWR.2\|AC[CAM]SAIHAVNLR... [More]
SEN / CTL		O94826		Mitochondrial import receptor subunit TOM70		TOMM70A		2.08		1.1		0.0774		0.0289		protein targeting to mitochondrion,macroautophagy,... [More]		protein binding,protein transmembrane transporter ... [More]		mitochondrion,mitochondrial outer membrane,mitocho... [More]					3	29	43	ILLDQVEEAVADFDEC[CAM]IR.3\|ILLDQVEEAVADFDEC[CAM]IR.... [More]
SEN / CTL		P21796		Voltage-dependent anion-selective channel protein 1		VDAC1		2.01		1.02		9.46e-18		7.98e-17		behavioral fear response,anion transport,mitochond... [More]		protein binding,voltage-gated anion channel activi... [More]		nucleus,mitochondrion,mitochondrial outer membrane... [More]					48	31	53	LTLSALLDGK.2\|YQIDPDAC[CAM]FSAK.2\|YQIDPDAC[CAM]FSAK... [More]
SEN / CTL		Q99988		Growth/differentiation factor 15		GDF15		1.96		0.87		0.00000167		0.00000264		signal transduction,transforming growth factor bet... [More]		cytokine activity,transforming growth factor beta ... [More]		extracellular region,extracellular space,nucleus,c... [More]					12	7	7	ASLEDLGWADWVLSPR.2\|LKPDTVPAPC[CAM]C[CAM]VPASYNPMVL... [More]
SEN / CTL		P07203		Glutathione peroxidase 1		GPX1		1.89		1.18		0.00659		0.00383		response to reactive oxygen species,temperature ho... [More]		glutathione peroxidase activity,SH3 domain binding		cytoplasm,mitochondrion,mitochondrial matrix,cytos... [More]					6	17	27	FLVGPDGVPLRR.3\|YVRPGGGFEPNFMLFEK.3\|YVRPGGGFEPNFM[O... [More]
SEN / CTL		P48735		Isocitrate dehydrogenase [NADP], mitochondrial		IDH2		1.86		1.17		7.05e-9		1.88e-8		carbohydrate metabolic process,glyoxylate cycle,tr... [More]		magnesium ion binding,isocitrate dehydrogenase (NA... [More]		mitochondrion,mitochondrial inner membrane,mitocho... [More]					27	38	63	IIWQFIK.2\|VC[CAM]VETVESGAMTK.2\|VC[CAM]VETVESGAM[Ox... [More]
SEN / CTL		Q6DD88		Atlastin-3		ATL3		1.83		0.87		0.0627		0.0243		endoplasmic reticulum organization,Golgi organizat... [More]		GTPase activity,protein binding,GTP binding,identi... [More]		endoplasmic reticulum,endoplasmic reticulum membra... [More]					3	31	45	GLLEYFK.2\|DQHSFELDEK.3\|DQHSFELDEK.2\|IYQGEDLPHPK.3\|... [More]
SEN / CTL		Q9HCB6		Spondin-1		SPON1		1.72		0.71		3.72e-12		1.73e-11		cell adhesion,protein O-linked fucosylation		metal ion binding		proteinaceous extracellular matrix,extracellular s... [More]					27	12	13	AQWPAWQPLNVR.2\|AAPSAEFSVDR.2\|VTLSAAPPSYFR.2\|GFTLIA... [More]
SEN / CTL		Q92882		Osteoclast-stimulating factor 1		OSTF1		1.7		1.26		0.124		0.0422		ossification,signal transduction		protein binding,SH3 domain binding		intracellular,cytoplasm,extracellular exosome					3	13	23	GYADIVQLLLAK.2\|GYADIVQLLLAK.3\|AGSTALYWAC[CAM]HGGHK... [More]
SEN / CTL		Q9BPX5		Actin-related protein 2/3 complex subunit 5-like protein		ARPC5L		1.62		0.46		0.0233		0.0108		biological_process,Arp2/3 complex-mediated actin n... [More]		molecular_function,actin binding		cytoplasm,Arp2/3 protein complex,focal adhesion,ex... [More]					3	10	13	ALAVGGLGSIIR.2\|RVDIDEFDENK.3\|RVDIDEFDENK.2\|GFEKPTE... [More]
SEN / CTL		Q93050		V-type proton ATPase 116 kDa subunit a isoform 1		ATP6V0A1		1.58		0.66		0.069		0.0262		vacuolar acidification,insulin receptor signaling ... [More]		protein binding,proton-transporting ATPase activit... [More]		vacuolar proton-transporting V-type ATPase, V0 dom... [More]					3	20	24	LGFVAGVINR.2\|RGTEHSGSTVPSILNR.4\|FLPFSFEHIR.3\|LGFVA... [More]
SEN / CTL		P10909		Clusterin		CLU		1.57		0.9		2.98e-15		1.79e-14		cell morphogenesis,microglial cell activation,rele... [More]		protein binding,ubiquitin protein ligase binding,c... [More]		extracellular region,extracellular space,nucleus,c... [More]					48	25	42	LFDSDPITVTVPVEVSR.2\|LFDSDPITVTVPVEVSR.3\|ASSIIDELFQ... [More]
SEN / CTL		P08134		Rho-related GTP-binding protein RhoC		RHOC		1.57		0.34		0.000113		0.000112		cytokinesis,small GTPase mediated signal transduct... [More]		signal transducer activity,protein binding,GTP bin... [More]		cytosol,plasma membrane,cleavage furrow,extracellu... [More]					6	5	7	ISAFGYLEC[CAM]SAK.2\|ISAFGYLEC[CAM]SAK.3\|EGVREVFEMA... [More]
SEN / CTL		P45880		Voltage-dependent anion-selective channel protein 2		VDAC2		1.55		1.15		0.00054		0.000445		anion transport,negative regulation of protein pol... [More]		nucleotide binding,voltage-gated anion channel act... [More]		nucleus,mitochondrion,mitochondrial outer membrane... [More]					18	21	28	YQLDPTASISAK.2\|LTLSALVDGK.2\|VNNSSLIGVGYTQTLRPGVK.3... [More]
SEN / CTL		Q9P2J5		Leucine--tRNA ligase, cytoplasmic		LARS		1.51		0.33		0.0109		0.00572		tRNA aminoacylation for protein translation,leucyl... [More]		aminoacyl-tRNA editing activity,leucine-tRNA ligas... [More]		nucleus,cytoplasm,cytosol					3	78	124	WQFLTLR.2\|KHFEANNGKLPDNK.4\|LHLGHTFSLSK.3\|LHLGHTFSL... [More]
SEN / CTL		P11310		Medium-chain specific acyl-CoA dehydrogenase, mitochondrial		ACADM		1.47		0.43		0.0299		0.0132		fatty acid beta-oxidation,carnitine metabolic proc... [More]		fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti... [More]		nucleus,mitochondrion,mitochondrial matrix,axon,ex... [More]					3	33	52	ANWYFLLAR.2\|GIVFEDVKVPK.3\|GIVFEDVKVPK.2\|ELNMGQR.2\|... [More]
SEN / CTL		P14678 P63162		Small nuclear ribonucleoprotein-associated proteins B and B';Small nuclear ribonucleoprotein-associated protein N		SNRPB SNRPN		1.46		0.88		0.0873		0.0321		spliceosomal snRNP assembly,mRNA splicing, via spl... [More]		protein binding,U2 snRNA binding,poly(A) RNA bindi... [More]		nucleoplasm,spliceosomal complex,U5 snRNP,U7 snRNP... [More]					3	1	1	VLGLVLLR.2
SEN / CTL		O95379		Tumor necrosis factor alpha-induced protein 8		TNFAIP8		1.45		0.2		0.00839		0.00465		apoptotic process,negative regulation of apoptotic... [More]		protein binding,cysteine-type endopeptidase inhibi... [More]		cytoplasm					3	6	10	SIATTLIDDTSSEVLDELYR.3\|SIATTLIDDTSSEVLDELYR.2\|EVAT... [More]
SEN / CTL		P69905		Hemoglobin subunit alpha		HBA1		1.44		1.22		0.000519		0.000431		receptor-mediated endocytosis,positive regulation ... [More]		oxygen transporter activity,iron ion binding,prote... [More]		extracellular region,cytosol,hemoglobin complex,me... [More]					12	23	78	VGAHAGEYGAEALER.3\|VGAHAGEYGAEALER.2\|MFLSFPTTK.2\|M[... [More]
SEN / CTL		P06732		Creatine kinase M-type		CKM		1.43		0.29		0.0135		0.0068		creatine metabolic process,phosphorylation,phospho... [More]		creatine kinase activity,protein binding,ATP bindi... [More]		cytosol					3	5	6	GGDDLDPNYVLSSR.2\|LGSSEVEQVQLVVDGVK.3\|GQSIDDMIPAQK.... [More]
SEN / CTL		P17096		High mobility group protein HMG-I/HMG-Y		HMGA1		1.4		1.14		0.00953		0.00512		DNA unwinding involved in DNA replication,nucleoso... [More]		transcriptional activator activity, RNA polymerase... [More]		nucleus,nucleoplasm,transcription factor complex,c... [More]					12	9	13	KLEKEEEEGISQESSEEEQ.3\|KQPPVSPGTALVGSQKEPSEVPTPK.4\|... [More]
SEN / CTL		P21980		Protein-glutamine gamma-glutamyltransferase 2		TGM2		1.38		0.93		1e-20		1.23e-19		blood vessel remodeling,isopeptide cross-linking v... [More]		protein-glutamine gamma-glutamyltransferase activi... [More]		mitochondrion,endoplasmic reticulum,cytosol,focal ... [More]					90	46	73	SVPLC[CAM]ILYEK.2\|RGQPFWLTLHFEGR.3\|RGQPFWLTLHFEGR.... [More]
SEN / CTL		Q9H4B7		Tubulin beta-1 chain		TUBB1		1.37		0.46		0.036		0.0152		spindle assembly		GTPase activity,structural constituent of cytoskel... [More]		cytoplasm,microtubule,extracellular exosome					3	21	38	NSSC[CAM]FVEWIPNNVK.2\|NSSC[CAM]FVEWIPNNVK.3\|IMNSFS... [More]
SEN / CTL		Q13885		Tubulin beta-2A chain		TUBB2A		1.32		0.77		2.85e-15		1.75e-14		cytoskeleton organization,microtubule-based proces... [More]		GTPase activity,structural constituent of cytoskel... [More]		nucleus,cytoplasm,microtubule,extracellular exosom... [More]					54	12	25	YLTVAAIFR.2\|ESESC[CAM]DC[CAM]LQGFQLTHSLGGGTGSGMGTL... [More]
SEN / CTL		P68104		Elongation factor 1-alpha 1		EEF1A1		1.31		0.72		2.02e-38		7.81e-37		transcription, DNA-templated,regulation of transcr... [More]		tRNA binding,translation elongation factor activit... [More]		extracellular space,nucleus,nucleolus,cytoplasm,cy... [More]					132	52	144	EHALLAYTLGVK.3\|EHALLAYTLGVK.2\|IGGIGTVPVGR.2\|YYVTII... [More]
SEN / CTL		Q9NQH7		Probable Xaa-Pro aminopeptidase 3		XPNPEP3		1.31		1.6		0.106		0.0373		glomerular filtration,protein processing		aminopeptidase activity,metallopeptidase activity,... [More]		mitochondrion,extracellular exosome					3	10	14	AILFVPR.2\|GVQQLIQR.2\|YC[CAM]PHHVGHYLGMDVHDTPDMPR.5... [More]
SEN / CTL		Q71U36		Tubulin alpha-1A chain		TUBA1A		1.3		0.6		2.73e-49		1.84e-47		G2/M transition of mitotic cell cycle,cytoskeleton... [More]		GTPase activity,structural molecule activity,struc... [More]		nucleus,cytosol,microtubule,cytoplasmic microtubul... [More]					135	45	112	AVFVDLEPTVIDEVR.2\|AVFVDLEPTVIDEVR.3\|LIGQIVSSITASLR... [More]
SEN / CTL		P68371		Tubulin beta-4B chain		TUBB4B		1.28		0.7		4.16e-55		5.61e-53		G2/M transition of mitotic cell cycle,movement of ... [More]		double-stranded RNA binding,GTPase activity,struct... [More]		nucleus,cytosol,cytoskeleton,microtubule,extracell... [More]					201	42	123	YLTVAAVFR.2\|NSSYFVEWIPNNVK.2\|NSSYFVEWIPNNVK.3\|SGPF... [More]
SEN / CTL		P14618		Pyruvate kinase PKM		PKM		1.27		0.99		2.89e-39		1.3e-37		programmed cell death,canonical glycolysis,cell-ce... [More]		magnesium ion binding,pyruvate kinase activity,pro... [More]		nucleus,cytoplasm,mitochondrion,cytosol,plasma mem... [More]					246	71	161	GDLGIEIPAEK.2\|IYVDDGLISLQVK.2\|IYVDDGLISLQVK.3\|KGVN... [More]
SEN / CTL		P27824		Calnexin		CANX		1.27		0.92		0.000253		0.000228		antigen processing and presentation of peptide ant... [More]		glycoprotein binding,calcium ion binding,protein b... [More]		endoplasmic reticulum,endoplasmic reticulum lumen,... [More]					18	59	93	GTLSGWILSK.2\|KIPNPDFFEDLEPFR.3\|KIPNPDFFEDLEPFR.2\|V... [More]
SEN / CTL		Q14376		UDP-glucose 4-epimerase		GALE		1.27		0.48		0.0444		0.0182		galactose catabolic process		UDP-N-acetylglucosamine 4-epimerase activity,UDP-g... [More]		cytosol,extracellular exosome					3	22	28	VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFR.4\|VLVTGGAGYIG... [More]
SEN / CTL		Q93008		Probable ubiquitin carboxyl-terminal hydrolase FAF-X		USP9X		1.26		1.28		0.0272		0.0122		negative regulation of transcription from RNA poly... [More]		cysteine-type endopeptidase activity,thiol-depende... [More]		cytoplasm,cytosol,membrane,growth cone					6	82	105	VVIQSNDDIASR.2\|SGGLPLVLSMLTR.2\|SGGLPLVLSM[Oxi]LTR.... [More]
SEN / CTL		Q9BUF5		Tubulin beta-6 chain		TUBB6		1.24		1.11		1.46e-11		5.89e-11		cytoskeleton organization,microtubule-based proces... [More]		molecular_function,GTPase activity,structural cons... [More]		nucleus,cytoplasm,microtubule,extracellular exosom... [More]					72	25	55	YLTVATVFR.2\|M[Oxi]ASTFIGNSTAIQELFKR.3\|MASTFIGNSTAI... [More]
SEN / CTL		P18065		Insulin-like growth factor-binding protein 2		IGFBP2		1.24		0.67		0.00000432		0.0000061		regulation of cell growth,signal transduction,fema... [More]		receptor binding,insulin-like growth factor I bind... [More]		extracellular region,extracellular space,apical pl... [More]					18	11	14	TPC[CAM]QQELDQVLER.2\|LEGEAC[CAM]GVYTPR.2\|LAAC[CAM]... [More]
SEN / CTL		P62280		40S ribosomal protein S11		RPS11		1.24		0.4		0.0275		0.0123		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,rRNA binding,po... [More]		nucleoplasm,nucleolus,cytoplasm,cytosol,ribosome,f... [More]					3	16	23	NMSVHLSPC[CAM]FR.3\|NM[Oxi]SVHLSPC[CAM]FR.3\|NMSVHLS... [More]
SEN / CTL		P00387		NADH-cytochrome b5 reductase 3		CYB5R3		1.23		0.95		0.000206		0.000193		cholesterol biosynthetic process,blood circulation... [More]		cytochrome-b5 reductase activity, acting on NAD(P)... [More]		cytoplasm,mitochondrion,mitochondrial outer membra... [More]					15	25	51	FALPSPQHILGLPVGQHIYLSAR.4\|FALPSPQHILGLPVGQHIYLSAR.... [More]
SEN / CTL		Q12797		Aspartyl/asparaginyl beta-hydroxylase		ASPH		1.23		0.73		0.000537		0.000445		muscle contraction,peptidyl-amino acid modificatio... [More]		peptide-aspartate beta-dioxygenase activity,struct... [More]		endoplasmic reticulum,endoplasmic reticulum membra... [More]					9	34	40	GLFLPEDENLREK.3\|GAIETYQEVASLPDVPADLLK.3\|GAIETYQEVA... [More]
SEN / CTL		Q9H853		Putative tubulin-like protein alpha-4B		TUBA4B		1.22		0.44		0.036		0.0152		cytoskeleton organization,microtubule-based proces... [More]		molecular_function,GTPase activity,structural cons... [More]		cellular_component,cytoplasm,microtubule					3	1	2	QIFHPEQLITGK.3\|QIFHPEQLITGK.2
SEN / CTL		P13807		Glycogen [starch] synthase, muscle		GYS1		1.21		0.42		0.0392		0.0162		glycogen biosynthetic process,heart development		glycogen (starch) synthase activity,protein bindin... [More]		cytosol,membrane,inclusion body					3	25	31	LSDLLDWK.2\|FSAMHEFQNLHAQSK.4\|FSAMHEFQNLHAQSK.3\|LSD... [More]
SEN / CTL		P46940		Ras GTPase-activating-like protein IQGAP1		IQGAP1		1.2		0.69		1.67e-32		5.02e-31		regulation of cytokine production,signal transduct... [More]		GTPase inhibitor activity,GTPase activator activit... [More]		ruffle,nucleus,cytoplasm,cytosol,microtubule,actin... [More]					120	128	200	NKYQELINDIAR.3\|NKYQELINDIAR.2\|IIGNLLYYR.2\|LIVDVIR.... [More]
SEN / CTL		Q14204		Cytoplasmic dynein 1 heavy chain 1		DYNC1H1		1.2		0.95		8.71e-16		6.03e-15		G2/M transition of mitotic cell cycle,ER to Golgi ... [More]		microtubule motor activity,ATP binding,ATPase acti... [More]		centrosome,cytosol,cytoplasmic dynein complex,micr... [More]					81	337	531	FGNPLLVQDVESYDPVLNPVLNR.3\|GNEIVLSAGSTPR.2\|IFVFEPPP... [More]
SEN / CTL		Q6NUK1		Calcium-binding mitochondrial carrier protein SCaMC-1		SLC25A24		1.2		0.61		0.00159		0.00114		mitochondrial transport,regulation of cell death,A... [More]		ATP transmembrane transporter activity,calcium ion... [More]		mitochondrion,mitochondrial inner membrane,integra... [More]					6	28	40	QLLAGGIAGAVSR.2\|QLLAGGIAGAVSR.3\|TSTAPLDR.2\|QTLGVTQ... [More]
SEN / CTL		Q9BVC6		Transmembrane protein 109		TMEM109		1.2		0.65		0.0809		0.0301		ion transport,regulation of ion transmembrane tran... [More]		molecular_function,voltage-gated ion channel activ... [More]		nuclear outer membrane,integral component of membr... [More]					3	5	6	EAPVDVLTQIGR.2\|ASGAQLEAK.2\|REAPVDVLTQIGR.3\|REAPVDV... [More]
SEN / CTL		P04066		Tissue alpha-L-fucosidase		FUCA1		1.19		0.66		6.94e-12		3.02e-11		fucose metabolic process,glycosaminoglycan catabol... [More]		alpha-L-fucosidase activity		cytoplasm,lysosomal lumen,extracellular exosome					39	21	32	DGLIVPIFQER.2\|WLSINGEAIYASKPWR.3\|DLVGELGTALR.2\|DVG... [More]
SEN / CTL		P50851		Lipopolysaccharide-responsive and beige-like anchor protein		LRBA		1.17		1.09		0.00497		0.00298		biological_process		molecular_function		lysosome,endoplasmic reticulum,Golgi apparatus,pla... [More]					12	75	87	VANEAEFILSR.2\|LQATMETDDNIR.2\|EAVEAQIR.2\|EIFVDFAPFL... [More]
SEN / CTL		P10145		Interleukin-8		CXCL8		1.16		0.53		0.0612		0.0238		angiogenesis,response to molecule of bacterial ori... [More]		interleukin-8 receptor binding,protein binding,che... [More]		extracellular region,extracellular space,intracell... [More]					3	1	2	VIESGPHC[CAM]ANTEIIVK.3\|VIESGPHC[CAM]ANTEIIVK.2
SEN / CTL		Q16787		Laminin subunit alpha-3		LAMA3		1.15		0.97		0.0118		0.00614		cell adhesion,epidermis development,extracellular ... [More]		receptor binding,structural molecule activity		extracellular region,basement membrane,laminin-5 c... [More]					9	14	14	LLIDDQLLR.2\|VPTQPHAPIPTFGQTIQTTVDR.3\|SPQTYMDGLLHYV... [More]
SEN / CTL		P07437		Tubulin beta chain		TUBB		1.14		0.56		1.33e-12		6.7e-12		G2/M transition of mitotic cell cycle,movement of ... [More]		GTPase activity,structural molecule activity,struc... [More]		extracellular region,nucleus,nuclear envelope lume... [More]					30	8	21	ALTVPELTQQVFDAK.2\|ALTVPELTQQVFDAK.3\|ISVYYNEATGGKYV... [More]
SEN / CTL		Q14108		Lysosome membrane protein 2		SCARB2		1.14		0.29		2.72e-8		6.21e-8		protein targeting to lysosome,viral entry into hos... [More]		virus receptor activity,protein binding,enzyme bin... [More]		lysosomal membrane,focal adhesion,membrane,integra... [More]					12	15	24	KLDDFVETGDIR.3\|KLDDFVETGDIR.2\|FVSAIEGMHPNQEDHETFVD... [More]
SEN / CTL		Q9NY65		Tubulin alpha-8 chain		TUBA8		1.14		0.25		0.0139		0.00694		cytoskeleton organization,microtubule-based proces... [More]		GTPase activity,structural constituent of cytoskel... [More]		cytoplasm,microtubule					3	7	9	KLTDAC[CAM]SGLQGFLIFHSFGGGTGSGFTSLLMER.4\|GHYTVGKES... [More]
SEN / CTL		P12277		Creatine kinase B-type		CKB		1.13		0.65		1.76e-19		1.9e-18		creatine metabolic process,phosphorylation,substan... [More]		creatine kinase activity,protein binding,ATP bindi... [More]		extracellular space,cytoplasm,mitochondrion,cytoso... [More]					63	33	80	VLTPELYAELR.2\|VLTPELYAELR.3\|HGGYKPSDEHKTDLNPDNLQGG... [More]
SEN / CTL		P17655		Calpain-2 catalytic subunit		CAPN2		1.12		0.73		1.83e-21		2.47e-20		response to hypoxia,blastocyst development,proteol... [More]		calcium-dependent cysteine-type endopeptidase acti... [More]		chromatin,nucleus,cytoplasm,lysosome,endoplasmic r... [More]					69	45	77	FADDQLIIDFDNFVR.2\|FADDQLIIDFDNFVR.3\|LFAQLAGEDAEISA... [More]
SEN / CTL		Q9BVA1		Tubulin beta-2B chain		TUBB2B		1.12		0.24		0.0162		0.00794		neuron migration,cytoskeleton organization,microtu... [More]		GTPase activity,structural constituent of cytoskel... [More]		nucleus,cytoplasm,microtubule					3	2	2	INVYYNEATGNKYVPR.3\|INVYYNEATGNK.2
SEN / CTL		A6NHL2		Tubulin alpha chain-like 3		TUBAL3		1.12		0.27		0.0171		0.00828		cytoskeleton organization,microtubule-based proces... [More]		GTPase activity,structural constituent of cytoskel... [More]		cytoplasm,microtubule					3	4	7	KLAEQC[CAM]GGLQGFLIFRSFGGGTGSGFTSLLMER.4\|SLFHPEQLL... [More]
SEN / CTL		O75915		PRA1 family protein 3		ARL6IP5		1.11		0.3		0.0246		0.0112		negative regulation of L-glutamate transport,intri... [More]		molecular_function		endoplasmic reticulum,endoplasmic reticulum membra... [More]					3	4	6	TPMGIVLDALEQQEEGINR.3\|TPMGIVLDALEQQEEGINR.2\|RTPMGI... [More]
SEN / CTL		P30044		Peroxiredoxin-5, mitochondrial		PRDX5		1.09		0.61		6.09e-18		5.3e-17		response to reactive oxygen species,apoptotic proc... [More]		RNA polymerase III regulatory region DNA binding,p... [More]		extracellular space,nucleus,cytoplasm,mitochondrio... [More]					48	19	35	THLPGFVEQAEALK.3\|THLPGFVEQAEALK.2\|THLPGFVEQAEALKAK... [More]
SEN / CTL		O43324		Eukaryotic translation elongation factor 1 epsilon-1		EEF1E1		1.09		0.32		0.0239		0.011		translational elongation,tRNA aminoacylation for p... [More]		translation elongation factor activity,glutathione... [More]		nucleus,cytoplasm,cytosol,extracellular exosome					3	12	17	AIVQQWLEYR.2\|WFC[CAM]HIQHYPGIR.4\|WFC[CAM]HIQHYPGIR... [More]
SEN / CTL		Q01813		ATP-dependent 6-phosphofructokinase, platelet type		PFKP		1.08		0.74		2.6e-11		1.02e-10		fructose 6-phosphate metabolic process,canonical g... [More]		6-phosphofructokinase activity,ATP binding,protein... [More]		nucleus,cytoplasm,cytosol,cell-cell adherens junct... [More]					39	52	85	EWSGLLEELAR.2\|LAIKLPDDQIPK.3\|LAIKLPDDQIPK.2\|NVIFQP... [More]
SEN / CTL		P12236		ADP/ATP translocase 3		SLC25A6		1.08		1.68		0.148		0.0482		protein targeting to mitochondrion,apoptotic proce... [More]		ATP:ADP antiporter activity,protein binding,adenin... [More]		nucleus,mitochondrion,mitochondrial inner membrane... [More]					9	8	15	DFLAGGIAAAISK.2\|DFLAGGIAAAISK.3\|KGADIMYTGTVDC[CAM]... [More]
SEN / CTL		P39656		Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit		DDOST		1.07		0.97		0.00142		0.00103		protein glycosylation,protein N-linked glycosylati... [More]		oligosaccharyl transferase activity,dolichyl-dipho... [More]		endoplasmic reticulum,endoplasmic reticulum membra... [More]					9	20	32	NTLLIAGLQAR.2\|TLVLLDNLNVR.2\|WVFKEEGVLR.3\|WVFKEEGVL... [More]
SEN / CTL		P26640		Valine--tRNA ligase		VARS		1.06		0.46		0.00000469		0.00000649		tRNA aminoacylation for protein translation,valyl-... [More]		aminoacyl-tRNA editing activity,valine-tRNA ligase... [More]		mitochondrion,cytosol					12	72	116	LSAAVTEAFVR.2\|SSAQDPQAVLGALGR.2\|SSAQDPQAVLGALGR.3\|... [More]
SEN / CTL		P48047		ATP synthase subunit O, mitochondrial		ATP5O		1.05		0.51		0.0000294		0.0000331		ATP biosynthetic process,proton transport,mitochon... [More]		transporter activity,protein binding,drug binding,... [More]		nucleus,mitochondrion,mitochondrial inner membrane... [More]					9	18	35	LVRPPVQVYGIEGR.3\|LVRPPVQVYGIEGR.2\|FSPLTTNLINLLAENG... [More]
SEN / CTL		P02042 P02100 P68871 P69891 P69892		Hemoglobin subunit delta;Hemoglobin subunit epsilon;Hemoglobin subunit beta;Hemoglobin subunit gamma-1;Hemoglobin subunit gamma-2		HBD HBE1 HBB HBG1 HBG2		1.04		1.22		0.0278		0.0124		blood coagulation,oxygen transport;blood coagulati... [More]		oxygen transporter activity,iron ion binding,prote... [More]		cytosol,hemoglobin complex,blood microparticle;cyt... [More]					6	1	2	LLVVYPWTQR.2\|LLVVYPWTQR.3
SEN / CTL	Q99714		3-hydroxyacyl-CoA dehydrogenase type-2		HSD17B10		1.04		0.88		0.111		0.0387		lipid metabolic process,branched-chain amino acid ... [More]		3-hydroxyacyl-CoA dehydrogenase activity,protein b... [More]		cytoplasm,mitochondrion,mitochondrial matrix,plasm... [More]		6	26	51	GGIVGMTLPIAR.2\|GGIVGM[Oxi]TLPIAR.2\|DLAPIGIR.2\|GQTH... [More]
SEN / CTL	Q16527		Cysteine and glycine-rich protein 2		CSRP2		1.03		0.88		0.00375		0.00238		multicellular organism development,cell differenti... [More]		molecular_function,zinc ion binding		nucleus,focal adhesion		9	10	14	GFGYGQGAGALVHAQ.2\|GYGYGQGAGTLNMDRGER.3\|C[CAM]C[CAM... [More]
SEN / CTL	Q14894		Ketimine reductase mu-crystallin		CRYM		1.03		1		0.00619		0.00361		negative regulation of transcription from RNA poly... [More]		transcription corepressor activity,protein homodim... [More]		nucleus,cytoplasm,mitochondrion,peroxisomal matrix... [More]		9	13	18	VPAFLSAAEVEEHLR.3\|FADTVQGEVR.2\|SLGMAVEDTVAAK.2\|SLG... [More]
SEN / CTL	P02511		Alpha-crystallin B chain		CRYAB		1.03		0.66		0.0213		0.00992		response to hypoxia,lens development in camera-typ... [More]		structural constituent of eye lens,protein binding... [More]		nucleus,nucleoplasm,cytoplasm,mitochondrion,Golgi ... [More]		6	25	40	FSVNLDVK.2\|LFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLR.4\|LF... [More]
SEN / CTL	Q96DG6		Carboxymethylenebutenolidase homolog		CMBL		1.02		0.2		0.000115		0.000114		xenobiotic metabolic process		hydrolase activity		cytosol,extracellular exosome		6	19	23	NLIEWLNK.2\|AVIVIQDIFGWQLPNTR.3\|AVIVIQDIFGWQLPNTR.2... [More]
SEN / CTL	O00299		Chloride intracellular channel protein 1		CLIC1		1		0.89		5e-9		1.39e-8		chloride transport,signal transduction,regulation ... [More]		voltage-gated ion channel activity,chloride channe... [More]		extracellular space,nucleus,nuclear envelope,cytop... [More]		63	24	42	LAALNPESNTAGLDIFAK.2\|LAALNPESNTAGLDIFAK.3\|GFTIPEAF... [More]
SEN / CTL	Q15717		ELAV-like protein 1		ELAVL1		1		0.08		0.00231		0.00157		mRNA splicing, via spliceosome,multicellular organ... [More]		nucleotide binding,RNA binding,double-stranded RNA... [More]		nucleus,nucleoplasm,cytoplasm,cytosol,membrane,rib... [More]		3	21	35	VLVDQTTGLSR.2\|DANLYISGLPR.3\|DANLYISGLPR.2\|FGGPVHHQ... [More]
SEN / CTL	P61586		Transforming protein RhoA		RHOA		0.97		0.76		0.00000196		0.00000302		transforming growth factor beta receptor signaling... [More]		GTPase activity,protein binding,GTP binding,myosin... [More]		endosome,endoplasmic reticulum membrane,cytosol,cy... [More]		27	17	30	HFC[CAM]PNVPIILVGNKK.4\|HFC[CAM]PNVPIILVGNKK.3\|TC[C... [More]
SEN / CTL	Q9H6S3		Epidermal growth factor receptor kinase substrate 8-like protein 2		EPS8L2		0.97		0.62		0.000495		0.000414		Rho protein signal transduction,regulation of Rho ... [More]		actin binding,cadherin binding involved in cell-ce... [More]		cytoplasm,plasma membrane,cell-cell adherens junct... [More]		9	30	35	VGPQVPLSEPGFR.2\|LAINLLAK.2\|ETQILNC[CAM]ALDDIEWFVAR... [More]
SEN / CTL	P60903		Protein S100-A10		S100A10		0.96		0.46		2.7e-10		9.23e-10		membrane raft assembly,membrane budding,positive r... [More]		calcium ion binding,protein binding,protein homodi... [More]		extrinsic component of plasma membrane,extracellul... [More]		24	12	32	FAGDKGYLTKEDLR.4\|FAGDKGYLTKEDLR.3\|VLMEKEFPGFLENQKD... [More]
SEN / CTL	Q3ZCM7		Tubulin beta-8 chain		TUBB8		0.96		1.04		0.0000192		0.0000227		oocyte maturation,spindle assembly involved in fem... [More]		molecular_function,GTPase activity,structural cons... [More]		cytoplasm,microtubule,extracellular exosome,meioti... [More]		21	4	13	LPTPTYGDLNHLVSATMSGVTTC[CAM]LR.3\|EAESC[CAM]DC[CAM]... [More]
SEN / CTL	P36543		V-type proton ATPase subunit E 1		ATP6V1E1		0.96		0.39		0.0459		0.0186		insulin receptor signaling pathway,ATP hydrolysis ... [More]		protein binding,hydrogen-exporting ATPase activity... [More]		mitochondrion,lysosomal membrane,endosome,cytosol,... [More]		3	16	22	ARDDLITDLLNEAK.3\|ARDDLITDLLNEAK.2\|VSNTLESR.2\|IMEYY... [More]
SEN / CTL	P04083		Annexin A1		ANXA1		0.95		0.47		9.2e-22		1.31e-20		DNA strand renaturation,neutrophil homeostasis,ada... [More]		single-stranded DNA binding,single-stranded RNA bi... [More]		cornified envelope,phagocytic cup,extracellular re... [More]		75	38	69	GLGTDEDTLIEILASR.3\|GLGTDEDTLIEILASR.2\|GVDEATIIDILT... [More]
SEN / CTL	P48307		Tissue factor pathway inhibitor 2		TFPI2		0.95		2.1		0.0805		0.03		blood coagulation,negative regulation of endopepti... [More]		serine-type endopeptidase inhibitor activity,extra... [More]		proteinaceous extracellular matrix,nucleus,extrace... [More]		6	4	4	LQVSVDDQC[CAM]EGSTEK.2\|TC[CAM]DAFTYTGC[CAM]GGNDNNF... [More]
SEN / CTL	Q32MK0 Q86YV6 Q9H1R3		Myosin light chain kinase 3;Myosin light chain kinase family member 4;Myosin light chain kinase 2, skeletal/cardiac muscle		MYLK3 MYLK4 MYLK2		0.95		0.72		0.105		0.0371		regulation of vascular permeability involved in ac... [More]		calmodulin-dependent protein kinase activity,myosi... [More]		cytoplasm,cytosol,actin cytoskeleton;extracellular... [More]		3	1	1	IIDFGLAR.2
SEN / CTL	P04406		Glyceraldehyde-3-phosphate dehydrogenase		GAPDH		0.94		0.83		1.67e-26		3.1e-25		microtubule cytoskeleton organization,gluconeogene... [More]		glyceraldehyde-3-phosphate dehydrogenase (NAD+) (p... [More]		nucleus,cytoplasm,lipid particle,cytosol,plasma me... [More]		174	51	166	LISWYDNEFGYSNR.2\|LISWYDNEFGYSNR.3\|GALQNIIPASTGAAK.... [More]
SEN / CTL	P38646		Stress-70 protein, mitochondrial		HSPA9		0.94		1.21		0.000012		0.0000151		protein folding,protein export from nucleus,erythr... [More]		protein binding,ATP binding,ubiquitin protein liga... [More]		nucleolus,cytoplasm,mitochondrion,focal adhesion,e... [More]		36	68	123	TTPSVVAFTADGER.2\|TTPSVVAFTADGER.3\|AQFEGIVTDLIR.2\|A... [More]
SEN / CTL	O60936		Nucleolar protein 3		NOL3		0.94		0.4		0.0636		0.0246		response to hypoxia,blood vessel remodeling,respon... [More]		RNA binding,death receptor binding,calcium ion bin... [More]		nucleolus,mitochondrion,cytosol,membrane,sarcoplas... [More]		3	5	6	LVETLQADSGLLLDALLAR.3\|LVETLQADSGLLLDALLAR.2\|GEAAC[... [More]
SEN / CTL	O15264 P45983 P45984 P53778 P53779 Q15759 Q16539		Mitogen-activated protein kinase 13;Mitogen-activated protein kinase 8;Mitogen-activated protein kinase 9;Mitogen-activated protein kinase 12;Mitogen-activated protein kinase 10;Mitogen-activated protein kinase 11;Mitogen-activated protein kinase 14		MAPK13 MAPK8 MAPK9 MAPK12 MAPK10 MAPK11 MAPK14		0.94		0.72		0.105		0.0371		MAPK cascade,transcription, DNA-templated,regulati... [More]		protein serine/threonine kinase activity,MAP kinas... [More]		cytosol;nucleus,nucleoplasm,mitochondrion,cytosol;... [More]		3	1	1	ILDFGLAR.2
SEN / CTL	Q96TA1		Niban-like protein 1		FAM129B		0.93		0.5		2.15e-15		1.36e-14		negative regulation of apoptotic process,cell-cell... [More]		cadherin binding involved in cell-cell adhesion		nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pl... [More]		45	38	58	FDVSSTSVFK.2\|FQELIFEDFAR.2\|HC[CAM]NNGIPEDSKVEGPAFT... [More]
SEN / CTL	P40939		Trifunctional enzyme subunit alpha, mitochondrial		HADHA		0.92		0.8		3.87e-10		1.28e-9		fatty acid beta-oxidation,response to insulin,card... [More]		fatty-acyl-CoA binding,3-hydroxyacyl-CoA dehydroge... [More]		mitochondrion,mitochondrial inner membrane,mitocho... [More]		33	68	128	LTAYAMTIPFVR.2\|LTAYAMTIPFVR.3\|LTAYAM[Oxi]TIPFVR.2\|... [More]
SEN / CTL	Q13509		Tubulin beta-3 chain		TUBB3		0.9		0.95		1.6e-8		4.04e-8		cytoskeleton organization,microtubule-based proces... [More]		GTPase activity,structural constituent of cytoskel... [More]		nucleus,cytoplasm,microtubule,axon,dendrite,neuron... [More]		42	12	23	ISVYYNEASSHKYVPR.4\|LHFFMPGFAPLTAR.3\|LHFFMPGFAPLTAR... [More]
SEN / CTL	P07741		Adenine phosphoribosyltransferase		APRT		0.9		1.18		0.0013		0.000948		adenine salvage,lactation,grooming behavior,cellul... [More]		adenine binding,adenine phosphoribosyltransferase ... [More]		nucleoplasm,cytoplasm,cytosol,extracellular exosom... [More]		15	17	29	GFLFGPSLAQELGLGC[CAM]VLIR.3\|GFLFGPSLAQELGLGC[CAM]V... [More]
SEN / CTL	P07355		Annexin A2		ANXA2		0.89		1.02		3.01e-28		6.26e-27		angiogenesis,membrane raft assembly,positive regul... [More]		protease binding,calcium ion binding,protein bindi... [More]		ruffle,basement membrane,extracellular space,nucle... [More]		222	49	99	GLGTDEDSLIEIIC[CAM]SR.2\|GLGTDEDSLIEIIC[CAM]SR.3\|GV... [More]
SEN / CTL	Q14240		Eukaryotic initiation factor 4A-II		EIF4A2		0.89		0.61		0.0693		0.0263		nuclear-transcribed mRNA poly(A) tail shortening,t... [More]		translation initiation factor activity,ATP-depende... [More]		cytosol,eukaryotic translation initiation factor 4... [More]		3	18	29	KGVAINFVTEEDKR.4\|KGVAINFVTEEDKR.3\|KGVAINFVTEEDKR.2... [More]
SEN / CTL	O00151		PDZ and LIM domain protein 1		PDLIM1		0.88		0.29		2.87e-19		2.87e-18		response to hypoxia,regulation of transcription, D... [More]		transcription coactivator activity,zinc ion bindin... [More]		transcription factor complex,cytoplasm,cytoskeleto... [More]		39	27	50	IKGC[CAM]TDNLTLTVAR.3\|IKGC[CAM]TDNLTLTVAR.2\|C[CAM]... [More]
SEN / CTL	P60709 P63261		Actin, cytoplasmic 1;Actin, cytoplasmic 2		ACTB ACTG1		0.88		1.26		9.1e-19		8.47e-18		retina homeostasis,movement of cell or subcellular... [More]		structural constituent of cytoskeleton,protein bin... [More]		nuclear chromatin,extracellular space,nucleoplasm,... [More]		282	34	122	SYELPDGQVITIGNER.2\|SYELPDGQVITIGNER.3\|VAPEEHPVLLTE... [More]
SEN / CTL	Q6IAA8		Ragulator complex protein LAMTOR1		LAMTOR1		0.88		0.36		0.00102		0.000773		regulation of receptor recycling,endosome organiza... [More]		protein binding,guanyl-nucleotide exchange factor ... [More]		lysosome,lysosomal membrane,Golgi apparatus,plasma... [More]		6	9	17	TDEQALLSSILAK.2\|IAAYAYSALSQIR.2\|ALNGAEPNYHSLPSAR.4... [More]
SEN / CTL	P04179		Superoxide dismutase [Mn], mitochondrial		SOD2		0.86		1.13		0.0000142		0.0000174		response to reactive oxygen species,response to su... [More]		superoxide dismutase activity,manganese ion bindin... [More]		mitochondrion,mitochondrial matrix,extracellular e... [More]		54	23	42	AIWNVINWENVTER.2\|AIWNVINWENVTER.3\|GDVTAQIALQPALK.2... [More]
SEN / CTL	P34059		N-acetylgalactosamine-6-sulfatase		GALNS		0.85		1.61		0.0673		0.0257		keratan sulfate catabolic process		N-acetylgalactosamine-4-sulfatase activity,sulfuri... [More]		lysosomal lumen,extracellular exosome		9	12	17	YYEEFPINLK.2\|AHFWTWTNSWENFR.3\|AHFWTWTNSWENFR.2\|AID... [More]
SEN / CTL	P60866		40S ribosomal protein S20		RPS20		0.85		0.66		0.132		0.0444		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,poly(A) RNA bin... [More]		nucleoplasm,cytoplasm,cytosol,membrane,cytosolic s... [More]		3	5	10	LIDLHSPSEIVK.3\|LIDLHSPSEIVK.2\|DTGKTPVEPEVAIHR.4\|DT... [More]
SEN / CTL	P50552		Vasodilator-stimulated phosphoprotein		VASP		0.84		0.29		0.0000215		0.0000252		neural tube closure,axon guidance,actin polymeriza... [More]		actin binding,protein binding,profilin binding,SH3... [More]		cytoplasm,cytosol,plasma membrane,cell-cell adhere... [More]		9	28	48	WLPAGTGPQAFSR.2\|SSSSVTTSETQPC[CAM]TPSSSDYSDLQR.3\|V... [More]
SEN / CTL	Q9BVK6		Transmembrane emp24 domain-containing protein 9		TMED9		0.84		0.52		0.000425		0.000359		ER to Golgi vesicle-mediated transport,retrograde ... [More]		syntaxin binding		Golgi membrane,endoplasmic reticulum,endoplasmic r... [More]		9	13	20	QLVEQVEQIQKEQNYQR.3\|FSLFAGGMLR.2\|FSLFAGGM[Oxi]LR.2... [More]
SEN / CTL	O00748		Cocaine esterase		CES2		0.84		0.09		0.0035		0.00224		xenobiotic metabolic process,catabolic process		methylumbelliferyl-acetate deacetylase activity,ca... [More]		extracellular space,endoplasmic reticulum,endoplas... [More]		3	21	31	MIPGVVDGVFLPR.2\|M[Oxi]IPGVVDGVFLPR.2\|ADHGDELPFVFR.... [More]
SEN / CTL	P61026		Ras-related protein Rab-10		RAB10		0.83		0.37		0.00000813		0.0000107		Golgi to plasma membrane transport,small GTPase me... [More]		GTPase activity,GTP binding,GDP binding,myosin V b... [More]		Golgi membrane,endosome,endoplasmic reticulum memb... [More]		12	17	24	AFLTLAEDILR.2\|LLLIGDSGVGK.2\|LQIWDTAGQER.2\|LQIWDTAG... [More]
SEN / CTL	P10606		Cytochrome c oxidase subunit 5B, mitochondrial		COX5B		0.83		0.69		0.0135		0.0068		mitochondrial electron transport, cytochrome c to ... [More]		cytochrome-c oxidase activity,protein binding,meta... [More]		mitochondrion,mitochondrial inner membrane,mitocho... [More]		6	10	16	KGLDPYNVLAPK.3\|KGLDPYNVLAPK.2\|GLDPYNVLAPK.2\|EDPNLV... [More]
SEN / CTL	P00568		Adenylate kinase isoenzyme 1		AK1		0.82		0.51		5.55e-8		1.2e-7		nucleoside diphosphate phosphorylation,ADP biosynt... [More]		adenylate kinase activity,nucleoside diphosphate k... [More]		outer dense fiber,cytoplasm,cytosol,plasma membran... [More]		21	16	23	IIFVVGGPGSGK.2\|GQLVPLETVLDMLR.3\|GQLVPLETVLDMLR.2\|G... [More]
SEN / CTL	P12268		Inosine-5'-monophosphate dehydrogenase 2		IMPDH2		0.81		0.34		0.00000215		0.0000033		GMP biosynthetic process,GTP biosynthetic process,... [More]		nucleotide binding,DNA binding,RNA binding,IMP deh... [More]		nucleus,cytoplasm,peroxisomal membrane,cytosol,mem... [More]		12	39	77	NLIDAGVDALR.2\|GKLPIVNEDDELVAIIAR.3\|GKLPIVNEDDELVAI... [More]
SEN / CTL	Q9NP97		Dynein light chain roadblock-type 1		DYNLRB1		0.81		0.19		0.0000045		0.0000063		transport,microtubule-based movement,visual behavi... [More]		microtubule motor activity,dynein intermediate cha... [More]		cytoplasm,centrosome,cytoplasmic dynein complex,mi... [More]		9	6	12	STVRDIDPQNDLTFLR.3\|DIDPQNDLTFLR.2\|DIDPQNDLTFLR.3\|G... [More]
SEN / CTL	P33176		Kinesin-1 heavy chain		KIF5B		0.81		0.8		0.00226		0.00154		microtubule-based movement,cytoplasm organization,... [More]		microtubule motor activity,protein binding,ATP bin... [More]		cytoplasm,microtubule organizing center,kinesin co... [More]		12	140	283	GLEETVAK.2\|LYLVDLAGSEK.2\|FQGEDTVVIASKPYAFDR.3\|FQGE... [More]
SEN / CTL	O43639 P16333		Cytoplasmic protein NCK2;Cytoplasmic protein NCK1		NCK2 NCK1		0.81		0.29		0.0572		0.0226		immunological synapse formation,actin filament org... [More]		SH3/SH2 adaptor activity,ARF guanyl-nucleotide exc... [More]		cytoplasm,endoplasmic reticulum,trans-Golgi networ... [More]		3	1	1	LWLLDDSK.2
SEN / CTL	P61247		40S ribosomal protein S3a		RPS3A		0.8		0.46		0.00000392		0.00000563		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,fo... [More]		15	30	55	LFC[CAM]VGFTK.2\|ADGYEPPVQESV.2\|LIPDSIGKDIEK.3\|LIPD... [More]
SEN / CTL	P35232		Prohibitin		PHB		0.8		0.74		0.00000902		0.0000118		negative regulation of transcription from RNA poly... [More]		RNA polymerase II transcription factor activity, s... [More]		nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch... [More]		30	36	61	FDAGELITQR.2\|DLQNVNITLR.2\|VLPSITTEILK.2\|VLPSITTEIL... [More]
SEN / CTL	Q96FQ6		Protein S100-A16		S100A16		0.8		0.65		0.000447		0.000376		response to calcium ion		calcium ion binding,protein binding,protein homodi... [More]		nucleolus,cytoplasm,cytosol,plasma membrane,extrac... [More]		12	8	13	AVIVLVENFYK.2\|AVIVLVENFYK.3\|ISFDEYWTLIGGITGPIAK.3\|... [More]
SEN / CTL	Q99829		Copine-1		CPNE1		0.8		0.27		0.00212		0.00145		transcription, DNA-templated,regulation of transcr... [More]		phosphatidylserine binding,endopeptidase activity,... [More]		nucleus,cytoplasm,cytosol,plasma membrane,membrane... [More]		6	23	37	SDPFLEFFR.2\|EALAQTVLAEVPTQLVSYFR.3\|EALAQTVLAEVPTQL... [More]
SEN / CTL	Q9Y490		Talin-1		TLN1		0.79		0.65		5.75e-26		9.71e-25		platelet degranulation,movement of cell or subcell... [More]		integrin binding,structural constituent of cytoske... [More]		ruffle,extracellular region,cytoplasm,microtubule ... [More]		225	186	355	GLAGAVSELLR.2\|AVAEQIPLLVQGVR.2\|AVAEQIPLLVQGVR.3\|AV... [More]
SEN / CTL	Q9Y6N5		Sulfide:quinone oxidoreductase, mitochondrial		SQRDL		0.79		0.67		2.71e-8		6.21e-8		sulfide oxidation, using sulfide:quinone oxidoredu... [More]		quinone binding,sulfide:quinone oxidoreductase act... [More]		mitochondrial inner membrane		30	39	63	YADALQEIIQER.2\|TAAAVAAQSGILDR.2\|TAAAVAAQSGILDR.3\|H... [More]
SEN / CTL	P62701		40S ribosomal protein S4, X isoform		RPS4X		0.79		0.55		0.000128		0.000126		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,protein binding... [More]		nucleoplasm,cytosol,ribosome,polysome,focal adhesi... [More]		12	30	47	LSNIFVIGK.2\|LREC[CAM]LPLIIFLR.3\|LREC[CAM]LPLIIFLR.... [More]
SEN / CTL	P67809		Nuclease-sensitive element-binding protein 1		YBX1		0.79		0.39		0.00161		0.00114		negative regulation of transcription from RNA poly... [More]		RNA polymerase II core promoter proximal region se... [More]		nucleus,nucleoplasm,U12-type spliceosomal complex,... [More]		6	29	58	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR.4\|RPQYSNPPVQGEVM[Ox... [More]
SEN / CTL	O00264		Membrane-associated progesterone receptor component 1		PGRMC1		0.79		0.63		0.00391		0.00244				steroid binding,heme binding		nucleolus,endoplasmic reticulum,endoplasmic reticu... [More]		9	19	22	FYGPEGPYGVFAGR.2\|IVRGDQPAASGDSDDDEPPPLPR.3\|ILMAING... [More]
SEN / CTL	Q16891		MICOS complex subunit MIC60		IMMT		0.78		0.77		0.00914		0.00497		biological_process,cristae formation,mitochondrial... [More]		protein binding,poly(A) RNA binding		mitochondrion,mitochondrial inner membrane,membran... [More]		12	79	130	VVSQYHELVVQAR.3\|VVSQYHELVVQAR.2\|LRGIEQAVQSHAVAEEEA... [More]
SEN / CTL	P35080		Profilin-2		PFN2		0.78		0.35		0.0919		0.0334		negative regulation of epithelial cell migration,a... [More]		adenyl-nucleotide exchange factor activity,actin m... [More]		cytoplasm,cytoskeleton,terminal bouton,extracellul... [More]		3	8	11	DREGFFTNGLTLGAK.3\|DREGFFTNGLTLGAK.2\|VLVFVM[Oxi]GK.... [More]
SEN / CTL	Q99536		Synaptic vesicle membrane protein VAT-1 homolog		VAT1		0.77		0.56		1.62e-8		4.04e-8		negative regulation of mitochondrial fusion,oxidat... [More]		zinc ion binding,oxidoreductase activity		mitochondrial outer membrane,integral component of... [More]		33	28	53	TWWNQFSVTALQLLQANR.3\|LQSRPAAPPAPGPGQLTLR.3\|LQSRPAA... [More]
SEN / CTL	Q9BUT1		3-hydroxybutyrate dehydrogenase type 2		BDH2		0.77		0.37		0.000239		0.000218		fatty acid beta-oxidation,siderophore biosynthetic... [More]		3-hydroxybutyrate dehydrogenase activity,oxidoredu... [More]		cytoplasm,cytosol,extracellular exosome,mitochondr... [More]		9	13	19	SVAADFIQQGIR.2\|VIILTAAAQGIGQAAALAFAR.3\|VIILTAAAQGI... [More]
SEN / CTL	P68402		Platelet-activating factor acetylhydrolase IB subunit beta		PAFAH1B2		0.77		0.32		0.000712		0.000567		lipid metabolic process,spermatogenesis,brain deve... [More]		1-alkyl-2-acetylglycerophosphocholine esterase act... [More]		nucleolus,cytoplasm,cytosol,plasma membrane,extrac... [More]		9	10	21	IIVLGLLPR.2\|ELFSPLHALNFGIGGDTTR.3\|ELFSPLHALNFGIGGD... [More]
SEN / CTL	O60701		UDP-glucose 6-dehydrogenase		UGDH		0.77		0.8		0.00232		0.00157		gastrulation with mouth forming second,carbohydrat... [More]		UDP-glucose 6-dehydrogenase activity,electron carr... [More]		nucleus,nucleoplasm,cytosol,extracellular exosome		15	46	76	ILTTNTWSSELSK.2\|VTVVDVNESR.2\|IAILGFAFK.2\|LAANAFLAQ... [More]
SEN / CTL	P62913		60S ribosomal protein L11		RPL11		0.77		0.33		0.00279		0.00183		ribosomal large subunit assembly,nuclear-transcrib... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleoplasm,nucleolus,cytoplasm,cytosol,membrane,c... [More]		6	20	23	VLEQLTGQTPVFSK.2\|VLEQLTGQTPVFSK.3\|AEEILEK.2\|HRISKE... [More]
SEN / CTL	P23368		NAD-dependent malic enzyme, mitochondrial		ME2		0.77		1.16		0.0542		0.0215		malate metabolic process,oxidation-reduction proce... [More]		malic enzyme activity,malate dehydrogenase (decarb... [More]		mitochondrion,mitochondrial matrix,intracellular m... [More]		12	35	55	VFTPGQGNNVYIFPGVALAVILC[CAM]NTR.3\|LC[CAM]LYTAC[CAM... [More]
SEN / CTL	O60749		Sorting nexin-2		SNX2		0.76		0.09		0.00304		0.00197		intracellular protein transport,endocytosis,vesicl... [More]		epidermal growth factor receptor binding,insulin r... [More]		cytoplasm,cytosol,cell-cell adherens junction,endo... [More]		3	24	36	AVNTQALSGAGILR.2\|AVNTQALSGAGILR.3\|TVKHPTLLQDPDLR.4... [More]
SEN / CTL	P49411		Elongation factor Tu, mitochondrial		TUFM		0.76		1.63		0.00817		0.00455		translational elongation,response to ethanol,mitoc... [More]		translation elongation factor activity,GTPase acti... [More]		mitochondrion,membrane,mitochondrial nucleoid,extr... [More]		30	46	87	GITINAAHVEYSTAAR.3\|GITINAAHVEYSTAAR.2\|GITINAAHVEYS... [More]
SEN / CTL	Q96HY6		DDRGK domain-containing protein 1		DDRGK1		0.76		0.39		0.00955		0.00512		regulation of intracellular estrogen receptor sign... [More]		protein binding,ubiquitin-like protein ligase bind... [More]		endoplasmic reticulum,endoplasmic reticulum membra... [More]		6	12	18	VVLLEDLASQVGLR.2\|VVLLEDLASQVGLR.3\|FIYITPEELAAVANFI... [More]
SEN / CTL	O60763		General vesicular transport factor p115		USO1		0.76		0.61		0.0234		0.0108		intracellular protein transport,ER to Golgi vesicl... [More]		protein transporter activity,poly(A) RNA binding,c... [More]		Golgi membrane,nucleolus,endoplasmic reticulum,Gol... [More]		9	49	72	VTNLHLMLQLVR.3\|VTNLHLMLQLVR.2\|EVIRNDGVLLLQALTR.3\|E... [More]
SEN / CTL	Q92743		Serine protease HTRA1		HTRA1		0.76		0.67		0.119		0.041		regulation of cell growth,placenta development,pro... [More]		serine-type endopeptidase activity,insulin-like gr... [More]		extracellular region,extracellular space,cytosol,p... [More]		6	2	2	IAPAVVHIELFR.3\|SSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQR.3
SEN / CTL	Q96SI9		Spermatid perinuclear RNA-binding protein		STRBP		0.76		0.52		0.141		0.0465		multicellular organism development,spermatid devel... [More]		DNA binding,double-stranded RNA binding,single-str... [More]		nucleus,cytoplasm,microtubule cytoskeleton		3	24	25	SC[CAM]VIVLR.2\|EDITHSAQHALR.3\|RPFEDGLGDDKDPNKK.4\|R... [More]
SEN / CTL	P04004		Vitronectin		VTN		0.76		1.51		0.145		0.0477		receptor-mediated endocytosis,immune response,cell... [More]		scavenger receptor activity,integrin binding,prote... [More]		extracellular region,basement membrane,extracellul... [More]		12	22	33	LIRDVWGIEGPIDAAFTR.3\|DVWGIEGPIDAAFTR.2\|DVWGIEGPIDA... [More]
SEN / CTL	Q9BR76		Coronin-1B		CORO1B		0.75		0.61		0.00000154		0.00000247		cell migration,actin cytoskeleton organization,ruf... [More]		protein binding,identical protein binding,actin fi... [More]		stress fiber,cytoplasm,cytosol,actin filament,plas... [More]		21	27	44	DADPILISLR.2\|AGEAGKLEEVMQELR.3\|AGEAGKLEEVMQELR.2\|V... [More]
SEN / CTL	Q6PCE3		Glucose 1,6-bisphosphate synthase		PGM2L1		0.75		0.18		0.000287		0.000255		glucose metabolic process,phosphorylation		intramolecular transferase activity, phosphotransf... [More]		cytosol		6	15	17	DVPVYLFSR.2\|FC[CAM]GTFAILHVR.3\|GFVVGYDTR.2\|VFGFKPP... [More]
SEN / CTL	Q13418		Integrin-linked protein kinase		ILK		0.75		0.8		0.00387		0.00242		branching involved in ureteric bud morphogenesis,p... [More]		protein serine/threonine kinase activity,signal tr... [More]		stress fiber,nucleoplasm,cytoplasm,cytosol,plasma ... [More]		12	21	36	FDMIVPILEK.2\|FDM[Oxi]IVPILEK.2\|SAVVEMLIMR.2\|GMAFLH... [More]
SEN / CTL	P30042		ES1 protein homolog, mitochondrial		C21orf33		0.75		0.41		0.00763		0.00427						mitochondrion		6	22	42	VLKEFHQAGKPIGLC[CAM]C[CAM]IAPVLAAK.4\|VLKEFHQAGKPIG... [More]
SEN / CTL	P59190		Ras-related protein Rab-15		RAB15		0.75		0.45		0.0601		0.0235		small GTPase mediated signal transduction,protein ... [More]		protein binding,GTP binding		cytoplasm,plasma membrane,endosome membrane,perinu... [More]		3	1	1	IQIWDTAGQER.2
SEN / CTL	P68366		Tubulin alpha-4A chain		TUBA4A		0.74		0.63		6.77e-13		3.52e-12		G2/M transition of mitotic cell cycle,platelet deg... [More]		GTPase activity,structural constituent of cytoskel... [More]		extracellular region,cytosol,microtubule,extracell... [More]		42	16	28	LISQIVSSITASLR.2\|LISQIVSSITASLR.3\|AVFVDLEPTVIDEIR.... [More]
SEN / CTL	P52943		Cysteine-rich protein 2		CRIP2		0.74		0.62		1.15e-7		2.29e-7		positive regulation of cell proliferation,hemopoie... [More]		zinc ion binding		cell cortex,extracellular matrix		21	12	18	ASSVTTFTGEPNTC[CAM]PR.2\|GVNIGGAGSYIYEKPLAEGPQVTGPI... [More]
SEN / CTL	P62826		GTP-binding nuclear protein Ran		RAN		0.74		0.41		0.00000596		0.00000812		ribosomal large subunit export from nucleus,riboso... [More]		chromatin binding,transcription coactivator activi... [More]		nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla... [More]		15	19	35	GPIKFNVWDTAGQEK.3\|GPIKFNVWDTAGQEK.2\|LVLVGDGGTGK.2\|... [More]
SEN / CTL	P35998		26S protease regulatory subunit 7		PSMC2		0.74		0.56		0.000227		0.000208		MAPK cascade,protein polyubiquitination,osteoblast... [More]		protein binding,ATP binding,ATPase activity,TBP-cl... [More]		proteasome complex,cytoplasmic mRNA processing bod... [More]		15	40	63	ALDEGDIALLK.2\|KIEFSLPDLEGR.3\|KIEFSLPDLEGR.2\|SVC[CA... [More]
SEN / CTL	P04350		Tubulin beta-4A chain		TUBB4A		0.73		0.39		0.000294		0.00026		G2/M transition of mitotic cell cycle,cytoskeleton... [More]		GTPase activity,structural constituent of cytoskel... [More]		nucleus,cytosol,microtubule,cilium,internode regio... [More]		12	4	7	M[Oxi]AATFIGNSTAIQELFKR.3\|MAATFIGNSTAIQELFKR.3\|M[O... [More]
SEN / CTL	Q8N1G4		Leucine-rich repeat-containing protein 47		LRRC47		0.73		0.62		0.00986		0.00526		phenylalanyl-tRNA aminoacylation		poly(A) RNA binding,phenylalanine-tRNA ligase acti... [More]		phenylalanine-tRNA ligase complex		6	28	40	SILEYLR.2\|DVRPYIVGAVVR.3\|DVRPYIVGAVVR.2\|AAGGQLPPR.... [More]
SEN / CTL	P68032		Actin, alpha cardiac muscle 1		ACTC1		0.72		0.62		1.2e-16		8.78e-16		apoptotic process,positive regulation of gene expr... [More]		ATP binding,ATPase activity,myosin binding		extracellular space,cytoplasm,cytosol,actin filame... [More]		81	12	42	EKLC[CAM]YVALDFENEM[Oxi]ATAASSSSLEK.3\|MTQIMFETFNVP... [More]
SEN / CTL	Q9UGI8		Testin		TES		0.72		0.66		0.0000286		0.0000324		negative regulation of cell proliferation,cell-cel... [More]		protein binding,zinc ion binding,poly(A) RNA bindi... [More]		nucleus,cytoplasm,plasma membrane,cell-cell adhere... [More]		18	33	47	C[CAM]EGFELHFWR.3\|LSMKEGDPAIYAER.3\|KNVSINTVTYEWAPP... [More]
SEN / CTL	P04632		Calpain small subunit 1		CAPNS1		0.72		1.04		0.000693		0.000557		proteolysis,positive regulation of cell proliferat... [More]		calcium-dependent cysteine-type endopeptidase acti... [More]		cytosol,plasma membrane,membrane,extracellular exo... [More]		30	18	39	ILGGVISAISEAAAQYNPEPPPPR.4\|ILGGVISAISEAAAQYNPEPPPP... [More]
SEN / CTL	P62304		Small nuclear ribonucleoprotein E		SNRPE		0.72		0.47		0.136		0.0453		spliceosomal complex assembly,spliceosomal snRNP a... [More]		RNA binding,protein binding		nucleus,nucleoplasm,spliceosomal complex,U5 snRNP,... [More]		3	5	11	VMVQPINLIFR.2\|VMVQPINLIFR.3\|VM[Oxi]VQPINLIFR.3\|VM[... [More]
SEN / CTL	O75955		Flotillin-1		FLOT1		0.71		0.28		3.77e-7		6.84e-7		membrane raft assembly,positive regulation of cyto... [More]		protease binding,protein binding,ionotropic glutam... [More]		uropod,lysosomal membrane,endosome,early endosome,... [More]		15	31	45	AAYDIEVNTR.2\|MRGEAEAFAIGAR.3\|MRGEAEAFAIGAR.2\|HGVPI... [More]
SEN / CTL	Q9NZM1		Myoferlin		MYOF		0.71		0.86		0.0000493		0.0000526		plasma membrane repair,muscle contraction,blood ci... [More]		protein binding,phospholipid binding		nuclear envelope,plasma membrane,caveola,integral ... [More]		30	117	143	WVTFLLK.2\|FGSHC[CAM]GIPEEYC[CAM]VSGVNTWR.3\|ANVTVLD... [More]
SEN / CTL	P49755		Transmembrane emp24 domain-containing protein 10		TMED10		0.71		0.37		0.00242		0.00162		kidney development,intracellular protein transport... [More]		protein binding,syntaxin binding,protein complex b... [More]		Golgi membrane,endoplasmic reticulum,endoplasmic r... [More]		6	11	23	RLEDLSESIVNDFAYMK.3\|RLEDLSESIVNDFAYM[Oxi]K.3\|RLEDL... [More]
SEN / CTL	Q15746		Myosin light chain kinase, smooth muscle		MYLK		0.71		0.98		0.0415		0.0171		protein phosphorylation,muscle contraction,smooth ... [More]		actin binding,myosin light chain kinase activity,c... [More]		stress fiber,cytoplasm,cytosol,lamellipodium,cleav... [More]		12	57	67	LIDFGLAR.2\|LSSMAMISGLSGR.2\|TSSSITLQAAR.2\|TIRDLEVVE... [More]
SEN / CTL	Q562R1		Beta-actin-like protein 2		ACTBL2		0.7		0.36		7.98e-10		2.48e-9		biological_process		molecular_function,ATP binding		extracellular space,cytoplasm,cytoskeleton,extrace... [More]		24	9	17	VAPDEHPILLTEAPLNPK.3\|VAPDEHPILLTEAPLNPK.4\|KDLYANTV... [More]
SEN / CTL	P51665		26S proteasome non-ATPase regulatory subunit 7		PSMD7		0.7		0.38		0.000209		0.000195		MAPK cascade,protein polyubiquitination,stimulator... [More]		protein binding,protein homodimerization activity		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		12	15	25	LHKNDIAINELMK.3\|VVGVLLGSWQK.2\|VVVHPLVLLSVVDHFNR.4\|... [More]
SEN / CTL	P20340 Q9NRW1		Ras-related protein Rab-6A;Ras-related protein Rab-6B		RAB6A RAB6B		0.7		0.58		0.000798		0.000626		protein targeting to Golgi,retrograde vesicle-medi... [More]		GTPase activity,protein binding,GTP binding,protei... [More]		Golgi membrane,endoplasmic reticulum membrane,Golg... [More]		9	3	3	LQLWDTAGQER.2\|LVFLGEQSVGK.2\|FKLVFLGEQSVGK.3
SEN / CTL	O43399		Tumor protein D54		TPD52L2		0.69		0.35		6.5e-8		1.36e-7				poly(A) RNA binding				18	18	28	LGLSTLGELKQNLSR.3\|LGLSTLGELK.2\|TSAALSTVGSAISR.2\|TS... [More]
SEN / CTL	P21912		Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial		SDHB		0.69		0.27		0.00167		0.00119		tricarboxylic acid cycle,succinate metabolic proce... [More]		succinate dehydrogenase activity,protein binding,s... [More]		nucleoplasm,mitochondrion,mitochondrial inner memb... [More]		6	18	26	LQDPFSLYR.2\|C[CAM]GPMVLDALIK.2\|C[CAM]GPM[Oxi]VLDAL... [More]
SEN / CTL	O76061		Stanniocalcin-2		STC2		0.69		1.41		0.0456		0.0186		cellular calcium ion homeostasis,response to oxida... [More]		hormone activity,enzyme binding,heme binding,prote... [More]		extracellular space,endoplasmic reticulum,Golgi ap... [More]		6	2	2	HDLC[CAM]AAAQENTR.2\|VIVEMIHFK.2
SEN / CTL	P50479		PDZ and LIM domain protein 4		PDLIM4		0.68		0.56		6.65e-8		1.38e-7				protein binding,zinc ion binding				27	14	19	VKPPEGYDVVAVYPNAK.3\|GYFFLDER.2\|DFSAPLTISR.2\|AALAAL... [More]
SEN / CTL	Q16555		Dihydropyrimidinase-related protein 2		DPYSL2		0.68		0.84		0.0000198		0.0000233		response to amphetamine,nucleobase-containing comp... [More]		dihydropyrimidinase activity,protein binding,micro... [More]		mitochondrion,cytosol,dendrite,growth cone,neurona... [More]		45	34	71	QIGENLIVPGGVK.2\|SSAEVIAQAR.2\|IVLEDGTLHVTEGSGR.3\|IV... [More]
SEN / CTL	Q13404		Ubiquitin-conjugating enzyme E2 variant 1		UBE2V1		0.68		0.64		0.000973		0.00075		protein polyubiquitination,stimulatory C-type lect... [More]		protein binding,ubiquitin protein ligase binding,u... [More]		ubiquitin ligase complex,nucleus,cytoplasm,cytosol... [More]		9	10	16	WTGMIIGPPR.2\|WTGM[Oxi]IIGPPR.2\|VVLQELR.2\|IEC[CAM]G... [More]
SEN / CTL	Q15435		Protein phosphatase 1 regulatory subunit 7		PPP1R7		0.68		0.22		0.0029		0.0019		chromosome segregation,biological_process,positive... [More]		protein phosphatase type 1 regulator activity,enzy... [More]		nucleus,chromosome,cytoplasm,extracellular exosome		6	25	37	IEGLQNLVNLR.2\|AIENIDTLTNLESLFLGK.3\|AIENIDTLTNLESLF... [More]
SEN / CTL	Q00610		Clathrin heavy chain 1		CLTC		0.67		0.7		2.35e-28		5.29e-27		osteoblast differentiation,intracellular protein t... [More]		double-stranded RNA binding,structural molecule ac... [More]		spindle,cytosol,plasma membrane,focal adhesion,mem... [More]		234	154	302	LLLPWLEAR.2\|SVDPTLALSVYLR.2\|VANVELYYR.2\|QKWLLLTGIS... [More]
SEN / CTL	P22314		Ubiquitin-like modifier-activating enzyme 1		UBA1		0.67		0.62		3.19e-15		1.87e-14		cellular response to DNA damage stimulus,protein u... [More]		ubiquitin activating enzyme activity,ubiquitin-pro... [More]		nucleus,cytoplasm,mitochondrion,cytosol,extracellu... [More]		111	67	128	LQTSSVLVSGLR.2\|LAGTQPLEVLEAVQR.3\|LAGTQPLEVLEAVQR.2... [More]
SEN / CTL	O75367		Core histone macro-H2A.1		H2AFY		0.67		0.35		1.08e-7		2.16e-7		negative regulation of transcription from RNA poly... [More]		rDNA binding,RNA polymerase II regulatory region s... [More]		nuclear chromosome,nuclear chromosome, telomeric r... [More]		18	23	38	HILLAVANDEELNQLLK.3\|HILLAVANDEELNQLLK.2\|KGGKEFVEAV... [More]
SEN / CTL	P0DMV8 P0DMV9		Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B		HSPA1A HSPA1B		0.67		0.9		3.39e-7		6.32e-7		positive regulation of gene expression,regulation ... [More]		virus receptor activity,G-protein coupled receptor... [More]		nucleoplasm,cytoplasm,mitochondrion,centriole,cyto... [More]		90	60	132	TTPSYVAFTDTER.2\|TTPSYVAFTDTER.3\|IINEPTAAAIAYGLDR.3... [More]
SEN / CTL	P27816		Microtubule-associated protein 4		MAP4		0.67		0.76		8.96e-7		0.00000152		mitotic spindle organization,neuron projection dev... [More]		structural molecule activity,microtubule binding,p... [More]		cytoplasm,microtubule,microtubule associated compl... [More]		36	68	96	NVVLPTETEVAPAKDVTLLKETER.4\|ATPMPSRPSTTPFIDKKPTSAKP... [More]
SEN / CTL	O94979		Protein transport protein Sec31A		SEC31A		0.67		1.05		0.00148		0.00107		antigen processing and presentation of peptide ant... [More]		protein binding,calcium-dependent protein binding		Golgi membrane,cytoplasm,endoplasmic reticulum,end... [More]		18	51	78	NPAVLSAASFDGR.2\|TTFEDLIQR.2\|NVWSFLK.2\|RPVGASFSFGGK... [More]
SEN / CTL	P23246		Splicing factor, proline- and glutamine-rich		SFPQ		0.67		0.88		0.0082		0.00456		negative regulation of transcription from RNA poly... [More]		nucleotide binding,transcription regulatory region... [More]		chromatin,nucleus,nucleoplasm,cytoplasm,nuclear ma... [More]		12	49	90	NLSPYVSNELLEEAFSQFGPIER.3\|NLSPYVSNELLEEAFSQFGPIER.... [More]
SEN / CTL	P36578		60S ribosomal protein L4		RPL4		0.67		0.42		0.00882		0.00484		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleus,nucleolus,cytoplasm,cytosol,focal adhesion... [More]		6	42	74	NIPGITLLNVSK.2\|NIPGITLLNVSK.3\|FC[CAM]IWTESAFR.2\|KP... [More]
SEN / CTL	P50914		60S ribosomal protein L14		RPL14		0.67		0.35		0.0132		0.00668		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pol... [More]		cytoplasm,cytosol,cell-cell adherens junction,memb... [More]		6	10	14	LVAIVDVIDQNR.2\|LVAIVDVIDQNR.3\|C[CAM]MQLTDFILK.2\|C[... [More]
SEN / CTL	P22087		rRNA 2'-O-methyltransferase fibrillarin		FBL		0.67		0.77		0.0789		0.0295		box C/D snoRNA 3'-end processing,osteoblast differ... [More]		TFIID-class transcription factor binding,RNA bindi... [More]		dense fibrillar component,granular component,nucle... [More]		6	26	47	IVALNAHTFLR.3\|IVALNAHTFLR.2\|VSISEGDDKIEYR.3\|VSISEG... [More]
SEN / CTL	P25705		ATP synthase subunit alpha, mitochondrial		ATP5A1		0.66		0.68		2.17e-15		1.36e-14		negative regulation of endothelial cell proliferat... [More]		protein binding,ATP binding,transmembrane transpor... [More]		mitochondrion,mitochondrial inner membrane,mitocho... [More]		87	55	105	TGAIVDVPVGEELLGR.2\|TGAIVDVPVGEELLGR.3\|EAYPGDVFYLHS... [More]
SEN / CTL	Q14254		Flotillin-2		FLOT2		0.66		0.38		0.00177		0.00125		membrane raft assembly,cell adhesion,chemical syna... [More]		protease binding,protein binding,ionotropic glutam... [More]		uropod,acrosomal membrane,endosome,plasma membrane... [More]		12	26	30	SAFSEEVNIK.2\|TAEAQLAYELQGAR.2\|MALVLEALPQIAAK.2\|M[O... [More]
SEN / CTL	Q02543		60S ribosomal protein L18a		RPL18A		0.66		0.67		0.0336		0.0144		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pro... [More]		cytosol,membrane,cytosolic large ribosomal subunit		6	17	25	EYRDLTTAGAVTQC[CAM]YR.3\|DLTTAGAVTQC[CAM]YR.2\|DLTTA... [More]
SEN / CTL	Q9BZQ8		Protein Niban		FAM129A		0.65		0.41		0.000148		0.000143		negative regulation of protein phosphorylation,pos... [More]		molecular_function,protein binding		cytoplasm,plasma membrane,membrane,extracellular e... [More]		12	25	36	FSALLSDC[CAM]VR.2\|EFPVYLWQPFFR.2\|EFPVYLWQPFFR.3\|QY... [More]
SEN / CTL	P21291		Cysteine and glycine-rich protein 1		CSRP1		0.65		0.96		0.000216		0.0002		platelet aggregation		zinc ion binding,poly(A) RNA binding		nucleus,focal adhesion,extracellular exosome		21	16	31	NLDSTTVAVHGEEIYC[CAM]K.3\|NLDSTTVAVHGEEIYC[CAM]K.2\|... [More]
SEN / CTL	O14950 P19105		Myosin regulatory light chain 12B;Myosin regulatory light chain 12A		MYL12B MYL12A		0.65		0.46		0.038		0.0158		muscle contraction,regulation of cell shape;muscle... [More]		calcium ion binding,myosin heavy chain binding;cal... [More]		stress fiber,cytosol,brush border,myosin II comple... [More]		27	18	38	GNFNYIEFTR.2\|LNGTDPEDVIR.2\|NAFAC[CAM]FDEEATGTIQEDY... [More]
SEN / CTL	Q15149		Plectin		PLEC		0.64		0.91		9.66e-29		2.37e-27		hemidesmosome assembly,cell-cell adhesion		actin binding,protein binding,structural constitue... [More]		cytoplasm,cytosol,plasma membrane,brush border,cel... [More]		309	489	728	WQAVLAQTDVR.2\|SQVEEELFSVR.2\|VTLVQTLEIQR.2\|IISLETYN... [More]
SEN / CTL	P78417		Glutathione S-transferase omega-1		GSTO1		0.64		0.73		0.0000255		0.0000293		glutathione metabolic process,regulation of releas... [More]		glutathione transferase activity,oxidoreductase ac... [More]		cytoplasm,cytosol,extracellular exosome		18	28	41	VPSLVGSFIR.2\|MILELFSK.2\|M[Oxi]ILELFSK.2\|GIRHEVININ... [More]
SEN / CTL	Q9H082		Ras-related protein Rab-33B		RAB33B		0.64		0.46		0.0129		0.00659		protein targeting to Golgi,intra-Golgi vesicle-med... [More]		GTPase activity,protein binding,GTP binding		Golgi membrane,Golgi apparatus,Golgi lumen,extrace... [More]		6	4	5	IQLWDTAGQER.2\|IKIQLWDTAGQER.3\|IKIQLWDTAGQER.2\|QHLL... [More]
SEN / CTL	P31949		Protein S100-A11		S100A11		0.64		0.97		0.0172		0.00828		signal transduction,negative regulation of DNA rep... [More]		calcium ion binding,protein homodimerization activ... [More]		ruffle,extracellular space,nucleus,cytoplasm,cell-... [More]		33	8	13	C[CAM]IESLIAVFQK.2\|C[CAM]IESLIAVFQK.3\|ISSPTETERC[C... [More]
SEN / CTL	P25325		3-mercaptopyruvate sulfurtransferase		MPST		0.64		0.43		0.133		0.0446		kidney development,liver development,cyanate catab... [More]		thiosulfate sulfurtransferase activity,3-mercaptop... [More]		mitochondrion,cytosol,cell junction,neuron project... [More]		3	17	26	ALVSAQWVAEALR.2\|ALVSAQWVAEALR.3\|ARPEDVISEGR.3\|ARPE... [More]
SEN / CTL	O15143		Actin-related protein 2/3 complex subunit 1B		ARPC1B		0.63		0.3		1.54e-11		6.1e-11		movement of cell or subcellular component,Arp2/3 c... [More]		structural constituent of cytoskeleton,actin filam... [More]		cytosol,Arp2/3 protein complex,focal adhesion,acti... [More]		30	22	41	TWKPTLVILR.3\|VHELKEHNGQVTGIDWAPESNR.4\|VHELKEHNGQVT... [More]
SEN / CTL	P60981		Destrin		DSTN		0.63		0.67		0.0000827		0.0000836		actin polymerization or depolymerization,actin fil... [More]		protein binding,actin filament binding		actin cytoskeleton,cortical actin cytoskeleton,ext... [More]		21	22	34	YALYDASFETK.2\|AVIFC[CAM]LSADKK.3\|AVIFC[CAM]LSADKK.... [More]
SEN / CTL	Q16774		Guanylate kinase		GUK1		0.63		0.33		0.00347		0.00222		purine nucleotide metabolic process,dGDP biosynthe... [More]		guanylate kinase activity,ATP binding		cytosol		6	15	23	IC[CAM]VLDVDLQGVR.2\|VAVQAVQAMNR.2\|VAVQAVQAM[Oxi]NR... [More]
SEN / CTL	P46777		60S ribosomal protein L5		RPL5		0.62		0.46		9.81e-7		0.00000166		ribosomal large subunit assembly,nuclear-transcrib... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleus,nucleolus,cytoplasm,cytosol,focal adhesion... [More]		21	27	56	VGLTNYAAAYC[CAM]TGLLLAR.3\|VGLTNYAAAYC[CAM]TGLLLAR.... [More]
SEN / CTL	Q16851		UTP--glucose-1-phosphate uridylyltransferase		UGP2		0.62		0.49		0.00000427		0.00000606		glycogen biosynthetic process,UDP-glucose metaboli... [More]		UTP:glucose-1-phosphate uridylyltransferase activi... [More]		nucleus,cytosol,extracellular exosome		24	37	59	GLPDNISSVLNK.2\|EFPTVPLVK.2\|SFENSLGINVPR.2\|SFENSLGI... [More]
SEN / CTL	Q9UPN3		Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5		MACF1		0.62		0.97		0.000347		0.000303		regulation of epithelial cell migration,Wnt signal... [More]		actin binding,calcium ion binding,protein binding,... [More]		cytoplasm,Golgi apparatus,cytoskeleton,microtubule... [More]		18	251	298	ALLELVPWR.2\|LVLDTVNEVSR.2\|VIAQLEIR.2\|C[CAM]DSFLHQS... [More]
SEN / CTL	A5A3E0		POTE ankyrin domain family member F		POTEF		0.62		0.84		0.00182		0.00128		retina homeostasis				extracellular space,cell cortex,extracellular exos... [More]		15	4	5	VAPEEHPVLLTEATLNPK.3\|C[CAM]PEALFQPC[CAM]FLGMESC[CA... [More]
SEN / CTL	P10253		Lysosomal alpha-glucosidase		GAA		0.62		1.07		0.00201		0.00139		maltose metabolic process,regulation of the force ... [More]		alpha-1,4-glucosidase activity,oligo-1,6-glucosida... [More]		lysosome,lysosomal membrane,membrane,lysosomal lum... [More]		18	34	49	GAYTQVIFLAR.2\|QQPMALAVALTK.2\|WTQLGAFYPFMR.2\|WTQLGA... [More]
SEN / CTL	O75396		Vesicle-trafficking protein SEC22b		SEC22B		0.62		0.53		0.0151		0.00746		ER to Golgi vesicle-mediated transport,retrograde ... [More]		SNARE binding,SNAP receptor activity,protein bindi... [More]		Golgi membrane,endoplasmic reticulum membrane,endo... [More]		9	15	21	VLLTMIAR.2\|VLLTM[Oxi]IAR.2\|NLGSINTELQDVQR.2\|IMVANI... [More]
SEN / CTL	Q9BUI4		DNA-directed RNA polymerase III subunit RPC3		POLR3C		0.62		0.2		0.0304		0.0133		regulation of transcription from RNA polymerase II... [More]		DNA binding,DNA-directed RNA polymerase activity,p... [More]		nucleus,nucleoplasm,DNA-directed RNA polymerase II... [More]		3	15	17	SLPVGYNISK.2\|VIAHDTGTSLDQVK.3\|VIAHDTGTSLDQVK.2\|SGD... [More]
SEN / CTL	Q13492		Phosphatidylinositol-binding clathrin assembly protein		PICALM		0.62		0.41		0.127		0.043		protein complex assembly,receptor-mediated endocyt... [More]		protein binding,1-phosphatidylinositol binding,cla... [More]		nucleus,Golgi apparatus,clathrin-coated pit,cell-c... [More]		3	26	37	ATTLSNAVSSLASTGLSLTK.3\|ATTLSNAVSSLASTGLSLTK.2\|EKQA... [More]
SEN / CTL	Q14914		Prostaglandin reductase 1		PTGR1		0.61		0.25		7.18e-12		3.08e-11		leukotriene metabolic process,prostaglandin metabo... [More]		zinc ion binding,2-alkenal reductase [NAD(P)] acti... [More]		cytoplasm,extracellular exosome		27	22	35	MEAFVVYR.2\|IAIC[CAM]GAISTYNR.2\|LGFDVVFNYK.2\|HFVGYP... [More]
SEN / CTL	P16152		Carbonyl reductase [NADPH] 1		CBR1		0.61		0.36		9.94e-10		2.98e-9		drug metabolic process,cyclooxygenase pathway,epit... [More]		carbonyl reductase (NADPH) activity,oxidoreductase... [More]		cytosol,extracellular exosome,extracellular vesicl... [More]		30	26	43	LFSGDVVLTAR.2\|FHQLDIDDLQSIR.3\|FHQLDIDDLQSIR.2\|DVC[... [More]
SEN / CTL	P07585		Decorin		DCN		0.61		0.48		1.45e-9		4.21e-9		kidney development,placenta development,negative r... [More]		protein kinase inhibitor activity,protein binding,... [More]		extracellular region,collagen type VI trimer,extra... [More]		42	22	33	NLHALILVNNK.3\|NLHALILVNNK.2\|VSPGAFTPLVKLER.3\|KVTFN... [More]
SEN / CTL	P62136		Serine/threonine-protein phosphatase PP1-alpha catalytic subunit		PPP1CA		0.61		0.42		6.01e-7		0.00000105		glycogen metabolic process,regulation of glycogen ... [More]		phosphoprotein phosphatase activity,protein serine... [More]		protein phosphatase type 1 complex,nucleus,nucleop... [More]		24	29	46	IKYPENFFLLR.3\|AHQVVEDGYEFFAKR.3\|AHQVVEDGYEFFAKR.4\|... [More]
SEN / CTL	P35754		Glutaredoxin-1		GLRX		0.61		0.35		9.98e-7		0.00000167		nucleobase-containing small molecule interconversi... [More]		electron carrier activity,glutathione disulfide ox... [More]		nucleus,mitochondrion,cytosol,extracellular exosom... [More]		18	7	11	AQEILSQLPIK.2\|RAQEILSQLPIK.3\|RAQEILSQLPIK.2\|QGLLEF... [More]
SEN / CTL	P62424		60S ribosomal protein L7a		RPL7A		0.61		0.65		0.000181		0.000172		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleus,nucleolus,cytoplasm,cytosol,cell-cell adhe... [More]		15	31	43	AQLVVIAHDVDPIELVVFLPALC[CAM]R.3\|AQLVVIAHDVDPIELVVF... [More]
SEN / CTL	Q9BQE3		Tubulin alpha-1C chain		TUBA1C		0.61		0.23		0.000991		0.000756		cytoskeleton organization,microtubule-based proces... [More]		GTPase activity,structural molecule activity,struc... [More]		nucleus,cytoplasm,microtubule,vesicle		6	3	10	AVC[CAM]MLSNTTAVAEAWAR.3\|AVC[CAM]MLSNTTAVAEAWAR.2\|... [More]
SEN / CTL	P36957		Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial		DLST		0.61		0.96		0.00125		0.00092		generation of precursor metabolites and energy,tri... [More]		dihydrolipoyllysine-residue succinyltransferase ac... [More]		nucleus,mitochondrial matrix,membrane,myelin sheat... [More]		18	27	40	LGFMSAFVK.2\|LGFM[Oxi]SAFVK.2\|GLVVPVIR.2\|TPAFAESVTE... [More]
SEN / CTL	O43790 P78385 Q14533		Keratin, type II cuticular Hb6;Keratin, type II cuticular Hb3;Keratin, type II cuticular Hb1		KRT86 KRT83 KRT81		0.61		2.27		0.00462		0.00279		;aging,epidermis development,hair cycle;		structural molecule activity,protein binding;struc... [More]		extracellular space,keratin filament,extracellular... [More]		18	6	6	LGLDIEIATYR.2\|DVDC[CAM]AYLR.2\|ATAENEFVALKK.3\|FAAFI... [More]
SEN / CTL	P40121		Macrophage-capping protein		CAPG		0.59		0.8		0.0000674		0.0000703		protein complex assembly,barbed-end actin filament... [More]		actin binding,protein binding,protein domain speci... [More]		nucleus,nucleoplasm,nucleolus,cytoplasm,centriole,... [More]		33	22	39	QAALQVAEGFISR.2\|QAALQVAEGFISR.3\|VADSSPFALELLISDDC[... [More]
SEN / CTL	P0CG39		POTE ankyrin domain family member J		POTEJ		0.59		0.12		0.0138		0.00687		retina homeostasis				extracellular space,extracellular exosome		3	2	3	LC[CAM]YVALDFEQEMAMVASSSSLEK.3\|LC[CAM]YVALDFEQEMAM... [More]
SEN / CTL	Q96BW5		Phosphotriesterase-related protein		PTER		0.59		1.58		0.0454		0.0185		catabolic process,epithelial cell differentiation		molecular_function,zinc ion binding,hydrolase acti... [More]		extracellular exosome		36	18	21	VQTVLGLVEPSKLGR.3\|AMSVEQLTDVLMNEILHGADGTSIK.3\|ILQE... [More]
SEN / CTL	Q92542		Nicastrin		NCSTN		0.59		0.83		0.0714		0.027		myeloid cell homeostasis,proteolysis,membrane prot... [More]		endopeptidase activity,protein binding		lysosomal membrane,endoplasmic reticulum,Golgi app... [More]		6	10	12	LLYGFLIK.2\|ALADVATVLGR.2\|APDVTTLPR.2\|ADVLFIAPR.2\|S... [More]
SEN / CTL	Q09666		Neuroblast differentiation-associated protein AHNAK		AHNAK		0.58		0.75		1.22e-32		4.11e-31		regulation of RNA splicing,protein oligomerization... [More]		protein binding,S100 protein binding,poly(A) RNA b... [More]		nucleus,cytoplasm,lysosomal membrane,cytosol,plasm... [More]		447	433	666	ISMPDLDLNLKGPK.3\|ISMPDLDLNLKGPK.2\|ISIPDVDLDLKGPK.3... [More]
SEN / CTL	P17987		T-complex protein 1 subunit alpha		TCP1		0.58		0.32		2.56e-10		8.86e-10		protein folding,tubulin complex assembly,binding o... [More]		protein binding,ATP binding,ubiquitin protein liga... [More]		pericentriolar material,acrosomal vesicle,zona pel... [More]		48	42	75	EQLAIAEFAR.2\|TSASIILR.2\|IAC[CAM]LDFSLQK.2\|IC[CAM]D... [More]
SEN / CTL	Q9Y678		Coatomer subunit gamma-1		COPG1		0.58		0.39		0.0000403		0.0000438		intracellular protein transport,ER to Golgi vesicl... [More]		structural molecule activity		Golgi membrane,endoplasmic reticulum membrane,Golg... [More]		15	60	99	TLEEAVGNIVK.2\|SIATLAITTLLK.2\|SIATLAITTLLK.3\|FGAQNE... [More]
SEN / CTL	Q9Y6U3		Adseverin		SCIN		0.58		0.93		0.00386		0.00242		negative regulation of cell proliferation,calcium ... [More]		phosphatidylserine binding,actin binding,calcium i... [More]		cytoplasm,cytoskeleton,brush border,cell cortex,pr... [More]		12	34	43	LYMVSDASGSMR.2\|GASQEEEKGAEYVASVLK.3\|NTQIQVLPEGGETP... [More]
SEN / CTL	P15289		Arylsulfatase A		ARSA		0.57		0.26		3.6e-8		7.98e-8		glycosphingolipid metabolic process,post-translati... [More]		arylsulfatase activity,cerebroside-sulfatase activ... [More]		lysosome,endoplasmic reticulum lumen,lysosomal lum... [More]		18	9	16	GGLPLEEVTVAEVLAAR.2\|GGLPLEEVTVAEVLAAR.3\|QSLFFYPSYP... [More]
SEN / CTL	O00154		Cytosolic acyl coenzyme A thioester hydrolase		ACOT7		0.57		0.3		0.00000171		0.00000269		coenzyme A biosynthetic process,long-chain fatty-a... [More]		fatty-acyl-CoA binding,protein binding,palmitoyl-C... [More]		nucleoplasm,cytoplasm,mitochondrion,cytosol,extrac... [More]		18	22	42	ATLWYVPLSLK.2\|MIEEAGAIISTR.2\|MIEEAGAIISTR.3\|M[Oxi]... [More]
SEN / CTL	P54136		Arginine--tRNA ligase, cytoplasmic		RARS		0.57		0.74		0.00000909		0.0000119		tRNA aminoacylation for protein translation,arginy... [More]		tRNA binding,arginine-tRNA ligase activity,protein... [More]		nucleoplasm,cytoplasm,mitochondrion,cytosol,cell-c... [More]		27	61	93	IVFVPGC[CAM]SIPLTIVK.2\|IVFVPGC[CAM]SIPLTIVK.3\|LMDL... [More]
SEN / CTL	O75348		V-type proton ATPase subunit G 1		ATP6V1G1		0.57		0.36		0.0000729		0.0000751		insulin receptor signaling pathway,regulation of m... [More]		protein binding,hydrogen-exporting ATPase activity... [More]		lysosomal membrane,cytosol,plasma membrane,vacuola... [More]		9	8	13	MTILQTYFR.2\|M[Oxi]TILQTYFR.2\|QNRDEVLDNLLAFVC[CAM]D... [More]
SEN / CTL	P62140		Serine/threonine-protein phosphatase PP1-beta catalytic subunit		PPP1CB		0.57		0.31		0.0115		0.00598		G2/M transition of mitotic cell cycle,glycogen met... [More]		protein binding,phosphatase activity,myosin phosph... [More]		protein phosphatase type 1 complex,nucleus,nucleop... [More]		6	11	14	IVQMTEAEVR.2\|IVQM[Oxi]TEAEVR.2\|FLNRHDLDLIC[CAM]R.3... [More]
SEN / CTL	P22307		Non-specific lipid-transfer protein		SCP2		0.57		0.96		0.0341		0.0146		bile acid biosynthetic process,peroxisome organiza... [More]		fatty-acyl-CoA binding,receptor binding,protein bi... [More]		nucleoplasm,cytoplasm,mitochondrion,peroxisome,per... [More]		6	34	57	IGGIFAFK.2\|EATWVVDVK.2\|DYPDLAEEAGKK.3\|DYPDLAEEAGKK... [More]
SEN / CTL	P55084		Trifunctional enzyme subunit beta, mitochondrial		HADHB		0.56		0.41		0.0000173		0.0000207		fatty acid beta-oxidation,cardiolipin acyl-chain r... [More]		3-hydroxyacyl-CoA dehydrogenase activity,acetyl-Co... [More]		mitochondrion,mitochondrial envelope,mitochondrial... [More]		15	41	75	LAAAFAVSR.2\|FNNWGGSLSLGHPFGATGC[CAM]R.3\|FNNWGGSLSL... [More]
SEN / CTL	P50991		T-complex protein 1 subunit delta		CCT4		0.56		0.79		0.0000697		0.0000723		protein folding,binding of sperm to zona pellucida... [More]		ATP binding,poly(A) RNA binding,unfolded protein b... [More]		zona pellucida receptor complex,nucleoplasm,cytopl... [More]		51	44	86	VIDPATATSVDLRDIK.3\|ALIAGGGAPEIELALR.2\|ALIAGGGAPEIE... [More]
SEN / CTL	P28482		Mitogen-activated protein kinase 1		MAPK1		0.56		0.28		0.000168		0.000161		MAPK cascade,activation of MAPK activity,MAPK impo... [More]		phosphotyrosine binding,DNA binding,protein serine... [More]		nucleus,nucleoplasm,cytoplasm,mitochondrion,early ... [More]		12	27	46	LKELIFEETAR.3\|LKELIFEETAR.2\|VADPDHDHTGFLTEYVATR.4\|... [More]
SEN / CTL	P36542		ATP synthase subunit gamma, mitochondrial		ATP5C1		0.56		1.45		0.00446		0.0027		oxidative phosphorylation,ATP biosynthetic process... [More]		transmembrane transporter activity,poly(A) RNA bin... [More]		mitochondrial proton-transporting ATP synthase com... [More]		15	21	34	IYGLGSLALYEK.2\|IYGLGSLALYEK.3\|EVMLVGIGDKIR.3\|THSDQ... [More]
SEN / CTL	P22392		Nucleoside diphosphate kinase B		NME2		0.56		0.55		0.0864		0.0319		negative regulation of myeloid leukocyte different... [More]		DNA binding,transcription factor activity, sequenc... [More]		ruffle,nucleus,cytoplasm,cytosol,intermediate fila... [More]		18	19	36	GDFC[CAM]IQVGR.2\|SC[CAM]AHDWVYE.2\|SAEKEISLWFKPEELV... [More]
SEN / CTL	Q14764		Major vault protein		MVP		0.55		0.75		7.9e-15		4.54e-14		protein transport,negative regulation of signaling... [More]		protein binding,protein kinase binding,protein pho... [More]		nucleus,nuclear pore,cytoplasm,cytoskeleton,membra... [More]		168	78	128	SFFLQPGEQLEQGIQDVYVLSEQQGLLLR.3\|SFFLQPGEQLEQGIQDVY... [More]
SEN / CTL	Q7KZF4		Staphylococcal nuclease domain-containing protein 1		SND1		0.55		0.55		0.0000272		0.0000309		osteoblast differentiation,transcription, DNA-temp... [More]		transcription cofactor activity,nuclease activity,... [More]		nucleus,cytoplasm,mitochondrion,cell-cell adherens... [More]		39	71	115	QFLPFLQR.2\|ETC[CAM]LITFLLAGIEC[CAM]PR.3\|ETC[CAM]LI... [More]
SEN / CTL	P62879		Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2		GNB2		0.55		0.26		0.00112		0.000834		protein folding,G-protein coupled receptor signali... [More]		GTPase activity,signal transducer activity,calcium... [More]		extracellular space,lysosomal membrane,cytosol,pla... [More]		9	15	25	TFVSGAC[CAM]DASIK.2\|KAC[CAM]GDSTLTQITAGLDPVGR.3\|KA... [More]
SEN / CTL	P08670		Vimentin		VIM		0.54		1.17		2.04e-19		2.12e-18		movement of cell or subcellular component,positive... [More]		glycoprotein binding,double-stranded RNA binding,s... [More]		cytoplasm,peroxisome,cytosol,cytoskeleton,intermed... [More]		336	92	187	ILLAELEQLKGQGK.3\|ILLAELEQLKGQGK.2\|ISLPLPNFSSLNLR.2... [More]
SEN / CTL	P51452		Dual specificity protein phosphatase 3		DUSP3		0.54		0.33		0.0000113		0.0000145		inactivation of MAPK activity,in utero embryonic d... [More]		protein tyrosine phosphatase activity,protein tyro... [More]		immunological synapse,nucleus,nucleoplasm,cytoplas... [More]		12	10	15	LGITHVLNAAEGR.3\|LGITHVLNAAEGR.2\|SPTLVIAYLMMR.2\|SPT... [More]
SEN / CTL	P04843		Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1		RPN1		0.54		1.21		0.000817		0.00064		cellular protein modification process,protein N-li... [More]		protein binding,poly(A) RNA binding,dolichyl-dipho... [More]		endoplasmic reticulum membrane,rough endoplasmic r... [More]		21	48	79	ALTSEIALLQSR.2\|ALTSEIALLQSR.3\|FFTVKLPVALDPGAK.3\|ID... [More]
SEN / CTL	Q13596		Sorting nexin-1		SNX1		0.54		0.23		0.000969		0.00075		intracellular protein transport,vesicle organizati... [More]		epidermal growth factor receptor binding,insulin r... [More]		cytoplasm,Golgi apparatus,cytosol,cell-cell adhere... [More]		6	24	29	YWEAFLPEAK.2\|AVGTQTLSGAGLLK.2\|VKVGKEDSSSAEFLEK.4\|V... [More]
SEN / CTL	O14936		Peripheral plasma membrane protein CASK		CASK		0.54		0.8		0.00694		0.00396		negative regulation of cell-matrix adhesion,protei... [More]		guanylate kinase activity,protein serine/threonine... [More]		basement membrane,nuclear lamina,nucleolus,cytopla... [More]		9	32	43	ITVYEALNHPWLK.3\|ITVYEALNHPWLK.2\|IHEQGLIAILDVEPQALK... [More]
SEN / CTL	P63167 Q96FJ2		Dynein light chain 1, cytoplasmic;Dynein light chain 2, cytoplasmic		DYNLL1 DYNLL2		0.54		0.19		0.0255		0.0116		G2/M transition of mitotic cell cycle,transcriptio... [More]		motor activity,protein binding;motor activity,cyto... [More]		kinetochore,nucleus,cytoplasm,mitochondrion,centro... [More]		3	1	2	YNPTWHC[CAM]IVGR.3\|YNPTWHC[CAM]IVGR.2
SEN / CTL	P10301		Ras-related protein R-Ras		RRAS		0.54		0.69		0.146		0.0479		leukocyte differentiation,Ras protein signal trans... [More]		GTPase activity,protein binding,GTP binding,GDP bi... [More]		intracellular,plasma membrane,focal adhesion,extra... [More]		9	13	15	LVVVGGGGVGK.2\|LNVDEAFEQLVR.2\|SEASAFGASHHVAYFEASAK.... [More]
SEN / CTL	P30085		UMP-CMP kinase		CMPK1		0.53		0.5		0.00000106		0.00000176		nucleoside diphosphate phosphorylation,'de novo' p... [More]		cytidylate kinase activity,nucleoside diphosphate ... [More]		nucleus,cytoplasm,cytosol,extracellular exosome		30	19	38	FLIDGFPR.2\|IVPVEITISLLKR.3\|IVPVEITISLLKR.2\|SVDEVFD... [More]
SEN / CTL	Q2TAA2		Isoamyl acetate-hydrolyzing esterase 1 homolog		IAH1		0.53		0.27		0.00058		0.000474		lipid catabolic process		hydrolase activity		extracellular exosome		9	7	10	VSSLPLLLPYWR.2\|DVAEAKPELSLLGDGDH.3\|DVAEAKPELSLLGDG... [More]
SEN / CTL	Q9UEY8		Gamma-adducin		ADD3		0.53		0.47		0.00233		0.00157		cytoskeleton organization,transmembrane transport		actin binding,structural constituent of cytoskelet... [More]		condensed nuclear chromosome,nucleoplasm,cytoplasm... [More]		9	31	36	GLSFSEATASNLVK.2\|VGEIEFEGLMR.2\|YFDRINENDPEYIRER.4\|... [More]
SEN / CTL	Q06323		Proteasome activator complex subunit 1		PSME1		0.52		0.65		0.00000115		0.00000189		MAPK cascade,protein polyubiquitination,stimulator... [More]		endopeptidase activator activity		proteasome complex,nucleoplasm,cytoplasm,cytosol,p... [More]		42	26	39	IEDGNNFGVAVQEK.2\|TENLLGSYFPK.2\|IVVLLQR.2\|QLVHELDEA... [More]
SEN / CTL	Q99439		Calponin-2		CNN2		0.52		0.47		0.00000192		0.00000298		cytoskeleton organization,actomyosin structure org... [More]		actin binding,calmodulin binding,cadherin binding ... [More]		stress fiber,cytoskeleton,cell-cell junction,cell-... [More]		24	17	33	TWIEGLTGLSIGPDFQK.2\|TWIEGLTGLSIGPDFQK.3\|GLKDGTILC[... [More]
SEN / CTL	A6NGU5 P19440 P36268		Putative gamma-glutamyltranspeptidase 3;Gamma-glutamyltranspeptidase 1;Inactive gamma-glutamyltranspeptidase 2		GGT3P GGT1 GGT2		0.52		0.48		0.00154		0.00111		proteolysis,glutathione metabolic process,glutathi... [More]		gamma-glutamyltransferase activity,glutathione hyd... [More]		integral component of membrane,anchored component ... [More]		9	3	3	LFQPSIQLAR.2\|NIDQAVTAALETR.2\|FVDVTEVVR.2
SEN / CTL	Q14344		Guanine nucleotide-binding protein subunit alpha-13		GNA13		0.52		0.26		0.00418		0.00256		patterning of blood vessels,in utero embryonic dev... [More]		GTPase activity,signal transducer activity,protein... [More]		nucleus,cytoplasm,heterotrimeric G-protein complex... [More]		6	19	25	ILLLGAGESGK.2\|VFLQYLPAIR.2\|IIHGQDFDQR.3\|IIHGQDFDQR... [More]
SEN / CTL	P36776		Lon protease homolog, mitochondrial		LONP1		0.52		1.23		0.00683		0.00392		mitochondrial genome maintenance,response to hypox... [More]		single-stranded DNA binding,single-stranded RNA bi... [More]		nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch... [More]		12	52	82	ILC[CAM]FYGPPGVGK.2\|LSSDVLTLLIK.2\|ILEFIAVSQLR.2\|IL... [More]
SEN / CTL	P20674		Cytochrome c oxidase subunit 5A, mitochondrial		COX5A		0.52		0.42		0.0179		0.00856		mitochondrial electron transport, cytochrome c to ... [More]		cytochrome-c oxidase activity,electron carrier act... [More]		mitochondrial inner membrane,mitochondrial respira... [More]		6	11	21	WVTYFNKPDIDAWELRK.4\|WVTYFNKPDIDAWELRK.3\|WVTYFNKPDI... [More]
SEN / CTL	P31040		Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial		SDHA		0.52		0.59		0.0987		0.0354		tricarboxylic acid cycle,succinate metabolic proce... [More]		protein binding,succinate dehydrogenase (ubiquinon... [More]		mitochondrion,mitochondrial inner membrane,mitocho... [More]		9	38	71	LGANSLLDLVVFGR.2\|LGANSLLDLVVFGR.3\|TYFSC[CAM]TSAHTS... [More]
SEN / CTL	P32119		Peroxiredoxin-2		PRDX2		0.51		0.52		9.74e-10		2.98e-9		response to reactive oxygen species,response to ox... [More]		thioredoxin peroxidase activity,antioxidant activi... [More]		cytoplasm,cytosol,extracellular exosome		57	24	40	GLFIIDGK.2\|LSEDYGVLKTDEGIAYR.3\|KEGGLGPLNIPLLADVTR.... [More]
SEN / CTL	P07339		Cathepsin D		CTSD		0.51		0.81		0.00000927		0.000012		proteolysis,autophagy,antigen processing and prese... [More]		aspartic-type endopeptidase activity,cysteine-type... [More]		extracellular region,extracellular space,lysosome,... [More]		42	30	62	VSTLPAITLK.2\|FDGILGMAYPR.2\|FDGILGM[Oxi]AYPR.2\|QVFG... [More]
SEN / CTL	P21281		V-type proton ATPase subunit B, brain isoform		ATP6V1B2		0.51		0.47		0.0000187		0.0000222		insulin receptor signaling pathway,ATP hydrolysis ... [More]		ATP binding,hydrogen ion transmembrane transporter... [More]		ruffle,lysosomal membrane,cytosol,plasma membrane,... [More]		24	28	43	IYPEEMIQTGISAIDGMNSIAR.3\|TVFETLDIGWQLLR.2\|TVFETLDI... [More]
SEN / CTL	O43776		Asparagine--tRNA ligase, cytoplasmic		NARS		0.51		0.79		0.0017		0.0012		tRNA aminoacylation for protein translation,aspara... [More]		nucleic acid binding,asparagine-tRNA ligase activi... [More]		cytoplasm,mitochondrion,cytosol,extracellular exos... [More]		21	33	60	FLTWILNR.2\|IFDSEEILAGYKR.3\|IFDSEEILAGYKR.2\|NLMFLVL... [More]
SEN / CTL	Q8NHP8		Putative phospholipase B-like 2		PLBD2		0.51		1.72		0.0502		0.0201		lipid catabolic process		hydrolase activity		lysosomal lumen,extracellular exosome		15	15	20	YNDFLHDPLSLC[CAM]K.3\|YNDFLHDPLSLC[CAM]K.2\|LASDGATW... [More]
SEN / CTL	Q9Y2Q5		Ragulator complex protein LAMTOR2		LAMTOR2		0.51		0.17		0.0511		0.0204		MAPK cascade,activation of MAPKK activity,cell cyc... [More]		protein binding,guanyl-nucleotide exchange factor ... [More]		lysosomal membrane,late endosome,endosome membrane... [More]		3	9	12	FILMDC[CAM]MEGR.2\|ETVGFGMLK.2\|VTAAIASNIWAAYDR.3\|VT... [More]
SEN / CTL	Q9NR28		Diablo homolog, mitochondrial		DIABLO		0.51		0.98		0.0878		0.0322		apoptotic process,activation of cysteine-type endo... [More]		protein binding		mitochondrion,mitochondrial intermembrane space,cy... [More]		12	12	19	AVYTLTSLYR.2\|LQVEEVHQLSR.3\|LQVEEVHQLSR.2\|TQEEGEER.... [More]
SEN / CTL	P62266		40S ribosomal protein S23		RPS23		0.51		0.35		0.124		0.0422		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,protein binding... [More]		nucleoplasm,nucleolus,cytoplasm,cytosol,ribosome,m... [More]		3	11	14	VANVSLLALYK.2\|AHLGTALK.2\|KGHAVGDIPGVR.3\|KGHAVGDIPG... [More]
SEN / CTL	Q92599		Septin-8		8-Sep		0.51		0.58		0.134		0.0448				protein binding,GTP binding		cytoplasm,cytoskeleton,myelin sheath		9	17	23	VNIIPIIAK.2\|LRPQTYDLQESNVQLK.3\|LRPQTYDLQESNVQLK.2\|... [More]
SEN / CTL	P07384		Calpain-1 catalytic subunit		CAPN1		0.5		0.4		1.78e-8		4.36e-8		proteolysis,positive regulation of cell proliferat... [More]		calcium-dependent cysteine-type endopeptidase acti... [More]		cytoplasm,mitochondrion,lysosome,cytosol,plasma me... [More]		54	51	72	EFTRLEIC[CAM]NLTPDALK.3\|LYELIITR.2\|DFFLANASR.2\|YLG... [More]
SEN / CTL	P35580		Myosin-10		MYH10		0.5		0.76		0.00000281		0.0000042		mitotic cytokinesis,in utero embryonic development... [More]		microfilament motor activity,actin binding,protein... [More]		stress fiber,nucleus,cytoplasm,mitochondrion,spind... [More]		60	183	307	AGKLDPHLVLDQLR.3\|AGKLDPHLVLDQLR.2\|LDPHLVLDQLR.2\|LD... [More]
SEN / CTL	Q9BUL8		Programmed cell death protein 10		PDCD10		0.5		0.15		0.000656		0.00053		angiogenesis,positive regulation of cell prolifera... [More]		protein binding,protein kinase binding,protein hom... [More]		Golgi membrane,cytoplasm,Golgi apparatus,cytosol,p... [More]		6	12	17	VNLSAAQTLR.2\|SVEVNFTESLLR.2\|ELLDTVNNVFKK.3\|ELLDTVN... [More]
SEN / CTL	O00232		26S proteasome non-ATPase regulatory subunit 12		PSMD12		0.5		0.73		0.00249		0.00165		MAPK cascade,protein polyubiquitination,stimulator... [More]				proteasome complex,nucleoplasm,cytoplasm,cytosol,p... [More]		15	37	54	IYVEIER.2\|LFTTMELMR.2\|LQEVIETLLSLEK.2\|LQEVIETLLSLE... [More]
SEN / CTL	P15880		40S ribosomal protein S2		RPS2		0.5		0.37		0.0319		0.0139		nuclear-transcribed mRNA catabolic process, nonsen... [More]		mRNA binding,structural constituent of ribosome,pr... [More]		nucleus,nucleoplasm,cytoplasm,cytosol,cell-cell ad... [More]		6	20	34	TYSYLTPDLWK.2\|KLLMMAGIDDC[CAM]YTSAR.3\|KLLMM[Oxi]AG... [More]
SEN / CTL	Q9NRX4		14 kDa phosphohistidine phosphatase		PHPT1		0.5		0.38		0.0368		0.0154		protein dephosphorylation,positive regulation of i... [More]		phosphoprotein phosphatase activity,phosphohistidi... [More]		cytosol,extracellular exosome		9	8	18	AKYPDYEVTWANDGY.2\|IHVYGYSMAYGPAQHAISTEK.4\|IHVYGYSM... [More]
SEN / CTL	P08727		Keratin, type I cytoskeletal 19		KRT19		0.49		0.6		6.17e-11		2.35e-10		Notch signaling pathway,viral process,response to ... [More]		structural constituent of cytoskeleton,protein bin... [More]		intermediate filament,plasma membrane,dystrophin-a... [More]		90	47	93	IVLQIDNAR.2\|DAEAWFTSR.2\|VLDELTLAR.2\|FGAQLAHIQALISG... [More]
SEN / CTL	Q14315		Filamin-C		FLNC		0.49		1.01		0.0000027		0.00000408		cell junction assembly,muscle fiber development		protein binding,cytoskeletal protein binding,ankyr... [More]		cytoplasm,cytosol,cytoskeleton,plasma membrane,foc... [More]		36	144	206	YGGDEIPYSPFR.2\|VAVGQEQAFSVNTR.2\|GVAGVPAEFSIWTR.2\|G... [More]
SEN / CTL	P53618		Coatomer subunit beta		COPB1		0.49		0.34		0.0000114		0.0000145		intracellular protein transport,ER to Golgi vesicl... [More]		structural molecule activity,protein binding		Golgi membrane,cytoplasm,endoplasmic reticulum mem... [More]		15	73	120	LKEAELLEPLMPAIR.3\|LKEAELLEPLM[Oxi]PAIR.3\|VLQDLVMDI... [More]
SEN / CTL	P11142		Heat shock cognate 71 kDa protein		HSPA8		0.49		0.89		0.000244		0.000221		mRNA splicing, via spliceosome,transcription, DNA-... [More]		G-protein coupled receptor binding,phosphatidylser... [More]		Prp19 complex,extracellular space,intracellular,nu... [More]		144	54	126	SQIHDIVLVGGSTR.3\|SQIHDIVLVGGSTR.2\|QATKDAGTIAGLNVLR... [More]
SEN / CTL	Q92878		DNA repair protein RAD50		RAD50		0.49		0.13		0.119		0.041		regulation of mitotic recombination,telomere maint... [More]		DNA binding,double-stranded telomeric DNA binding,... [More]		nuclear chromosome, telomeric region,nuclear chrom... [More]		3	75	89	VLASLIIR.2\|TTELVNK.2\|LEENIDNIKR.3\|GYEEEIIHFK.3\|NHN... [More]
SEN / CTL	P19367		Hexokinase-1		HK1		0.48		0.48		1.05e-10		3.95e-10		cellular glucose homeostasis,glycolytic process,gl... [More]		glucokinase activity,hexokinase activity,ATP bindi... [More]		mitochondrion,mitochondrial outer membrane,cytosol... [More]		63	46	62	SANLVAATLGAILNR.2\|SANLVAATLGAILNR.3\|TTVGVDGSLYK.2\|... [More]
SEN / CTL	Q15181		Inorganic pyrophosphatase		PPA1		0.48		0.43		8.74e-7		0.00000149		tRNA aminoacylation for protein translation,phosph... [More]		magnesium ion binding,inorganic diphosphatase acti... [More]		cytoplasm,cytosol,extracellular exosome		45	30	65	AAPFSLEYR.2\|LKPGYLEATVDWFRR.3\|LKPGYLEATVDWFRR.4\|YV... [More]
SEN / CTL	Q9NQR4		Omega-amidase NIT2		NIT2		0.48		0.37		0.00000133		0.00000217		oxaloacetate metabolic process,asparagine metaboli... [More]		omega-amidase activity		cytoplasm,mitochondrion,centrosome,extracellular e... [More]		30	28	39	FAELAQIYAQR.2\|FAELAQIYAQR.3\|VGLGIC[CAM]YDMR.2\|IVSL... [More]
SEN / CTL	P61204 P84077		ADP-ribosylation factor 3;ADP-ribosylation factor 1		ARF3 ARF1		0.48		0.47		0.00435		0.00265		phosphatidylinositol biosynthetic process,retrogra... [More]		GTPase activity,GTP binding;magnesium ion binding,... [More]		Golgi membrane,perinuclear region of cytoplasm,ext... [More]		9	3	10	ILMVGLDAAGK.2\|ILM[Oxi]VGLDAAGK.2\|NISFTVWDVGGQDKIRP... [More]
SEN / CTL	P49591		Serine--tRNA ligase, cytoplasmic		SARS		0.48		1.29		0.0303		0.0133		translation,tRNA aminoacylation for protein transl... [More]		RNA binding,serine-tRNA ligase activity,ATP bindin... [More]		cytoplasm,cytosol,extracellular exosome		21	41	63	VLDLDLFR.2\|LLIDEAILK.2\|KLDLEAWFPGSGAFR.3\|KLDLEAWFP... [More]
SEN / CTL	Q9UNF0		Protein kinase C and casein kinase substrate in neurons protein 2		PACSIN2		0.48		1.21		0.0599		0.0235		actin cytoskeleton organization,regulation of endo... [More]		transporter activity,protein binding,cytoskeletal ... [More]		nucleoplasm,cytoplasm,early endosome,cytosol,cytos... [More]		21	22	29	AYAQQLTEWAR.2\|AIYHDLEQSIR.3\|AIYHDLEQSIR.2\|HLDLSNVA... [More]
SEN / CTL	P06730		Eukaryotic translation initiation factor 4E		EIF4E		0.48		0.51		0.0968		0.0347		G1/S transition of mitotic cell cycle,nuclear-tran... [More]		RNA cap binding,translation initiation factor acti... [More]		cytoplasmic mRNA processing body,cytoplasm,cytosol... [More]		6	10	12	WLITLNK.2\|IAIWTTEC[CAM]ENR.2\|EAVTHIGR.2\|TWQANLR.2\|... [More]
SEN / CTL	P41250		Glycine--tRNA ligase		GARS		0.47		0.39		3.07e-8		6.98e-8		tRNA aminoacylation for protein translation,glycyl... [More]		bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) ... [More]		nucleoplasm,cytoplasm,mitochondrial matrix,cytosol... [More]		27	46	82	LLEFNQGKLPFAAAQIGNSFR.3\|TFFSFPAVVAPFK.2\|TFFSFPAVVA... [More]
SEN / CTL	Q9UJZ1		Stomatin-like protein 2, mitochondrial		STOML2		0.47		0.28		0.000399		0.000341		mitochondrial calcium ion transport,cellular calci... [More]		receptor binding,protein binding,GTPase binding,ca... [More]		mitochondrial inner membrane,mitochondrial interme... [More]		12	28	44	ILEPGLNILIPVLDR.2\|ILEPGLNILIPVLDR.3\|ESLNASIVDAINQA... [More]
SEN / CTL	P49773		Histidine triad nucleotide-binding protein 1		HINT1		0.47		0.74		0.00212		0.00145		transcription, DNA-templated,regulation of transcr... [More]		nucleotide binding,protein kinase C binding,hydrol... [More]		histone deacetylase complex,nucleus,cytoplasm,cyto... [More]		21	13	35	AQVARPGGDTIFGK.3\|AQVARPGGDTIFGK.2\|IIFEDDRC[CAM]LAF... [More]
SEN / CTL	P62491 Q15907		Ras-related protein Rab-11A;Ras-related protein Rab-11B		RAB11A RAB11B		0.47		0.26		0.00249		0.00165		cytokinesis,renal water homeostasis,mitotic metaph... [More]		GTPase activity,protein binding,GTP binding,microt... [More]		spindle pole,mitochondrion,multivesicular body,Gol... [More]		9	3	4	STIGVEFATR.2\|VVLIGDSGVGK.2\|GAVGALLVYDIAK.2\|GAVGALL... [More]
SEN / CTL	P31930		Cytochrome b-c1 complex subunit 1, mitochondrial		UQCRC1		0.47		0.97		0.00665		0.00384		oxidative phosphorylation,mitochondrial electron t... [More]		metalloendopeptidase activity,ubiquinol-cytochrome... [More]		mitochondrion,mitochondrial inner membrane,mitocho... [More]		9	36	66	IAEVDASVVR.2\|ADLTEYLSTHYKAPR.4\|ADLTEYLSTHYKAPR.3\|N... [More]
SEN / CTL	P35579		Myosin-9		MYH9		0.46		0.86		1.51e-19		1.69e-18		meiotic spindle organization,cytokinesis,angiogene... [More]		microfilament motor activity,motor activity,actin ... [More]		stress fiber,ruffle,uropod,nucleus,cytoplasm,spind... [More]		609	240	477	LQQELDDLLVDLDHQR.3\|LQQELDDLLVDLDHQR.2\|VSHLLGINVTDF... [More]
SEN / CTL	Q14847		LIM and SH3 domain protein 1		LASP1		0.46		0.37		3.66e-7		6.72e-7		ion transport,positive regulation of signal transd... [More]		SH3/SH2 adaptor activity,protein binding,zinc ion ... [More]		cytoplasm,cell-cell adherens junction,focal adhesi... [More]		36	20	35	GKGFSVVADTPELQR.3\|RPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGG... [More]
SEN / CTL	P06756		Integrin alpha-V		ITGAV		0.46		0.5		0.0011		0.000827		angiogenesis,antigen processing and presentation o... [More]		virus receptor activity,fibronectin binding,protea... [More]		plasma membrane,integral component of plasma membr... [More]		30	49	56	ILAC[CAM]APLYHWR.3\|IYIGDDNPLTLIVK.2\|GATDIDKNGYPDLI... [More]
SEN / CTL	Q5JTV8		Torsin-1A-interacting protein 1		TOR1AIP1		0.46		0.35		0.00274		0.0018		positive regulation of ATPase activity,protein loc... [More]		ATPase activator activity,lamin binding,cytoskelet... [More]		nucleus,nuclear inner membrane,integral component ... [More]		9	21	26	SQPAILLLTAAR.2\|SIQEAPVSEDLVIR.2\|ISHLVLPVQPENALKR.4... [More]
SEN / CTL	Q9ULV4		Coronin-1C		CORO1C		0.46		0.88		0.00447		0.0027		neural crest cell migration,regulation of protein ... [More]		protein binding,Rac GTPase binding,actin filament ... [More]		cytoplasm,focal adhesion,actin cytoskeleton,latera... [More]		27	36	54	VTWDSSFC[CAM]AVNPR.2\|NADPILISLK.2\|AIFLADGNVFTTGFSR... [More]
SEN / CTL	P62495		Eukaryotic peptide chain release factor subunit 1		ETF1		0.46		0.42		0.00519		0.0031		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,translation release factor activity,pr... [More]		cytoplasm,cytosol,nucleus		9	35	53	LSVLGAITSVQQR.2\|LSVLGAITSVQQR.3\|GFGGIGGILR.2\|FTVDL... [More]
SEN / CTL	Q9UHL4		Dipeptidyl peptidase 2		DPP7		0.46		1.04		0.0412		0.017		proteolysis		serine-type carboxypeptidase activity,serine-type ... [More]		lysosome,Golgi apparatus,cytosol,cytoplasmic, memb... [More]		15	18	27	GHTELLTVEQALADFAELLR.3\|DVTADFEGQSPK.2\|KLEATIIGEWVK... [More]
SEN / CTL	P29218		Inositol monophosphatase 1		IMPA1		0.46		1.3		0.0658		0.0252		inositol metabolic process,inositol biosynthetic p... [More]		magnesium ion binding,inositol monophosphate 1-pho... [More]		cytoplasm,cytosol,extracellular exosome		9	16	22	LFC[CAM]IPVHGIR.3\|LFC[CAM]IPVHGIR.2\|EIQVIPLQRDDED.... [More]
SEN / CTL	P62333		26S protease regulatory subunit 10B		PSMC6		0.45		0.35		0.0000027		0.00000408		MAPK cascade,protein polyubiquitination,stimulator... [More]		protein binding,ATP binding,ATPase activity,TBP-cl... [More]		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		21	28	44	ELREVIELPLTNPELFQR.3\|VVSSSIVDKYIGESAR.3\|HGEIDYEAIV... [More]
SEN / CTL	Q99460		26S proteasome non-ATPase regulatory subunit 1		PSMD1		0.45		0.38		0.00000279		0.00000418		MAPK cascade,protein polyubiquitination,stimulator... [More]		enzyme regulator activity,endopeptidase activity		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		30	60	102	QAIGIALETR.2\|VSTAVLSITAK.2\|AAVESLGFILFR.2\|AAVESLGF... [More]
SEN / CTL	P30041		Peroxiredoxin-6		PRDX6		0.45		0.7		0.000261		0.000235		response to reactive oxygen species,lipid cataboli... [More]		glutathione peroxidase activity,protein binding,hy... [More]		extracellular space,cytoplasm,lysosome,cytosol,cel... [More]		45	31	62	NFDEILR.2\|FHDFLGDSWGILFSHPR.3\|FHDFLGDSWGILFSHPR.4\|... [More]
SEN / CTL	Q92597		Protein NDRG1		NDRG1		0.45		0.73		0.00586		0.00345		negative regulation of cell proliferation,response... [More]		protein binding,microtubule binding,Rab GTPase bin... [More]		nucleus,cytoplasm,centrosome,cytosol,microtubule,p... [More]		15	18	49	SIIGMGTGAGAYILTR.2\|SIIGMGTGAGAYILTR.3\|SIIGM[Oxi]GT... [More]
SEN / CTL	Q9UHD8		Septin-9		9-Sep		0.45		1.55		0.0268		0.0121		cell cycle,protein heterooligomerization,cell divi... [More]		GTPase activity,protein binding,GTP binding,cadher... [More]		stress fiber,cytoplasm,microtubule,cell-cell adher... [More]		30	46	76	YLQEEVNINR.2\|STLINTLFK.2\|ADTLTLEER.2\|RTELSIDISSK.2... [More]
SEN / CTL	Q15019		Septin-2		2-Sep		0.44		0.37		4.25e-14		2.25e-13		regulation of L-glutamate transport,mitotic nuclea... [More]		protein binding,GTP binding,enzyme regulator activ... [More]		exocyst,condensed chromosome kinetochore,nucleus,n... [More]		57	30	53	STLINSLFLTDLYPER.2\|STLINSLFLTDLYPER.3\|TIISYIDEQFER... [More]
SEN / CTL	P49368		T-complex protein 1 subunit gamma		CCT3		0.44		0.69		1.41e-7		2.74e-7		protein folding,binding of sperm to zona pellucida... [More]		protein binding,ATP binding,protein binding involv... [More]		zona pellucida receptor complex,cytoplasm,cytosol,... [More]		72	49	102	TAVETAVLLLR.2\|IVLLDSSLEYK.2\|AVAQALEVIPR.2\|ELGIWEPL... [More]
SEN / CTL	P46782		40S ribosomal protein S5		RPS5		0.44		0.36		0.000311		0.000274		ribosomal small subunit assembly,nuclear-transcrib... [More]		RNA binding,mRNA binding,structural constituent of... [More]		nucleoplasm,cytosol,focal adhesion,membrane,cytoso... [More]		12	15	20	TIAEC[CAM]LADELINAAK.2\|TIAEC[CAM]LADELINAAK.3\|VNQA... [More]
SEN / CTL	Q9C0C2		182 kDa tankyrase-1-binding protein		TNKS1BP1		0.44		0.58		0.00373		0.00238		nuclear-transcribed mRNA poly(A) tail shortening,D... [More]		enzyme binding,ankyrin binding,cadherin binding in... [More]		nucleus,nucleoplasm,nuclear telomeric heterochroma... [More]		21	62	73	FAATTVEEILAK.2\|SQEADVQDWEFR.2\|EMEEELVPTGSEPGDTR.2\|... [More]
SEN / CTL	O75340		Programmed cell death protein 6		PDCD6		0.44		0.69		0.0177		0.0085		angiogenesis,positive regulation of endothelial ce... [More]		calcium-dependent cysteine-type endopeptidase acti... [More]		nucleus,cytoplasm,endosome,endoplasmic reticulum,e... [More]		9	13	19	AGVNFSEFTGVWK.2\|LSDQFHDILIR.3\|LSDQFHDILIR.2\|SIISMF... [More]
SEN / CTL	Q07812		Apoptosis regulator BAX		BAX		0.44		0.46		0.0185		0.00884		ovarian follicle development,neuron migration,T ce... [More]		protein binding,lipid binding,channel activity,ide... [More]		nucleus,nuclear envelope,cytoplasm,mitochondrion,m... [More]		9	8	14	TGALLLQGFIQDR.2\|IGDELDSNMELQR.2\|IGDELDSNM[Oxi]ELQR... [More]
SEN / CTL	P63010		AP-2 complex subunit beta		AP2B1		0.43		0.43		1.01e-11		4.2e-11		ventricular septum development,intracellular prote... [More]		signal sequence binding,protein binding,protein tr... [More]		trans-Golgi network,cytosol,plasma membrane,membra... [More]		42	43	83	IQPGNPNYTLSLK.2\|LASQANIAQVLAELKEYATEVDVDFVR.4\|LASQ... [More]
SEN / CTL	P46821		Microtubule-associated protein 1B		MAP1B		0.43		0.51		3.6e-9		1.01e-8		microtubule bundle formation,cellular process,dend... [More]		structural molecule activity,protein binding,micro... [More]		photoreceptor outer segment,cytoplasm,cytosol,micr... [More]		63	110	158	TPEEGGYSYDISEK.2\|AIGNIELGIR.2\|SVNFSLTPNEIK.2\|TPEDG... [More]
SEN / CTL	P26373		60S ribosomal protein L13		RPL13		0.43		0.49		0.00861		0.00475		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleus,cytosol,membrane,cytosolic large ribosomal... [More]		9	22	35	TIGISVDPR.2\|GFSLEELR.2\|KGDSSAEELKLATQLTGPVMPVR.4\|K... [More]
SEN / CTL	O60506		Heterogeneous nuclear ribonucleoprotein Q		SYNCRIP		0.43		0.77		0.0147		0.00728		mRNA splicing, via spliceosome,osteoblast differen... [More]		nucleotide binding,RNA binding,poly(A) binding,pol... [More]		nucleus,nucleoplasm,endoplasmic reticulum,membrane... [More]		33	48	77	GYAFVTFC[CAM]TK.2\|DLFEDELVPLFEK.2\|DLFEDELVPLFEK.3\|... [More]
SEN / CTL	O76054 Q9UDX4		SEC14-like protein 2;SEC14-like protein 3		SEC14L2 SEC14L3		0.43		0.1		0.0154		0.00758		transcription, DNA-templated,transport,regulation ... [More]		transporter activity,phospholipid binding,vitamin ... [More]		nucleus,cytoplasm,integral component of membrane,e... [More]		3	1	1	FRENVQDVLPALPNPDDYFLLR.3
SEN / CTL	P49748		Very long-chain specific acyl-CoA dehydrogenase, mitochondrial		ACADVL		0.43		1.03		0.0233		0.0108		temperature homeostasis,fatty acid beta-oxidation,... [More]		fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti... [More]		nucleus,nucleolus,cytoplasm,mitochondrion,mitochon... [More]		12	44	76	ITAFVVER.2\|GIVNEQFLLQR.2\|GIVNEQFLLQR.3\|IFEGTNDILR.... [More]
SEN / CTL	Q99426		Tubulin-folding cofactor B		TBCB		0.43		0.52		0.0297		0.0132		nervous system development,cell differentiation		protein binding		nucleoplasm,cytoplasm,microtubule,microtubule cyto... [More]		6	20	26	RGTVMYVGLTDFKPGYWIGVR.4\|YTISQEAYDQRQDTVR.3\|SLTIAEF... [More]
SEN / CTL	Q04917		14-3-3 protein eta		YWHAH		0.43		0.53		0.0587		0.0231		regulation of sodium ion transport,glucocorticoid ... [More]		actin binding,insulin-like growth factor receptor ... [More]		cytoplasm,mitochondrion,cytosol,plasma membrane,in... [More]		18	18	35	AVTELNEPLSNEDRNLLSVAYK.3\|LAEQAERYDDMASAMK.3\|LAEQAE... [More]
SEN / CTL	Q15366		Poly(rC)-binding protein 2		PCBP2		0.43		1.07		0.0928		0.0336		mRNA splicing, via spliceosome,gene expression,mRN... [More]		RNA binding,protein binding,enzyme binding,ubiquit... [More]		nucleus,nucleoplasm,cytoplasm,cytosol,focal adhesi... [More]		24	23	57	AITIAGIPQSIIEC[CAM]VK.2\|AITIAGIPQSIIEC[CAM]VK.3\|II... [More]
SEN / CTL	P18124		60S ribosomal protein L7		RPL7		0.42		0.36		0.0007		0.000561		nuclear-transcribed mRNA catabolic process, nonsen... [More]		DNA binding,RNA binding,mRNA binding,structural co... [More]		nucleus,nucleolus,cytoplasm,cytosol,focal adhesion... [More]		12	24	42	IALTDNALIAR.2\|IVEPYIAWGYPNLK.2\|IVEPYIAWGYPNLK.3\|FK... [More]
SEN / CTL	Q7Z304		MAM domain-containing protein 2		MAMDC2		0.42		0.2		0.0852		0.0315						proteinaceous extracellular matrix,endoplasmic ret... [More]		3	1	1	AGDHTTGLGYYLLANTK.3
SEN / CTL	P32969		60S ribosomal protein L9		RPL9		0.42		1.02		0.131		0.0443		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleus,nucleolus,cytoplasm,cytosol,ribosome,focal... [More]		6	15	30	FLDGIYVSEK.2\|DFNHINVELSLLGK.3\|DFNHINVELSLLGK.2\|GTV... [More]
SEN / CTL	P02545		Prelamin-A/C		LMNA		0.41		1.29		1.28e-9		3.75e-9		mitotic nuclear envelope disassembly,mitotic nucle... [More]		structural molecule activity,protein binding		nucleus,nuclear envelope,lamin filament,nucleoplas... [More]		144	85	142	VAVEEVDEEGKFVR.3\|VAVEEVDEEGKFVR.2\|LADALQELR.2\|EAAL... [More]
SEN / CTL	P08865		40S ribosomal protein SA		RPSA		0.41		0.34		0.0000149		0.000018		ribosomal small subunit assembly,nuclear-transcrib... [More]		virus receptor activity,structural constituent of ... [More]		nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr... [More]		21	21	46	AIVAIENPADVSVISSR.2\|AIVAIENPADVSVISSR.3\|FTPGTFTNQI... [More]
SEN / CTL	Q58FF8		Putative heat shock protein HSP 90-beta 2		HSP90AB2P		0.41		0.25		0.00195		0.00135		protein folding,response to stress,biological_proc... [More]		molecular_function,ATP binding,unfolded protein bi... [More]		cytoplasm,extracellular exosome		9	2	6	HSQFLGYPITLYLEKER.4\|HSQFLGYPITLYLEKER.3\|HSQFLGYPIT... [More]
SEN / CTL	Q92973		Transportin-1		TNPO1		0.41		0.32		0.00394		0.00244		protein import into nucleus, docking,protein impor... [More]		protein binding,nuclear localization sequence bind... [More]		nucleus,cytoplasm,cytosol,nuclear membrane,nuclear... [More]		9	43	65	TLLENTAITIGR.2\|QSSFALLGDLTK.2\|ALVMLLEVR.2\|ATVGILIT... [More]
SEN / CTL	Q99733		Nucleosome assembly protein 1-like 4		NAP1L4		0.41		0.26		0.00988		0.00526		nucleosome assembly		poly(A) RNA binding,unfolded protein binding		nucleus,cytoplasm		9	18	26	GIPEFWFTIFR.2\|YAALYQPLFDK.2\|NVDMLSELVQEYDEPILK.3\|N... [More]
SEN / CTL	Q01082		Spectrin beta chain, non-erythrocytic 1		SPTBN1		0.4		0.61		3.37e-23		5.35e-22		MAPK cascade,mitotic cytokinesis,ER to Golgi vesic... [More]		actin binding,Ras guanyl-nucleotide exchange facto... [More]		nucleolus,cytoplasm,cytosol,cell-cell adherens jun... [More]		294	217	362	SQNIVTDSSSLSAEAIR.3\|SQNIVTDSSSLSAEAIR.2\|LTTLELLEVR... [More]
SEN / CTL	P23381		Tryptophan--tRNA ligase, cytoplasmic		WARS		0.4		0.54		3.96e-7		7.13e-7		angiogenesis,translation,tRNA aminoacylation for p... [More]		tryptophan-tRNA ligase activity,protein binding,AT... [More]		nucleus,cytoplasm,cytosol,extracellular exosome		36	36	61	GIFGFTDSDC[CAM]IGK.2\|ALIEVLQPLIAEHQAR.3\|ALIEVLQPLI... [More]
SEN / CTL	P47755		F-actin-capping protein subunit alpha-2		CAPZA2		0.4		0.27		0.0000359		0.0000393		protein complex assembly,movement of cell or subce... [More]		actin binding		extracellular region,cytosol,brush border,F-actin ... [More]		15	16	29	FTITPSTTQVVGILK.2\|FTITPSTTQVVGILK.3\|EATDPRPC[CAM]E... [More]
SEN / CTL	Q14651		Plastin-1		PLS1		0.4		0.36		0.000737		0.000582		intestinal D-glucose absorption,regulation of micr... [More]		structural constituent of cytoskeleton,calcium ion... [More]		cytoplasm,actin filament,brush border,actin filame... [More]		15	37	50	SISTSLPVLDLIDAIAPNAVR.3\|SISTSLPVLDLIDAIAPNAVR.2\|MI... [More]
SEN / CTL	Q14203		Dynactin subunit 1		DCTN1		0.4		1.54		0.0101		0.00536		G2/M transition of mitotic cell cycle,ER to Golgi ... [More]		motor activity,protein binding,microtubule binding... [More]		kinetochore,spindle pole,nuclear envelope,cytoplas... [More]		24	74	109	WVGVILDEAK.2\|VTFSC[CAM]AAGFGQR.2\|VTFSC[CAM]AAGFGQR... [More]
SEN / CTL	P07900		Heat shock protein HSP 90-alpha		HSP90AA1		0.4		0.8		0.144		0.0473		G2/M transition of mitotic cell cycle,neuron migra... [More]		nucleotide binding,glycoprotein binding,UTP bindin... [More]		extracellular region,nucleus,nucleoplasm,cytoplasm... [More]		105	69	151	ALLFVPR.2\|NPDDITNEEYGEFYK.2\|NPDDITNEEYGEFYK.3\|ELIS... [More]
SEN / CTL	P59998		Actin-related protein 2/3 complex subunit 4		ARPC4		0.39		0.34		0.0000102		0.0000131		actin filament polymerization,Arp2/3 complex-media... [More]		structural constituent of cytoskeleton,protein bin... [More]		cytosol,Arp2/3 protein complex,cell projection,ext... [More]		21	12	18	VLIEGSINSVR.2\|AENFFILR.2\|IVAEEFLK.2\|ELLLQPVTISR.2\|... [More]
SEN / CTL	Q96IU4		Alpha/beta hydrolase domain-containing protein 14B		ABHD14B		0.39		0.29		0.0000103		0.0000132		positive regulation of transcription from RNA poly... [More]		protein binding,hydrolase activity		nucleus,nucleolus,cytoplasm,cytosol,extracellular ... [More]		18	9	14	FSVLLLHGIR.2\|FSSETWQNLGTLHR.3\|FSSETWQNLGTLHR.2\|AVA... [More]
SEN / CTL	Q16181		Septin-7		7-Sep		0.39		0.46		0.0000127		0.0000158		cytokinesis,mitotic nuclear division,regulation of... [More]		structural molecule activity,protein binding,GTP b... [More]		condensed chromosome kinetochore,stress fiber,nucl... [More]		27	39	59	VNIIPLIAK.2\|THMQDLKDVTNNVHYENYR.4\|STLINSLFLTDLYSPE... [More]
SEN / CTL	Q08257		Quinone oxidoreductase		CRYZ		0.39		1.08		0.000225		0.000208		visual perception,xenobiotic catabolic process,pro... [More]		mRNA 3'-UTR binding,NADPH:quinone reductase activi... [More]		cytoplasm,cytosol,extracellular exosome		48	32	52	VFEFGGPEVLK.2\|VHAC[CAM]GVNPVETYIR.3\|VHAC[CAM]GVNPV... [More]
SEN / CTL	Q92499		ATP-dependent RNA helicase DDX1		DDX1		0.39		0.21		0.00198		0.00137		spliceosomal complex assembly,double-strand break ... [More]		DNA binding,chromatin binding,transcription cofact... [More]		nucleus,nucleoplasm,cytoplasm,cytoplasmic stress g... [More]		9	56	98	ELLIIGGVAAR.2\|FLIC[CAM]TDVAAR.2\|FLVLDEADGLLSQGYSDF... [More]
SEN / CTL	O95394		Phosphoacetylglucosamine mutase		PGM3		0.39		0.04		0.006		0.00353		carbohydrate metabolic process,glucosamine metabol... [More]		magnesium ion binding,phosphoacetylglucosamine mut... [More]		cellular_component,cytosol		3	32	47	MGLLAVLR.2\|AFVELTK.2\|AFVELTK.1\|AEHLDHVMFR.3\|AEHLDH... [More]
SEN / CTL	P24821		Tenascin		TNC		0.39		1		0.0181		0.00865		osteoblast differentiation,cell adhesion,negative ... [More]		syndecan binding		extracellular region,basement membrane,interstitia... [More]		18	77	105	VSIYGVIR.2\|ITAQGQYELR.2\|TAHISGLPPSTDFIVYLSGLAPSIR.... [More]
SEN / CTL	O43813		LanC-like protein 1		LANCL1		0.39		0.38		0.112		0.0389		G-protein coupled receptor signaling pathway		catalytic activity,G-protein coupled receptor acti... [More]		cytoplasm,extracellular exosome,integral component... [More]		9	22	31	SLAEGYFDAAGR.2\|ARFPAFEL.2\|IPQSHIQQIC[CAM]ETILTSGEN... [More]
SEN / CTL	Q9BSJ8		Extended synaptotagmin-1		ESYT1		0.38		0.62		7.91e-7		0.00000137		lipid transport		lipid binding,metal ion binding		plasma membrane,membrane,integral component of end... [More]		39	52	75	LTLWYYSEER.2\|LTTVLNSGFLDEWLTLEDVPSGR.3\|VQLDLAETDLS... [More]
SEN / CTL	P83731		60S ribosomal protein L24		RPL24		0.38		0.19		0.000203		0.00019		ribosomal large subunit assembly,nuclear-transcrib... [More]		RNA binding,structural constituent of ribosome,pro... [More]		cytoplasm,cytosol,cell-cell adherens junction,memb... [More]		9	10	16	QINWTVLYR.2\|AITGASLADIMAK.2\|AITGASLADIMAK.3\|AITGAS... [More]
SEN / CTL	Q16658		Fascin		FSCN1		0.38		0.53		0.000228		0.000208		cell-cell junction assembly,cell proliferation,ana... [More]		actin binding,drug binding,protein binding, bridgi... [More]		stress fiber,ruffle,podosome,cytoplasm,cytosol,cyt... [More]		48	44	69	YLTAEAFGFK.2\|NASC[CAM]YFDIEWR.2\|VGKDELFALEQSC[CAM]... [More]
SEN / CTL	P0DJI9		Serum amyloid A-2 protein		SAA2		0.38		0.35		0.123		0.042		acute-phase response,positive chemotaxis,cell chem... [More]		chemoattractant activity		extracellular space,high-density lipoprotein parti... [More]		3	2	3	RGPGGAWAAEVISNAR.3\|RGPGGAWAAEVISNAR.2\|GPGGAWAAEVIS... [More]
SEN / CTL	P40227		T-complex protein 1 subunit zeta		CCT6A		0.37		0.71		0.00000155		0.00000247		protein folding,positive regulation of telomere ma... [More]		protein binding,ATP binding,protein binding involv... [More]		cytoplasm,cytosol,chaperonin-containing T-complex,... [More]		63	42	77	ALQFLEEVKVSR.3\|VLAQNSGFDLQETLVK.3\|VLAQNSGFDLQETLVK... [More]
SEN / CTL	Q96HE7		ERO1-like protein alpha		ERO1L		0.37		0.53		0.000861		0.000672		response to reactive oxygen species,protein foldin... [More]		protein disulfide isomerase activity,protein disul... [More]		endoplasmic reticulum,endoplasmic reticulum lumen,... [More]		21	31	49	LLESDYFR.2\|LGAVDESLSEETQK.2\|YSEEANNLIEEC[CAM]EQAER... [More]
SEN / CTL	Q15691		Microtubule-associated protein RP/EB family member 1		MAPRE1		0.37		0.38		0.00185		0.00129		G2/M transition of mitotic cell cycle,sister chrom... [More]		protein binding,protein C-terminus binding,identic... [More]		cytoplasm,Golgi apparatus,centrosome,cytosol,micro... [More]		18	24	48	FFDANYDGKDYDPVAAR.3\|FFDANYDGKDYDPVAAR.2\|NIELIC[CAM... [More]
SEN / CTL	P61158		Actin-related protein 3		ACTR3		0.37		0.47		0.0121		0.00623		movement of cell or subcellular component,establis... [More]		structural constituent of cytoskeleton,ATP binding... [More]		cytosol,Arp2/3 protein complex,brush border,cell-c... [More]		48	34	61	LKLSEELSGGR.2\|LKPKPIDVQVITHHMQR.5\|LKPKPIDVQVITHHMQ... [More]
SEN / CTL	Q5TZA2		Rootletin		CROCC		0.37		0.08		0.0167		0.00816		cell cycle,protein localization,centriole-centriol... [More]		actin binding,structural molecule activity,protein... [More]		photoreceptor inner segment,cytoplasm,centrosome,c... [More]		3	10	11	LALLEEAR.2\|HSLATISLEMER.3\|HSLATISLEMER.2\|AEVAEALTK... [More]
SEN / CTL	P60842		Eukaryotic initiation factor 4A-I		EIF4A1		0.37		1.1		0.0422		0.0173		nuclear-transcribed mRNA poly(A) tail shortening,t... [More]		RNA cap binding,double-stranded RNA binding,mRNA b... [More]		cytoplasm,cytosol,membrane,eukaryotic translation ... [More]		51	39	86	VLITTDLLAR.2\|AEVQKLQMEAPHIIVGTPGR.4\|GIYAYGFEKPSAIQ... [More]
SEN / CTL	Q15233		Non-POU domain-containing octamer-binding protein		NONO		0.37		0.66		0.0664		0.0254		mRNA splicing, via spliceosome,DNA repair,DNA reco... [More]		nucleotide binding,transcription regulatory region... [More]		nucleus,nucleoplasm,nucleolus,membrane,nuclear mat... [More]		12	43	99	NLPQYVSNELLEEAFSVFGQVER.3\|FAC[CAM]HSASLTVR.3\|FAC[C... [More]
SEN / CTL	Q02878		60S ribosomal protein L6		RPL6		0.37		0.54		0.0681		0.0259		ribosomal large subunit assembly,nuclear-transcrib... [More]		DNA binding,RNA binding,structural constituent of ... [More]		nucleus,cytosol,cell-cell adherens junction,focal ... [More]		12	30	42	AIPQLQGYLR.2\|IKAIPQLQGYLR.3\|HQEGEIFDTEKEKYEITEQR.4... [More]
SEN / CTL	O75369		Filamin-B		FLNB		0.36		0.59		1.12e-17		9.14e-17		keratinocyte development,epithelial cell morphogen... [More]		actin binding,protein binding,poly(A) RNA binding,... [More]		stress fiber,cytoplasm,cytosol,plasma membrane,bru... [More]		252	210	349	LIALLEVLSQK.2\|SPFTVGVAAPLDLSK.2\|SPFTVGVAAPLDLSK.3\|... [More]
SEN / CTL	Q9NQC3		Reticulon-4		RTN4		0.36		0.48		0.0000649		0.0000684		apoptotic process,axonal fasciculation,cerebral co... [More]		protein binding,poly(A) RNA binding,cadherin bindi... [More]		intracellular,nuclear envelope,endoplasmic reticul... [More]		21	18	28	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR.4\|KPAAGLSAAPVPT... [More]
SEN / CTL	Q9NVA2		Septin-11		11-Sep		0.36		0.53		0.00027		0.000242		cell cycle,protein heterooligomerization,cell divi... [More]		protein binding,GTP binding		stress fiber,cytoplasm,cell junction,axon,dendriti... [More]		18	27	44	STLMDTLFNTKFESDPATHNEPGVR.4\|STLMDTLFNTKFESDPATHNEP... [More]
SEN / CTL	Q9Y5K6		CD2-associated protein		CD2AP		0.36		0.46		0.00967		0.00517		protein complex assembly,substrate-dependent cell ... [More]		vascular endothelial growth factor receptor bindin... [More]		ruffle,nucleolus,cytoplasm,plasma membrane,cell-ce... [More]		12	47	57	SVDFDSLTVR.2\|LGLFPSNFVK.2\|ANTTAFLTPLEIK.2\|ISTYGLPA... [More]
SEN / CTL	P17980		26S protease regulatory subunit 6A		PSMC3		0.36		0.91		0.0377		0.0157		MAPK cascade,protein polyubiquitination,blastocyst... [More]		transcription coactivator activity,transcription c... [More]		proteasome complex,cytoplasmic mRNA processing bod... [More]		15	35	62	VIAATNRVDILDPALLR.3\|VIAATNRVDILDPALLR.2\|LLDSEIK.2\|... [More]
SEN / CTL	P62314		Small nuclear ribonucleoprotein Sm D1		SNRPD1		0.36		0.42		0.0728		0.0274		spliceosomal complex assembly,spliceosomal snRNP a... [More]		RNA binding,protein binding,poly(A) RNA binding,U1... [More]		commitment complex,nucleus,nucleoplasm,U5 snRNP,U1... [More]		9	6	13	NREPVQLETLSIR.3\|NREPVQLETLSIR.2\|YFILPDSLPLDTLLVDVE... [More]
SEN / CTL	Q14157		Ubiquitin-associated protein 2-like		UBAP2L		0.36		0.09		0.146		0.0479		binding of sperm to zona pellucida,hematopoietic s... [More]		protein binding,poly(A) RNA binding		PcG protein complex,Ada2/Gcn5/Ada3 transcription a... [More]		3	28	45	IDLAVLLGK.2\|QRPQATAEQIR.3\|QRPQATAEQIR.2\|GFGDVGEAK.... [More]
SEN / CTL	P27487		Dipeptidyl peptidase 4		DPP4		0.35		0.48		0.000361		0.000314		behavioral fear response,response to hypoxia,prote... [More]		virus receptor activity,protease binding,serine-ty... [More]		lysosomal membrane,plasma membrane,focal adhesion,... [More]		21	34	42	ISLQWLR.2\|LNWATYLASTENIIVASFDGR.3\|HSYTASYDIYDLNKR.... [More]
SEN / CTL	O75874		Isocitrate dehydrogenase [NADP] cytoplasmic		IDH1		0.35		0.5		0.00409		0.00252		glyoxylate cycle,tricarboxylic acid cycle,isocitra... [More]		magnesium ion binding,isocitrate dehydrogenase (NA... [More]		cytoplasm,mitochondrion,peroxisome,peroxisomal mat... [More]		30	28	53	GWPLYLSTK.2\|IIWELIK.2\|LVSGWVKPIIIGR.3\|LVSGWVKPIIIG... [More]
SEN / CTL	P42224		Signal transducer and activator of transcription 1-alpha/beta		STAT1		0.35		0.53		0.00936		0.00505		negative regulation of transcription from RNA poly... [More]		RNA polymerase II core promoter proximal region se... [More]		nuclear chromatin,nucleus,nucleoplasm,nucleolus,cy... [More]		9	47	63	ELSAVTFPDIIR.2\|NLSFFLTPPC[CAM]AR.2\|FHDLLSQLDDQYSR.... [More]
SEN / CTL	Q9Y265		RuvB-like 1		RUVBL1		0.35		0.39		0.0102		0.00539		box C/D snoRNP assembly,DNA repair,DNA recombinati... [More]		DNA helicase activity,protein binding,ATP binding,... [More]		Swr1 complex,nucleus,nucleoplasm,cytoplasm,Golgi a... [More]		12	35	55	EAC[CAM]GVIVELIK.2\|YSVQLLTPANLLAK.2\|YSVQLLTPANLLAK... [More]
SEN / CTL	Q6NZI2		Polymerase I and transcript release factor		PTRF		0.35		0.74		0.0359		0.0152		regulation of transcription, DNA-templated,transcr... [More]		protein binding,rRNA primary transcript binding,po... [More]		nucleus,nucleoplasm,cytoplasm,mitochondrion,endopl... [More]		21	15	23	VMIYQDEVKLPAK.3\|VM[Oxi]IYQDEVKLPAK.3\|VMIYQDEVKLPAK... [More]
SEN / CTL	P47756		F-actin-capping protein subunit beta		CAPZB		0.34		0.35		0.00000466		0.00000649		movement of cell or subcellular component,cytoskel... [More]		actin binding,actin filament binding,cadherin bind... [More]		cytosol,cytoskeleton,actin filament,cell-cell adhe... [More]		36	22	40	STLNEIYFGK.2\|LVEDMENKIR.3\|SGSGTMNLGGSLTR.2\|SGSGTM[... [More]
SEN / CTL	Q14103		Heterogeneous nuclear ribonucleoprotein D0		HNRNPD		0.34		0.49		0.00716		0.00405		mRNA splicing, via spliceosome,liver development,t... [More]		nucleotide binding,AT DNA binding,chromatin bindin... [More]		nucleus,nucleoplasm,cytosol,intracellular ribonucl... [More]		21	25	51	FGEVVDC[CAM]TLK.2\|IFVGGLSPDTPEEK.2\|IFVGGLSPDTPEEK.... [More]
SEN / CTL	P63244		Guanine nucleotide-binding protein subunit beta-2-like 1		GNB2L1		0.34		0.58		0.00748		0.00421		positive regulation of protein phosphorylation,apo... [More]		protein kinase C binding,receptor binding,protein ... [More]		phagocytic cup,nucleus,cytoplasm,mitochondrion,cyt... [More]		24	30	51	VWQVTIGTR.2\|LWDLTTGTTTR.2\|YWLC[CAM]AATGPSIK.2\|YWLC... [More]
SEN / CTL	O00487		26S proteasome non-ATPase regulatory subunit 14		PSMD14		0.34		0.34		0.00808		0.00451		MAPK cascade,protein polyubiquitination,double-str... [More]		protein binding,metallopeptidase activity,metal io... [More]		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		12	12	25	AVAVVVDPIQSVK.2\|AVAVVVDPIQSVK.3\|LINANMMVLGHEPR.3\|L... [More]
SEN / CTL	P30153		Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform		PPP2R1A		0.33		0.47		0.000203		0.00019		G2/M transition of mitotic cell cycle,nuclear-tran... [More]		antigen binding,protein serine/threonine phosphata... [More]		protein phosphatase type 2A complex,chromosome, ce... [More]		42	41	75	QLSQSLLPAIVELAEDAKWR.3\|TSAC[CAM]GLFSVC[CAM]YPR.2\|A... [More]
SEN / CTL	Q9UKK3		Poly [ADP-ribose] polymerase 4		PARP4		0.33		1.1		0.00259		0.00171		DNA repair,cellular protein modification process,p... [More]		DNA binding,NAD+ ADP-ribosyltransferase activity,p... [More]		nucleus,cytoplasm,spindle microtubule,membrane,int... [More]		18	45	55	LGNVRPLLHGSPVQNIVGILC[CAM]R.4\|QLLGLQPISTVSPLHR.3\|S... [More]
SEN / CTL	P26006		Integrin alpha-3		ITGA3		0.33		0.54		0.00389		0.00243		neuron migration,cell-matrix adhesion,integrin-med... [More]		glycoprotein binding,fibronectin binding,protease ... [More]		plasma membrane,focal adhesion,integrin complex,ex... [More]		33	26	39	YLLLAGAPR.2\|VNGWATLFLR.2\|EAGNPGSLFGYSVALHR.3\|EAGNP... [More]
SEN / CTL	P50995		Annexin A11		ANXA11		0.33		0.54		0.00518		0.00309		phagocytosis,cell cycle,cell division,response to ... [More]		calcium ion binding,protein binding,calcium-depend... [More]		nuclear envelope,nucleoplasm,cytoplasm,spindle,mem... [More]		21	29	45	SETDLLDIR.2\|EAIKGVGTDEAC[CAM]LIEILASR.3\|TPVLFDIYEI... [More]
SEN / CTL	P40261		Nicotinamide N-methyltransferase		NNMT		0.33		0.34		0.0148		0.00735		response to organonitrogen compound,animal organ r... [More]		nicotinamide N-methyltransferase activity,pyridine... [More]		cytosol		15	13	20	C[CAM]DVTQSQPLGAVPLPPADC[CAM]VLSTLC[CAM]LDAAC[CAM]... [More]
SEN / CTL	O00754		Lysosomal alpha-mannosidase		MAN2B1		0.33		0.41		0.0168		0.00818		mannose metabolic process,cellular protein modific... [More]		alpha-mannosidase activity,zinc ion binding,carboh... [More]		extracellular space,lysosomal lumen,extracellular ... [More]		27	32	45	DLFSTFTITR.2\|LQETTLVANQLR.2\|FQVIVYNPLGR.2\|ELVDYFLN... [More]
SEN / CTL	P11279		Lysosome-associated membrane glycoprotein 1		LAMP1		0.33		0.83		0.0234		0.0108		autophagy,granzyme-mediated apoptotic signaling pa... [More]		virus receptor activity,protein binding,enzyme bin... [More]		cytoplasm,lysosome,lysosomal membrane,late endosom... [More]		24	9	13	FFLQGIQLNTILPDARDPAFK.3\|FFLQGIQLNTILPDARDPAFK.4\|AL... [More]
SEN / CTL	P09104		Gamma-enolase		ENO2		0.33		0.68		0.0289		0.0128		gluconeogenesis,canonical glycolysis		magnesium ion binding,phosphopyruvate hydratase ac... [More]		phosphopyruvate hydratase complex,photoreceptor in... [More]		39	20	33	VNQIGSVTEAIQAC[CAM]K.2\|VNQIGSVTEAIQAC[CAM]K.3\|LAMQ... [More]
SEN / CTL	Q02218		2-oxoglutarate dehydrogenase, mitochondrial		OGDH		0.33		1.34		0.0333		0.0143		generation of precursor metabolites and energy,gly... [More]		oxoglutarate dehydrogenase (succinyl-transferring)... [More]		mitochondrion,mitochondrial matrix,mitochondrial m... [More]		9	77	124	QILLPFR.2\|SWDIFFR.2\|DMVGQVAITR.2\|DM[Oxi]VGQVAITR.2... [More]
SEN / CTL	Q9UHA4		Ragulator complex protein LAMTOR3		LAMTOR3		0.33		0.46		0.0458		0.0186		MAPK cascade,activation of MAPKK activity,cell cyc... [More]		protein binding,kinase activator activity,guanyl-n... [More]		lysosomal membrane,focal adhesion,endosome membran... [More]		6	5	12	ELAPLFEELR.2\|VANDNAPEHALRPGFLSTFALATDQGSK.4\|VANDNA... [More]
SEN / CTL	O95782		AP-2 complex subunit alpha-1		AP2A1		0.33		0.6		0.13		0.0439		intracellular protein transport,Golgi to endosome ... [More]		protein binding,protein C-terminus binding,protein... [More]		cytosol,plasma membrane,membrane,basolateral plasm... [More]		15	46	65	LVEC[CAM]LETVLNK.2\|HLC[CAM]ELLAQQF.2\|TC[CAM]VSLAVS... [More]
SEN / CTL	Q01518		Adenylyl cyclase-associated protein 1		CAP1		0.32		0.63		3.7e-7		6.75e-7		cell morphogenesis,ameboidal-type cell migration,r... [More]		actin binding,adenylate cyclase binding		plasma membrane,focal adhesion,cortical actin cyto... [More]		63	51	99	C[CAM]VNTTLQIK.2\|NSLDC[CAM]EIVSAK.2\|LSDLLAPISEQIKE... [More]
SEN / CTL	P00558		Phosphoglycerate kinase 1		PGK1		0.32		0.66		0.00000103		0.00000171		gluconeogenesis,phosphorylation,epithelial cell di... [More]		phosphoglycerate kinase activity,ATP binding		cytosol,membrane,membrane raft,extracellular exoso... [More]		162	59	126	AC[CAM]ANPAAGSVILLENLR.3\|AC[CAM]ANPAAGSVILLENLR.2\|... [More]
SEN / CTL	O60784		Target of Myb protein 1		TOM1		0.32		0.18		0.0169		0.00818		intracellular protein transport,endocytosis,protei... [More]		protein binding,clathrin binding		cytoplasm,endosome,early endosome,cytosol,membrane... [More]		6	20	27	LRSELEMVSGNVR.3\|LRSELEMVSGNVR.2\|VLNLIQSWADAFR.2\|VL... [More]
SEN / CTL	O43504		Ragulator complex protein LAMTOR5		LAMTOR5		0.32		0.12		0.0622		0.0241		cell cycle arrest,regulation of cell size,response... [More]		protein binding,guanyl-nucleotide exchange factor ... [More]		lysosome,lysosomal membrane,cytosol,Ragulator comp... [More]		3	4	6	GTLSDEHAGVISVLAQQAAK.3\|GTLSDEHAGVISVLAQQAAK.2\|HDGI... [More]
SEN / CTL	Q9Y3C8		Ubiquitin-fold modifier-conjugating enzyme 1		UFC1		0.32		0.7		0.104		0.0368		response to endoplasmic reticulum stress,protein u... [More]		protein binding,UFM1 transferase activity		cytoplasm,extracellular exosome		6	5	8	IC[CAM]LTDHFKPLWAR.3\|IC[CAM]LTDHFKPLWAR.4\|C[CAM]WY... [More]
SEN / CTL	Q13753		Laminin subunit gamma-2		LAMC2		0.32		1.05		0.139		0.046		cell adhesion,positive regulation of cell prolifer... [More]		heparin binding		extracellular region,laminin-2 complex,extracellul... [More]		27	14	15	LDPVYFVAPAK.2\|GGRHPSAHDVILEGAGLR.4\|AQGGDGVVPDTELEG... [More]
SEN / CTL	Q8WUM4		Programmed cell death 6-interacting protein		PDCD6IP		0.31		0.35		0.00000287		0.00000425		cell separation after cytokinesis,apoptotic proces... [More]		protein binding,proteinase activated receptor bind... [More]		immunological synapse,cytoplasm,microtubule organi... [More]		54	63	96	FYNELTEILVR.2\|LANQAADYFGDAFK.2\|FIQQTYPSGGEEQAQYC[C... [More]
SEN / CTL	O15144		Actin-related protein 2/3 complex subunit 2		ARPC2		0.31		0.66		0.0000326		0.000036		movement of cell or subcellular component,positive... [More]		structural constituent of cytoskeleton,protein bin... [More]		cytoplasm,endosome,Golgi apparatus,cytosol,Arp2/3 ... [More]		33	36	60	ASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPR.5\|ASHTAPQ... [More]
SEN / CTL	P20073		Annexin A7		ANXA7		0.31		0.31		0.0000905		0.0000908		cellular calcium ion homeostasis,autophagy,hemosta... [More]		integrin binding,calcium ion binding,protein bindi... [More]		nucleus,nuclear envelope,endoplasmic reticulum mem... [More]		30	23	33	VLIEILC[CAM]TR.2\|EFSGYVESGLK.2\|GFGTDEQAIVDVVANR.3\|... [More]
SEN / CTL	P13674		Prolyl 4-hydroxylase subunit alpha-1		P4HA1		0.31		0.37		0.00379		0.0024		peptidyl-proline hydroxylation to 4-hydroxy-L-prol... [More]		procollagen-proline 4-dioxygenase activity,iron io... [More]		mitochondrion,endoplasmic reticulum,endoplasmic re... [More]		24	32	47	LTSTATKDPEGFVGHPVNAFK.4\|LTSTATKDPEGFVGHPVNAFK.3\|SA... [More]
SEN / CTL	P04080		Cystatin-B		CSTB		0.31		0.35		0.0175		0.00842		adult locomotory behavior,negative regulation of p... [More]		protease binding,endopeptidase inhibitor activity,... [More]		extracellular space,nucleolus,cytoplasm,extracellu... [More]		15	8	11	VHVGDEDFVHLR.3\|VHVGDEDFVHLR.2\|VFQSLPHENKPLTLSNYQTN... [More]
SEN / CTL	P61019		Ras-related protein Rab-2A		RAB2A		0.31		0.75		0.0276		0.0124		Golgi organization,small GTPase mediated signal tr... [More]		GTPase activity,protein binding,GTP binding,GDP bi... [More]		Golgi membrane,nucleus,lysosomal membrane,endoplas... [More]		12	17	32	LQIWDTAGQESFR.2\|LQIWDTAGQESFR.3\|GAAGALLVYDITRR.3\|G... [More]
SEN / CTL	P28838		Cytosol aminopeptidase		LAP3		0.31		0.46		0.109		0.038		proteolysis		aminopeptidase activity,metalloexopeptidase activi... [More]		nucleus,nucleoplasm,cytoplasm,mitochondrion,trans-... [More]		15	44	80	GITFDSGGISIK.2\|TLIEFLLR.2\|LNLPINIIGLAPLC[CAM]ENMPS... [More]
SEN / CTL	P30048		Thioredoxin-dependent peroxide reductase, mitochondrial		PRDX3		0.3		0.26		0.00000162		0.00000258		response to reactive oxygen species,maternal place... [More]		protein binding,protein C-terminus binding,thiored... [More]		cytoplasm,mitochondrion,mitochondrial matrix,early... [More]		30	19	41	GLFIIDPNGVIK.2\|DYGVLLEGSGLALR.2\|DYGVLLEGSGLALR.3\|H... [More]
SEN / CTL	P78371		T-complex protein 1 subunit beta		CCT2		0.3		0.66		0.0000336		0.0000369		protein folding,binding of sperm to zona pellucida... [More]		protein binding,ATP binding,ubiquitin protein liga... [More]		zona pellucida receptor complex,cytoplasm,cytosol,... [More]		54	49	108	LAVEAVLR.2\|LTSFIGAIAIGDLVK.2\|LTSFIGAIAIGDLVK.3\|GAT... [More]
SEN / CTL	O95336		6-phosphogluconolactonase		PGLS		0.3		0.3		0.00062		0.000503		carbohydrate metabolic process,pentose-phosphate s... [More]		6-phosphogluconolactonase activity		cytosol,extracellular exosome		33	19	31	TVIFVATGEGK.2\|LC[CAM]WFLDEAAAR.2\|WTLGFC[CAM]DER.2\|... [More]
SEN / CTL	Q13200		26S proteasome non-ATPase regulatory subunit 2		PSMD2		0.3		0.95		0.00604		0.00354		MAPK cascade,protein polyubiquitination,stimulator... [More]		protein binding,enzyme regulator activity,endopept... [More]		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		27	63	112	LNILDTLSK.2\|MLVTFDEELRPLPVSVR.3\|M[Oxi]LVTFDEELRPLP... [More]
SEN / CTL	Q9NYL9		Tropomodulin-3		TMOD3		0.3		0.44		0.0645		0.0248		muscle contraction,actin filament organization,myo... [More]		actin binding,tropomyosin binding,cadherin binding... [More]		striated muscle thin filament,cell-cell junction,c... [More]		6	22	36	ILPVFDEPPNPTNVEESLKR.3\|FGYQFTQQGPR.2\|QKPVQTFTEEK.3... [More]
SEN / CTL	P06576		ATP synthase subunit beta, mitochondrial		ATP5B		0.29		0.44		5.75e-8		1.22e-7		angiogenesis,osteoblast differentiation,generation... [More]		transporter activity,protein binding,ATP binding,t... [More]		nucleus,mitochondrion,mitochondrial proton-transpo... [More]		120	47	115	AIAELGIYPAVDPLDSTSR.2\|AIAELGIYPAVDPLDSTSR.3\|AHGGYS... [More]
SEN / CTL	P31939		Bifunctional purine biosynthesis protein PURH		ATIC		0.29		0.3		0.00000689		0.00000921		brainstem development,nucleobase-containing compou... [More]		IMP cyclohydrolase activity,phosphoribosylaminoimi... [More]		mitochondrion,cytosol,cell-cell adherens junction,... [More]		27	53	87	LDFNLIR.2\|TVASPGVTVEEAVEQIDIGGVTLLR.3\|TVASPGVTVEEA... [More]
SEN / CTL	Q04446		1,4-alpha-glucan-branching enzyme		GBE1		0.29		0.46		0.000997		0.000759		glycogen metabolic process,glycogen biosynthetic p... [More]		1,4-alpha-glucan branching enzyme activity,hydrola... [More]		cytosol,extracellular exosome		42	32	48	LITHGLGGEGYLNFM[Oxi]GNEFGHPEWLDFPR.4\|LITHGLGGEGYLN... [More]
SEN / CTL	P62263		40S ribosomal protein S14		RPS14		0.29		0.43		0.00126		0.000928		ribosomal small subunit assembly,negative regulati... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleoplasm,nucleolus,cytoplasm,mitochondrion,cyto... [More]		15	15	31	IGRIEDVTPIPSDSTR.3\|IGRIEDVTPIPSDSTR.2\|VKADRDESSPYA... [More]
SEN / CTL	P50990		T-complex protein 1 subunit theta		CCT8		0.29		1.33		0.065		0.025		protein folding,binding of sperm to zona pellucida... [More]		protein binding,ATP binding,ATPase activity, coupl... [More]		zona pellucida receptor complex,nucleoplasm,cytopl... [More]		60	59	110	FAEAFEAIPR.2\|LATNAAVTVLR.2\|DIDEVSSLLR.2\|AIADTGANVV... [More]
SEN / CTL	Q15642		Cdc42-interacting protein 4		TRIP10		0.29		0.49		0.1		0.0358		endocytosis,cell communication,signal transduction... [More]		ARF guanyl-nucleotide exchange factor activity,GTP... [More]		phagocytic cup,nucleoplasm,cytoplasm,lysosome,tran... [More]		6	25	32	ELVAENLSVR.2\|LGAGYGLLSEAELEVVPIIAK.3\|LGAGYGLLSEAEL... [More]
SEN / CTL	Q9NQW7		Xaa-Pro aminopeptidase 1		XPNPEP1		0.28		0.27		0.0000279		0.0000317		proteolysis,bradykinin catabolic process		aminopeptidase activity,manganese ion binding,prot... [More]		cytoplasm,extracellular exosome		21	33	49	VGVDPLIIPTDYWK.2\|QEALEWLIR.2\|MGLKDTPTQEDWLVSVLPEGS... [More]
SEN / CTL	P53621		Coatomer subunit alpha		COPA		0.28		0.46		0.000979		0.000751		intracellular protein transport,ER to Golgi vesicl... [More]		hormone activity,structural molecule activity		Golgi membrane,extracellular space,cytoplasm,endop... [More]		30	92	167	SSGLTAVWVAR.2\|VTTVTEIGKDVIGLR.3\|VTTVTEIGKDVIGLR.2\|... [More]
SEN / CTL	P62829		60S ribosomal protein L23		RPL23		0.28		0.43		0.00405		0.0025		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,poly(A) RNA bin... [More]		nucleolus,cytoplasm,cytosol,ribosome,focal adhesio... [More]		12	14	27	NLYIISVK.2\|ISLGLPVGAVINC[CAM]ADNTGAK.2\|ISLGLPVGAVI... [More]
SEN / CTL	Q99798		Aconitate hydratase, mitochondrial		ACO2		0.28		0.61		0.00891		0.00488		generation of precursor metabolites and energy,tri... [More]		aconitate hydratase activity,iron ion binding,3 ir... [More]		nucleus,mitochondrion,mitochondrial matrix,myelin ... [More]		42	75	142	VAGILTVK.2\|NAVTQEFGPVPDTAR.2\|NAVTQEFGPVPDTAR.3\|WVV... [More]
SEN / CTL	Q16698		2,4-dienoyl-CoA reductase, mitochondrial		DECR1		0.28		0.13		0.0263		0.0119		fatty acid beta-oxidation,protein homotetramerizat... [More]		2,4-dienoyl-CoA reductase (NADPH) activity,oxidore... [More]		nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch... [More]		3	26	42	VAGHPNIVINNAAGNFISPTER.3\|VAGHPNIVINNAAGNFISPTER.4\|... [More]
SEN / CTL	P32321		Deoxycytidylate deaminase		DCTD		0.28		0.34		0.134		0.0448		pyrimidine nucleotide metabolic process,nucleotide... [More]		dCMP deaminase activity,protein binding,zinc ion b... [More]		cytosol,extracellular exosome		9	11	17	LIIQAGIK.2\|LLFNMAGVTFR.2\|LLFNMAGVTFR.3\|LLFNM[Oxi]A... [More]
SEN / CTL	P26641		Elongation factor 1-gamma		EEF1G		0.27		0.37		0.000342		0.0003		translational elongation,glutathione metabolic pro... [More]		translation elongation factor activity,glutathione... [More]		nucleus,cytoplasm,cytosol,cell-cell adherens junct... [More]		30	36	59	ILGLLDAYLK.2\|ALIAAQYSGAQVR.2\|ALIAAQYSGAQVR.3\|STFVL... [More]
SEN / CTL	Q13751		Laminin subunit beta-3		LAMB3		0.27		0.73		0.0476		0.0192		cell adhesion,epidermis development,extracellular ... [More]		structural molecule activity,protein binding,prote... [More]		extracellular region,laminin-5 complex		6	11	11	AHAVEGQVEDVVGNLR.3\|C[CAM]LC[CAM]LPNVVGPK.2\|C[CAM]D... [More]
SEN / CTL	P23526		Adenosylhomocysteinase		AHCY		0.27		0.37		0.118		0.0407		sulfur amino acid metabolic process,response to hy... [More]		adenosylhomocysteinase activity,protein binding,ad... [More]		nucleus,cytoplasm,cytosol,melanosome,neuron projec... [More]		30	34	62	VADIGLAAWGR.2\|VAVVAGYGDVGKGC[CAM]AQALR.3\|IILLAEGR.... [More]
SEN / CTL	P15144		Aminopeptidase N		ANPEP		0.26		0.74		0.0000786		0.0000801		angiogenesis,proteolysis,cell differentiation,pept... [More]		virus receptor activity,aminopeptidase activity,re... [More]		extracellular space,lysosomal membrane,endoplasmic... [More]		102	60	99	ELWILNR.2\|YRLPNTLKPDSYR.4\|YRLPNTLKPDSYR.3\|QQQDYWLI... [More]
SEN / CTL	P08238		Heat shock protein HSP 90-beta		HSP90AB1		0.26		0.85		0.00498		0.00298		placenta development,protein folding,response to u... [More]		glycoprotein binding,UTP binding,CTP binding,doubl... [More]		nucleoplasm,cytoplasm,mitochondrion,lysosomal memb... [More]		186	84	175	GVVDSEDLPLNISR.2\|GVVDSEDLPLNISR.3\|ELISNASDALDKIR.3... [More]
SEN / CTL	O15145		Actin-related protein 2/3 complex subunit 3		ARPC3		0.26		1.66		0.0925		0.0336		movement of cell or subcellular component,Arp2/3 c... [More]		structural constituent of cytoskeleton,protein bin... [More]		cytosol,Arp2/3 protein complex,focal adhesion,acti... [More]		18	16	27	AYLQQLR.2\|PAYHSSLMDPDTKLIGNMALLPIR.4\|ETKDTDIVDEAIY... [More]
SEN / CTL	P05787		Keratin, type II cytoskeletal 8		KRT8		0.26		1.01		0.138		0.0458		viral process,tumor necrosis factor-mediated signa... [More]		structural molecule activity,protein binding,prote... [More]		nucleus,nucleoplasm,cytoplasm,intermediate filamen... [More]		105	65	157	LALDIEIATYR.2\|LSELEAALQR.2\|ASLEAAIADAEQRGELAIKDANA... [More]
SEN / CTL	Q13813		Spectrin alpha chain, non-erythrocytic 1		SPTAN1		0.25		0.68		2.5e-9		7.1e-9		MAPK cascade,ER to Golgi vesicle-mediated transpor... [More]		actin binding,Ras guanyl-nucleotide exchange facto... [More]		cytosol,cell-cell adherens junction,spectrin,micro... [More]		225	282	447	ETENVKSSEEIESAFR.3\|LQQLFRDVEDEETWIR.3\|FLSDFRDLMSWI... [More]
SEN / CTL	P55072		Transitional endoplasmic reticulum ATPase		VCP		0.25		0.44		0.0000123		0.0000153		DNA repair,double-strand break repair,NADH metabol... [More]		protein binding,ATP binding,lipid binding,ATPase a... [More]		proteasome complex,nucleus,nucleoplasm,cytoplasm,e... [More]		201	94	187	ELQELVQYPVEHPDKFLK.4\|ELQELVQYPVEHPDKFLK.3\|LDQLIYIP... [More]
SEN / CTL	Q96KP4		Cytosolic non-specific dipeptidase		CNDP2		0.25		0.75		0.0000304		0.0000339		sulfur amino acid metabolic process,proteolysis,gl... [More]		carboxypeptidase activity,zinc ion binding,metallo... [More]		nucleoplasm,cytoplasm,cytosol,extracellular exosom... [More]		114	44	84	TVFGVEPDLTR.2\|WVAIQSVSAWPEK.2\|WVAIQSVSAWPEK.3\|EGGS... [More]
SEN / CTL	P13639		Elongation factor 2		EEF2		0.25		1.02		0.0000858		0.0000865		hematopoietic progenitor cell differentiation,resp... [More]		p53 binding,translation elongation factor activity... [More]		nucleus,cytoplasm,cytosol,plasma membrane,cell-cel... [More]		144	84	183	VFSGLVSTGLK.2\|EGIPALDNFLDKL.2\|AYLPVNESFGFTADLR.3\|A... [More]
SEN / CTL	Q15365		Poly(rC)-binding protein 1		PCBP1		0.25		0.35		0.000236		0.000215		mRNA splicing, via spliceosome,gene expression,vir... [More]		RNA polymerase II transcription factor activity, s... [More]		nucleoplasm,cytoplasm,cell-cell adherens junction,... [More]		30	15	49	AITIAGVPQSVTEC[CAM]VK.2\|AITIAGVPQSVTEC[CAM]VK.3\|II... [More]
SEN / CTL	P50452		Serpin B8		SERPINB8		0.25		0.01		0.00246		0.00164		negative regulation of endopeptidase activity		serine-type endopeptidase inhibitor activity,prote... [More]		extracellular space,cytosol,extracellular exosome		3	13	14	ISEVLDAGTVDPLTK.2\|RLGMIDAFDEAK.3\|TGTQYLLR.2\|LEESYD... [More]
SEN / CTL	Q00688		Peptidyl-prolyl cis-trans isomerase FKBP3		FKBP3		0.25		0.3		0.00346		0.00222		protein peptidyl-prolyl isomerization,chaperone-me... [More]		peptidyl-prolyl cis-trans isomerase activity,recep... [More]		nucleus,endoplasmic reticulum membrane		27	19	30	AWTVEQLRSEQLPK.3\|ARLEIEPEWAYGK.3\|ARLEIEPEWAYGK.2\|V... [More]
SEN / CTL	P06396		Gelsolin		GSN		0.25		1.24		0.0316		0.0138		phagocytosis, engulfment,positive regulation of ge... [More]		actin binding,calcium ion binding,protein binding,... [More]		podosome,extracellular region,extracellular space,... [More]		51	53	102	QTQVSVLPEGGETPLFK.2\|QTQVSVLPEGGETPLFK.3\|FDLVPVPTNL... [More]
SEN / CTL	P21333		Filamin-A		FLNA		0.25		1.06		0.0438		0.0179		platelet degranulation,adenylate cyclase-inhibitin... [More]		G-protein coupled receptor binding,glycoprotein bi... [More]		extracellular region,nucleus,nucleolus,cytoplasm,c... [More]		453	207	388	YGGDEIPFSPYR.2\|EATTEFSVDAR.2\|FGGEHVPNSPFQVTALAGDQP... [More]
SEN / CTL	Q9NZA1		Chloride intracellular channel protein 5		CLIC5		0.25		0.46		0.0547		0.0217		diet induced thermogenesis,transport,chloride tran... [More]		voltage-gated ion channel activity,chloride channe... [More]		Golgi apparatus,microtubule organizing center,cell... [More]		15	13	16	FLDGDELTLADC[CAM]NLLPK.2\|FLDGDELTLADC[CAM]NLLPK.3\|... [More]
SEN / CTL	P30837		Aldehyde dehydrogenase X, mitochondrial		ALDH1B1		0.25		0.41		0.059		0.0231		carbohydrate metabolic process,ethanol catabolic p... [More]		aldehyde dehydrogenase (NAD) activity		nucleoplasm,mitochondrion,mitochondrial matrix,int... [More]		21	31	51	YGLAAAVFTR.2\|LAPALATGNTVVMK.2\|LAPALATGNTVVM[Oxi]K.... [More]
SEN / CTL	P05023		Sodium/potassium-transporting ATPase subunit alpha-1		ATP1A1		0.24		0.77		0.000106		0.000105		regulation of the force of heart contraction,regul... [More]		sodium:potassium-exchanging ATPase activity,protei... [More]		endosome,endoplasmic reticulum,Golgi apparatus,pla... [More]		39	62	112	IISANGC[CAM]KVDNSSLTGESEPQTR.3\|AVAGDASESALLK.2\|AVA... [More]
SEN / CTL	P48444		Coatomer subunit delta		ARCN1		0.24		0.28		0.000164		0.000158		intracellular protein transport,ER to Golgi vesicl... [More]		poly(A) RNA binding		Golgi membrane,cytoplasm,endoplasmic reticulum mem... [More]		21	40	66	VLLAAAVC[CAM]TK.2\|LYMVLITTK.2\|LFTAESLIGLKNPEK.3\|LF... [More]
SEN / CTL	P30740		Leukocyte elastase inhibitor		SERPINB1		0.24		0.37		0.000384		0.000331		negative regulation of endopeptidase activity		serine-type endopeptidase inhibitor activity		extracellular space,cytoplasm,membrane,extracellul... [More]		30	24	41	LGVQDLFNSSK.2\|TFHFNTVEEVHSR.4\|TFHFNTVEEVHSR.3\|TYNF... [More]
SEN / CTL	O43242		26S proteasome non-ATPase regulatory subunit 3		PSMD3		0.24		0.29		0.00124		0.00092		MAPK cascade,protein polyubiquitination,stimulator... [More]		protein binding,enzyme regulator activity		proteasome complex,nucleus,nucleoplasm,cytoplasm,c... [More]		18	43	64	VYEFLDKLDVVR.3\|VYEFLDKLDVVR.2\|HDADGQATLLNLLLR.3\|HD... [More]
SEN / CTL	Q13561		Dynactin subunit 2		DCTN2		0.24		0.37		0.00765		0.00428		G2/M transition of mitotic cell cycle,ER to Golgi ... [More]		motor activity,protein binding,spectrin binding		kinetochore,cytoplasm,centrosome,cytosol,dynactin ... [More]		36	28	43	LLLQLEATK.2\|WSPIASTLPELVQR.2\|LLGPDAAINLTDPDGALAKR.... [More]
SEN / CTL	P49588		Alanine--tRNA ligase, cytoplasmic		AARS		0.24		0.27		0.00864		0.00476		hair follicle development,tRNA modification,tRNA a... [More]		tRNA binding,aminoacyl-tRNA editing activity,alani... [More]		cytoplasm,cytosol,membrane,extracellular exosome,m... [More]		18	62	112	NVGC[CAM]LQEALQLATSFAQLR.3\|NVGC[CAM]LQEALQLATSFAQL... [More]
SEN / CTL	P61421		V-type proton ATPase subunit d 1		ATP6V0D1		0.24		0.95		0.0111		0.00581		vacuolar transport,vacuolar acidification,brain de... [More]		protein binding,hydrogen-exporting ATPase activity... [More]		lysosomal membrane,early endosome,synaptic vesicle... [More]		18	16	21	LYPEGLAQLAR.2\|LYPEGLAQLAR.3\|AKIDNYIPIF.2\|NIVWIAEC[... [More]
SEN / CTL	P38606		V-type proton ATPase catalytic subunit A		ATP6V1A		0.23		0.43		8.21e-7		0.00000141		transport,insulin receptor signaling pathway,ATP h... [More]		ATP binding,proton-transporting ATPase activity, r... [More]		mitochondrion,lysosomal membrane,cytosol,plasma me... [More]		42	53	91	QVRPVTEKLPANHPLLTGQR.4\|AKEILQEEEDLAEIVQLVGK.3\|AKEI... [More]
SEN / CTL	P54819		Adenylate kinase 2, mitochondrial		AK2		0.23		0.35		0.000712		0.000567		ADP biosynthetic process,nucleobase-containing sma... [More]		adenylate kinase activity,ATP binding		mitochondrial inner membrane,mitochondrial interme... [More]		39	28	55	NGFLLDGFPR.2\|GIHSAIDASQTPDVVFASILAAFSK.3\|GIHSAIDAS... [More]
SEN / CTL	P29692		Elongation factor 1-delta		EEF1D		0.23		0.39		0.0171		0.00828		transcription, DNA-templated,regulation of transcr... [More]		DNA binding,translation elongation factor activity... [More]		nucleus,nucleolus,cytoplasm,cytosol,eukaryotic tra... [More]		18	24	46	LVPVGYGIR.2\|SIQLDGLVWGASK.2\|SIQLDGLVWGASK.3\|IASLEV... [More]
SEN / CTL	O00622		Protein CYR61		CYR61		0.23		1.11		0.052		0.0207		regulation of cell growth,osteoblast differentiati... [More]		integrin binding,insulin-like growth factor bindin... [More]		proteinaceous extracellular matrix,extracellular m... [More]		36	17	20	GLEC[CAM]NFGASSTALK.2\|C[CAM]APGVGLVR.2\|HQC[CAM]TC[... [More]
SEN / CTL	Q9Y230		RuvB-like 2		RUVBL2		0.23		0.76		0.0856		0.0317		box C/D snoRNP assembly,DNA repair,DNA recombinati... [More]		RNA polymerase II core promoter sequence-specific ... [More]		Swr1 complex,intracellular,nucleus,nucleoplasm,nuc... [More]		24	42	67	GLGLDDALEPR.2\|IGLETSLR.2\|ALESDMAPVLIMATNR.3\|ALESDM... [More]
SEN / CTL	P21589		5'-nucleotidase		NT5E		0.23		0.56		0.0889		0.0326		purine nucleotide catabolic process,AMP catabolic ... [More]		nucleotide binding,5'-nucleotidase activity,metal ... [More]		cytoplasm,plasma membrane,cell surface,membrane,an... [More]		30	28	42	TIVYLDGSSQSC[CAM]R.2\|EVPAGKYPFIVTSDDGR.3\|VLPVGDEVV... [More]
SEN / CTL	Q9UL46		Proteasome activator complex subunit 2		PSME2		0.23		0.96		0.102		0.0363		MAPK cascade,protein polyubiquitination,stimulator... [More]		endopeptidase activator activity		proteasome complex,nucleoplasm,cytoplasm,cytosol,p... [More]		36	23	36	QNLFQEAEEFLYR.2\|QNLFQEAEEFLYR.3\|ALVHERDEAAYGELR.4\|... [More]
SEN / CTL	P13489		Ribonuclease inhibitor		RNH1		0.23		0.7		0.131		0.0443		mRNA catabolic process,negative regulation of cata... [More]		protein binding,ribonuclease inhibitor activity		nucleoplasm,cytoplasm,angiogenin-PRI complex,extra... [More]		84	31	55	VNPALAELNLR.2\|VNPALAELNLR.3\|WAELLPLLQQC[CAM]QVVR.2... [More]
SEN / CTL	P01024		Complement C3		C3		0.22		0.59		1.18e-7		2.33e-7		positive regulation of type IIa hypersensitivity,p... [More]		serine-type endopeptidase activity,endopeptidase i... [More]		extracellular region,extracellular space,plasma me... [More]		153	130	202	LVAYYTLIGASGQR.3\|LVAYYTLIGASGQR.2\|QVREPGQDLVVLPLSI... [More]
SEN / CTL	Q93052		Lipoma-preferred partner		LPP		0.22		0.69		0.0246		0.0113		cell adhesion,biological_process		protein binding,zinc ion binding		nucleus,cytoplasm,plasma membrane,focal adhesion		21	28	50	KTYITDPVSAPC[CAM]APPLQPK.3\|METTHSFGNPSISVSTQQPPKK.... [More]
SEN / CTL	Q99832		T-complex protein 1 subunit eta		CCT7		0.22		0.75		0.152		0.0493		protein folding,binding of sperm to zona pellucida... [More]		protein binding,ATP binding,identical protein bind... [More]		zona pellucida receptor complex,cytoplasm,mitochon... [More]		30	48	102	INALTAASEAAC[CAM]LIVSVDETIKNPR.3\|INALTAASEAAC[CAM]... [More]
SEN / CTL	P55268		Laminin subunit beta-2		LAMB2		0.21		0.49		0.00996		0.00529		cell adhesion,axon guidance,neuromuscular junction... [More]		integrin binding,structural molecule activity		extracellular region,basement membrane,basal lamin... [More]		15	53	60	SLADVDAILAR.2\|TGGSAQPETPYSGPGLLIDSLVLLPR.3\|GAVADTR... [More]
SEN / CTL	P62888		60S ribosomal protein L30		RPL30		0.21		0.24		0.011		0.00574		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleus,cytoplasm,cytosol,focal adhesion,membrane,... [More]		12	10	19	VC[CAM]TLAIIDPGDSDIIR.2\|VC[CAM]TLAIIDPGDSDIIR.3\|LV... [More]
SEN / CTL	Q13011		Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial		ECH1		0.21		0.35		0.0302		0.0133		fatty acid beta-oxidation,fatty acid catabolic pro... [More]		receptor binding,isomerase activity		mitochondrion,peroxisome,membrane,extracellular ex... [More]		24	26	53	YQETFNVIER.2\|VIGNQSLVNELAFTAR.2\|VIGNQSLVNELAFTAR.3... [More]
SEN / CTL	Q9H0E2		Toll-interacting protein		TOLLIP		0.21		0.77		0.036		0.0152		autophagy,inflammatory response,signal transductio... [More]		signal transducer activity,interleukin-1, Type I r... [More]		cytoplasm,cytosol,nuclear body,interleukin-18 rece... [More]		9	10	12	GPVYIGELPQDFLR.2\|LNITVVQAK.2\|IAWTHITIPESLR.3\|IAWTH... [More]
SEN / CTL	O43390		Heterogeneous nuclear ribonucleoprotein R		HNRNPR		0.21		0.69		0.0887		0.0325		mRNA splicing, via spliceosome,mRNA processing,cir... [More]		nucleotide binding,RNA binding,mRNA 3'-UTR binding... [More]		nucleoplasm,spliceosomal complex,endoplasmic retic... [More]		12	33	51	GYAFITFC[CAM]GK.2\|NLATTVTEEILEK.2\|NLATTVTEEILEK.3\|... [More]
SEN / CTL	Q8N2S1		Latent-transforming growth factor beta-binding protein 4		LTBP4		0.21		0.36		0.0947		0.0341		regulation of cell growth,protein folding,transmem... [More]		transforming growth factor beta-activated receptor... [More]		extracellular region,proteinaceous extracellular m... [More]		15	10	11	GGYTC[CAM]VC[CAM]PDGFLLDSSR.2\|IQQC[CAM]PGTETAEYQSL... [More]
SEN / CTL	Q14554		Protein disulfide-isomerase A5		PDIA5		0.21		1.25		0.104		0.037		protein folding,response to endoplasmic reticulum ... [More]		protein disulfide isomerase activity,oxidoreductas... [More]		endoplasmic reticulum lumen,endoplasmic reticulum ... [More]		6	26	32	GFPTIC[CAM]YFEK.2\|FHISEFPTLK.3\|FHISEFPTLK.2\|VIPHFT... [More]
SEN / CTL	O94760		N(G),N(G)-dimethylarginine dimethylaminohydrolase 1		DDAH1		0.21		0.36		0.132		0.0444		citrulline metabolic process,regulation of systemi... [More]		catalytic activity,dimethylargininase activity,ami... [More]		mitochondrion,cytosol,extracellular exosome		9	21	37	QHQLYVGVLGSK.3\|QHQLYVGVLGSK.2\|GAEILADTFKDYAVSTVPVA... [More]
SEN / CTL	P26885		Peptidyl-prolyl cis-trans isomerase FKBP2		FKBP2		0.2		0.22		0.0124		0.0064		protein peptidyl-prolyl isomerization,chaperone-me... [More]		peptidyl-prolyl cis-trans isomerase activity,FK506... [More]		endoplasmic reticulum,endoplasmic reticulum membra... [More]		12	13	21	LVIPSELGYGER.2\|GAPPKIPGGATLVFEVELLKIER.4\|KLVIPSELG... [More]
SEN / CTL	P21399		Cytoplasmic aconitate hydratase		ACO1		0.2		0.68		0.0194		0.00914		tricarboxylic acid cycle,citrate metabolic process... [More]		RNA binding,aconitate hydratase activity,protein b... [More]		cytoplasm,mitochondrion,endoplasmic reticulum,Golg... [More]		54	42	66	VLLEAAIR.2\|FVEFFGPGVAQLSIADR.2\|FVEFFGPGVAQLSIADR.3... [More]
SEN / CTL	P42766		60S ribosomal protein L35		RPL35		0.2		0.22		0.0478		0.0193		nuclear-transcribed mRNA catabolic process, nonsen... [More]		mRNA binding,structural constituent of ribosome,po... [More]		nucleolus,cytoplasm,cytosol,membrane,cytosolic lar... [More]		6	8	10	QLDDLKVELSQLR.3\|QLDDLKVELSQLR.2\|KYKPLDLRPK.3\|RLNKH... [More]
SEN / CTL	Q9NR45		Sialic acid synthase		NANS		0.2		0.31		0.0604		0.0236		lipopolysaccharide biosynthetic process		N-acylneuraminate cytidylyltransferase activity,N-... [More]		cytoplasm,cytosol,extracellular exosome		6	23	39	GSDHSASLEPGELAELVR.3\|GSDHSASLEPGELAELVR.2\|PLELELC[... [More]
SEN / CTL	P46783		40S ribosomal protein S10		RPS10		0.2		0.39		0.1		0.0358		ribosomal small subunit assembly,nuclear-transcrib... [More]		structural constituent of ribosome,protein binding... [More]		nucleoplasm,nucleolus,cytosol,ribosome,focal adhes... [More]		6	15	25	IAIYELLFK.2\|KAEAGAGSATEFQFR.3\|KAEAGAGSATEFQFR.2\|HP... [More]
SEN / CTL	P11216		Glycogen phosphorylase, brain form		PYGB		0.19		0.76		0.0000333		0.0000367		glycogen catabolic process		protein binding,glycogen phosphorylase activity,py... [More]		cytoplasm,membrane,extracellular exosome		42	65	111	VIFLENYR.2\|VLYPNDNFFEGK.2\|LAAC[CAM]FLDSMATLGLAAYGY... [More]
SEN / CTL	O15460		Prolyl 4-hydroxylase subunit alpha-2		P4HA2		0.19		0.33		0.00877		0.00482		peptidyl-proline hydroxylation,oxidation-reduction... [More]		procollagen-proline 4-dioxygenase activity,iron io... [More]		nucleus,cytoplasm,endoplasmic reticulum,endoplasmi... [More]		18	21	24	SSWLEEDDDPVVAR.2\|YYDVMSDEEIER.2\|KGTAVFWYNLLR.3\|SAA... [More]
SEN / CTL	P09525		Annexin A4		ANXA4		0.19		0.73		0.0112		0.00586		regulation of transcription from RNA polymerase II... [More]		phospholipase inhibitor activity,calcium ion bindi... [More]		nucleus,cytoplasm,plasma membrane,cell surface,ves... [More]		96	45	70	GLGTDEDAIISVLAYR.2\|GLGTDEDAIISVLAYR.3\|GAGTDEGC[CAM... [More]
SEN / CTL	P48643		T-complex protein 1 subunit epsilon		CCT5		0.19		0.61		0.122		0.0419		protein folding,binding of sperm to zona pellucida... [More]		protein binding,ATP binding,G-protein beta-subunit... [More]		zona pellucida receptor complex,nucleolus,cytoplas... [More]		45	49	103	AVTIFIR.2\|WVGGPEIELIAIATGGR.2\|WVGGPEIELIAIATGGR.3\|... [More]
SEN / CTL	P46781		40S ribosomal protein S9		RPS9		0.19		0.42		0.129		0.0438		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,protein binding... [More]		nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,ri... [More]		9	19	26	QVVNIPSFIVR.2\|QVVNIPSFIVR.3\|KQVVNIPSFIVR.3\|KQVVNIP... [More]
SEN / CTL	P04899		Guanine nucleotide-binding protein G(i) subunit alpha-2		GNAI2		0.18		0.41		8.03e-8		1.63e-7		activation of MAPKK activity,adenosine receptor si... [More]		G-protein coupled receptor binding,GTPase activity... [More]		nucleoplasm,cytoplasm,centrosome,cytosol,heterotri... [More]		33	27	44	IAQSDYIPTQQDVLR.2\|IAQSDYIPTQQDVLR.3\|AMGNLQIDFADPSR... [More]
SEN / CTL	P31948		Stress-induced-phosphoprotein 1		STIP1		0.18		0.31		0.000798		0.000626		response to stress		protein C-terminus binding,Hsp70 protein binding,p... [More]		nucleus,Golgi apparatus,myelin sheath,protein comp... [More]		30	71	131	TLLSDPTYRELIEQLR.3\|LMDVGLIAIR.2\|LM[Oxi]DVGLIAIR.2\|... [More]
SEN / CTL	P37802		Transgelin-2		TAGLN2		0.18		0.56		0.0395		0.0163		epithelial cell differentiation,cell-cell adhesion		cadherin binding involved in cell-cell adhesion		cell-cell adherens junction,vesicle,extracellular ... [More]		84	26	53	QYDADLEQILIQWITTQC[CAM]R.3\|QYDADLEQILIQWITTQC[CAM]... [More]
SEN / CTL	O60888		Protein CutA		CUTA		0.17		0.21		0.00126		0.000923		protein localization,response to metal ion		copper ion binding,enzyme binding		membrane,extracellular exosome		21	7	14	TQSSLVPALTDFVR.2\|TQSSLVPALTDFVR.3\|LAAC[CAM]VNLIPQI... [More]
SEN / CTL	P61160		Actin-related protein 2		ACTR2		0.17		0.51		0.00678		0.00391		movement of cell or subcellular component,establis... [More]		structural constituent of cytoskeleton,ATP binding... [More]		cytoplasm,cytosol,Arp2/3 protein complex,focal adh... [More]		54	23	52	VGNIEIKDLMVGDEASELR.3\|GYAFNHSADFETVR.3\|GYAFNHSADFE... [More]
SEN / CTL	P62241		40S ribosomal protein S8		RPS8		0.17		0.44		0.00947		0.00509		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,poly(A) RNA bin... [More]		nucleus,nucleoplasm,cytoplasm,cytosol,focal adhesi... [More]		21	23	39	ELEFYLR.2\|IIDVVYNASNNELVR.3\|IIDVVYNASNNELVR.2\|ISSL... [More]
SEN / CTL	P17936		Insulin-like growth factor-binding protein 3		IGFBP3		0.17		0.41		0.033		0.0143		regulation of cell growth,osteoblast differentiati... [More]		fibronectin binding,protein binding,insulin-like g... [More]		extracellular region,extracellular space,nucleus,i... [More]		9	10	13	C[CAM]QPSPDEARPLQALLDGR.3\|FLNVLSPR.2\|EMEDTLNHLK.3\|... [More]
SEN / CTL	Q14192		Four and a half LIM domains protein 2		FHL2		0.17		0.75		0.0579		0.0228		negative regulation of transcription from RNA poly... [More]		transcription coactivator activity,protein binding... [More]		nucleus,nucleoplasm,focal adhesion,actin cytoskele... [More]		21	26	39	GFLTERDDILC[CAM]PDC[CAM]GKDI.3\|SFIPKDNQNFC[CAM]VPC... [More]
SEN / CTL	P50502		Hsc70-interacting protein		ST13		0.16		0.42		0.00415		0.00255		protein folding,protein homooligomerization,negati... [More]		protein domain specific binding,Hsp70 protein bind... [More]		cytoplasm,cytosol,protein complex,extracellular ex... [More]		18	19	33	AIDLFTDAIK.2\|AIDLFTDAIKLNPR.3\|VAAIEALNDGELQK.2\|AIE... [More]
SEN / CTL	Q9UNH7		Sorting nexin-6		SNX6		0.16		0.67		0.0364		0.0153		intracellular protein transport,endocytosis,negati... [More]		protein binding,dynactin binding,phosphatidylinosi... [More]		intracellular,nucleus,cytoplasm,cytosol,cytoplasmi... [More]		9	25	36	NLVELAELELK.2\|SADGVIVSGVKDVDDFFEHER.4\|SADGVIVSGVKD... [More]
SEN / CTL	P54920		Alpha-soluble NSF attachment protein		NAPA		0.16		0.31		0.0894		0.0327		intracellular protein transport,ER to Golgi vesicl... [More]		soluble NSF attachment protein activity,protein bi... [More]		Golgi membrane,vacuolar membrane,cytosol,membrane,... [More]		18	24	43	IEEAC[CAM]EIYAR.2\|LAVQKYEELFPAFSDSR.3\|LAVQKYEELFPA... [More]
SEN / CTL	O95861		3'(2'),5'-bisphosphate nucleotidase 1		BPNT1		0.16		0.36		0.109		0.0383		nucleobase-containing compound metabolic process,n... [More]		magnesium ion binding,3'(2'),5'-bisphosphate nucle... [More]		cytoplasm,cytosol,extracellular exosome		15	19	27	RVIAEGDLGIVEK.3\|RVIAEGDLGIVEK.2\|LAQMSIC[CAM]SSLAR.... [More]
SEN / CTL	P17931		Galectin-3		LGALS3		0.15		0.33		0.00106		0.000802		monocyte chemotaxis,mRNA processing,RNA splicing,n... [More]		protein binding,IgE binding,carbohydrate binding,c... [More]		immunological synapse,extracellular space,nucleus,... [More]		21	12	19	IALDFQR.2\|MLITILGTVKPNANR.3\|M[Oxi]LITILGTVKPNANR.3... [More]
SEN / CTL	Q02952		A-kinase anchor protein 12		AKAP12		0.15		1.01		0.00685		0.00393		protein targeting,G-protein coupled receptor signa... [More]		adenylate cyclase binding,protein kinase A binding		cytoplasm,cytoskeleton,plasma membrane,focal adhes... [More]		81	84	109	VKEESQLPGTGGPEDVLQPVQR.3\|LVQNIIQTAVDQFVR.2\|LVQNIIQ... [More]
SEN / CTL	Q9UNM6		26S proteasome non-ATPase regulatory subunit 13		PSMD13		0.15		0.72		0.11		0.0383		MAPK cascade,protein polyubiquitination,stimulator... [More]		structural molecule activity		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		18	35	52	FLGC[CAM]VDIKDLPVSEQQER.3\|ITVNEVELLVMK.2\|ITVNEVELL... [More]
SEN / CTL	P14868		Aspartate--tRNA ligase, cytoplasmic		DARS		0.15		1.07		0.115		0.0399		translation,tRNA aminoacylation for protein transl... [More]		aminoacylase activity,aspartate-tRNA ligase activi... [More]		cytoplasm,cytosol,membrane,extracellular exosome		24	43	70	IYVISLAEPR.2\|IGSC[CAM]TQQDVELHVQK.3\|IGSC[CAM]TQQDV... [More]
SEN / CTL	P40926		Malate dehydrogenase, mitochondrial		MDH2		0.15		0.41		0.122		0.0419		gluconeogenesis,tricarboxylic acid cycle,oxaloacet... [More]		L-malate dehydrogenase activity,protein self-assoc... [More]		nucleus,nucleoplasm,mitochondrion,mitochondrial in... [More]		93	31	62	SQETEC[CAM]TYFSTPLLLGK.2\|SQETEC[CAM]TYFSTPLLLGK.3\|... [More]
SEN / CTL	Q9NYU2		UDP-glucose:glycoprotein glucosyltransferase 1		UGGT1		0.15		0.71		0.123		0.0421		protein N-linked glycosylation via asparagine,endo... [More]		UDP-glucose:glycoprotein glucosyltransferase activ... [More]		endoplasmic reticulum,endoplasmic reticulum lumen,... [More]		12	68	110	LGIEGLSLHNVLK.3\|LGIEGLSLHNVLK.2\|ILETTTFFQR.2\|IVPEW... [More]
SEN / CTL	P52907		F-actin-capping protein subunit alpha-1		CAPZA1		0.14		0.46		0.0000425		0.0000459		protein complex assembly,movement of cell or subce... [More]		actin binding,cadherin binding involved in cell-ce... [More]		extracellular region,cytosol,cytoskeleton,cell-cel... [More]		24	20	42	FTITPPTAQVVGVLK.2\|FTITPPTAQVVGVLK.3\|EASDPQPEEADGGL... [More]
SEN / CTL	P23528		Cofilin-1		CFL1		0.14		0.73		0.0735		0.0276		cytoskeleton organization,Rho protein signal trans... [More]		protein binding,actin filament binding		extracellular space,nucleus,cytoplasm,focal adhesi... [More]		42	22	40	LGGSAVISLEGKPL.2\|LGGSAVISLEGKPL.3\|NIILEEGKEILVGDVG... [More]
SEN / CTL	P50453		Serpin B9		SERPINB9		0.14		0.34		0.0938		0.0338		mast cell mediated immunity,apoptotic process,immu... [More]		protease binding,serine-type endopeptidase inhibit... [More]		extracellular space,intracellular,nucleus,cytoplas... [More]		15	21	29	LVLVNAIYFK.2\|AQLLELPYAR.2\|FC[CAM]ADHPFLFFIR.3\|FC[C... [More]
SEN / CTL	P61353		60S ribosomal protein L27		RPL27		0.13		0.27		0.133		0.0446		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,poly(A) RNA bin... [More]		nucleus,cytosol,ribosome,focal adhesion,membrane,c... [More]		6	11	19	VVLVLAGR.2\|NIDDGTSDRPYSHALVAGIDRYPR.5\|NIDDGTSDRPYS... [More]
SEN / CTL	P05556		Integrin beta-1		ITGB1		0.12		0.57		0.0103		0.00543		G1/S transition of mitotic cell cycle,in utero emb... [More]		virus receptor activity,fibronectin binding,protea... [More]		ruffle,cytoplasm,plasma membrane,cell-cell adheren... [More]		45	36	53	LKPEDITQIQPQQLVLR.3\|LKPEDITQIQPQQLVLR.2\|LKPEDITQIQ... [More]
SEN / CTL	P56537		Eukaryotic translation initiation factor 6		EIF6		0.12		0.4		0.0339		0.0145		ribosomal subunit export from nucleus,maturation o... [More]		translation initiation factor activity,protein bin... [More]		nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pr... [More]		24	13	23	HGLLVPNNTTDQELQHIR.4\|HGLLVPNNTTDQELQHIR.3\|TSIEDQDE... [More]
SEN / CTL	Q9BTY2		Plasma alpha-L-fucosidase		FUCA2		0.12		0.3		0.0752		0.0282		fucose metabolic process,response to bacterium,gly... [More]		alpha-L-fucosidase activity		extracellular space,extracellular exosome		21	12	14	LVYAIFLK.2\|EAGISDYLTIEELVK.2\|WPTSGQLFLGHPK.3\|WPTSG... [More]
SEN / CTL	P07602		Prosaposin		PSAP		0.12		1.36		0.091		0.0332		platelet degranulation,glycosphingolipid metabolic... [More]		G-protein coupled receptor binding,protein binding... [More]		extracellular region,extracellular space,cytoplasm... [More]		51	30	59	SDVYC[CAM]EVC[CAM]EFLVK.2\|SDVYC[CAM]EVC[CAM]EFLVK.... [More]
SEN / CTL	P15311		Ezrin		EZR		0.11		0.52		0.00897		0.0049		negative regulation of transcription from RNA poly... [More]		actin binding,protein binding,microtubule binding,... [More]		ruffle,immunological synapse,uropod,extracellular ... [More]		72	50	90	QRIDEFEAL.2\|GMLKDNAMLEYLK.3\|GMLKDNAMLEYLK.2\|SQEQLA... [More]
SEN / CTL	Q99613		Eukaryotic translation initiation factor 3 subunit C		EIF3C		0.11		0.76		0.0504		0.0201		formation of translation preinitiation complex,tra... [More]		translation initiation factor binding,poly(A) RNA ... [More]		cytosol,eukaryotic translation initiation factor 3... [More]		12	47	79	GC[CAM]ILTLVER.2\|AKELLGQGLLLR.3\|AKELLGQGLLLR.2\|RLD... [More]
SEN / CTL	P06737		Glycogen phosphorylase, liver form		PYGL		0.1		0.28		0.00113		0.000838		glycogen metabolic process,glycogen catabolic proc... [More]		purine nucleobase binding,protein binding,ATP bind... [More]		cytoplasm,cytosol,plasma membrane,extracellular ex... [More]		36	51	80	LHSFLGDDVFLR.3\|LHSFLGDDVFLR.2\|IFVDIEKLPWSK.3\|IFVDI... [More]
SEN / CTL	Q96QK1		Vacuolar protein sorting-associated protein 35		VPS35		0.1		0.63		0.0909		0.0332		intracellular protein transport,Wnt signaling path... [More]		protein binding,protein transporter activity,D1 do... [More]		lysosomal membrane,endosome,early endosome,late en... [More]		27	41	64	NIIIALIDR.2\|IRFTLPPLVFAAYQLAFR.3\|SEDPDQQYLILNTAR.2... [More]
SEN / CTL	P52565		Rho GDP-dissociation inhibitor 1		ARHGDIA		0.09		0.4		0.000323		0.000284		movement of cell or subcellular component,negative... [More]		Rho GDP-dissociation inhibitor activity,GTPase act... [More]		cytosol,cytoskeleton,extracellular exosome		57	15	29	AEEYEFLTPVEEAPK.2\|AEEYEFLTPVEEAPK.3\|SIQEIQELDKDDES... [More]
SEN / CTL	Q15084		Protein disulfide-isomerase A6		PDIA6		0.09		0.23		0.000397		0.00034		protein folding,response to endoplasmic reticulum ... [More]		protein disulfide isomerase activity,protein bindi... [More]		endoplasmic reticulum,endoplasmic reticulum lumen,... [More]		69	32	56	TGEAIVDAALSALR.2\|TGEAIVDAALSALR.3\|NSYLEVLLK.2\|GSFS... [More]
SEN / CTL	P98160		Basement membrane-specific heparan sulfate proteoglycan core protein		HSPG2		0.09		0.82		0.00915		0.00497		retinoid metabolic process,angiogenesis,glycosamin... [More]		calcium ion binding,protein binding,protein C-term... [More]		extracellular region,basement membrane,extracellul... [More]		390	163	239	LLSGPYFWSLPSR.2\|LLSGPYFWSLPSR.3\|AGLSSGFIGC[CAM]VR.... [More]
SEN / CTL	O00231		26S proteasome non-ATPase regulatory subunit 11		PSMD11		0.08		0.61		0.0022		0.0015		MAPK cascade,protein polyubiquitination,stimulator... [More]		structural molecule activity		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		27	33	53	YQEALHLGSQLLR.3\|YQEALHLGSQLLR.2\|AQSLLSTDREASIDILHS... [More]
SEN / CTL	P39060		Collagen alpha-1(XVIII) chain		COL18A1		0.08		0.36		0.111		0.0386		angiogenesis,endothelial cell morphogenesis,cell a... [More]		structural molecule activity,metal ion binding		extracellular region,collagen trimer,basement memb... [More]		60	31	46	LQDLYSIVR.2\|IFSFDGKDVLR.3\|DELLFPSWEALFSGSEGPLKPGAR... [More]
SEN / CTL	P00749		Urokinase-type plasminogen activator		PLAU		0.07		0.24		0.121		0.0417		response to hypoxia,proteolysis,chemotaxis,signal ... [More]		serine-type endopeptidase activity,protein binding		extracellular region,extracellular space,plasma me... [More]		12	6	7	IIGGEFTTIENQPWFAAIYR.3\|VSHFLPWIR.2\|DYSADTLAHHNDIAL... [More]
SEN / CTL	P13797		Plastin-3		PLS3		0.05		0.49		0.0561		0.0222		actin filament bundle assembly,actin filament netw... [More]		calcium ion binding,actin filament binding		cytoplasm,actin filament,actin filament bundle		33	45	74	AYFHLLNQIAPK.3\|AYFHLLNQIAPK.2\|VYALPEDLVEVKPK.3\|VYA... [More]
SEN / CTL	Q15404		Ras suppressor protein 1		RSU1		0.03		0.53		0.0657		0.0252		signal transduction,positive regulation of cell-su... [More]		protein binding		cytosol,focal adhesion,extracellular exosome		18	19	28	LQILSLRDNDLISLPK.3\|LQILSLRDNDLISLPK.2\|NLEVLNFFNNQI... [More]
SEN / CTL	P35606		Coatomer subunit beta'		COPB2		0.03		0.56		0.0688		0.0262		intracellular protein transport,ER to Golgi vesicl... [More]		structural molecule activity		Golgi membrane,endoplasmic reticulum membrane,cyto... [More]		15	61	94	TFEVC[CAM]DLPVR.2\|TFEVC[CAM]DLPVR.3\|KNWVVTGADDMQIR... [More]
SEN / CTL	Q02790		Peptidyl-prolyl cis-trans isomerase FKBP4		FKBP4		0.03		0.51		0.108		0.0378		protein peptidyl-prolyl isomerization,protein fold... [More]		peptidyl-prolyl cis-trans isomerase activity,prote... [More]		nucleoplasm,cytoplasm,mitochondrion,endoplasmic re... [More]		15	58	112	RGEAHLAVNDFELAR.3\|RGEAHLAVNDFELAR.4\|RGEAHLAVNDFELA... [More]
SEN / CTL	P52788		Spermine synthase		SMS		0.03		0.72		0.146		0.048		methionine metabolic process,polyamine metabolic p... [More]		spermine synthase activity		cytosol,extracellular exosome		24	28	36	LILDLSMK.2\|TC[CAM]GDVLDNLKGDC[CAM]YQVLIEDC[CAM]IPV... [More]
SEN / CTL	Q12906		Interleukin enhancer-binding factor 3		ILF3		0.02		0.69		0.0188		0.00892		transcription, DNA-templated,protein phosphorylati... [More]		DNA binding,RNA binding,double-stranded RNA bindin... [More]		nucleus,nucleoplasm,nucleolus,cytoplasm,mitochondr... [More]		21	70	118	SC[CAM]VIVIR.2\|C[CAM]LAALASLR.2\|HSSVYPTQEELEAVQNMV... [More]
SEN / CTL	P07237		Protein disulfide-isomerase		P4HB		0.01		0.82		0.0137		0.00686		response to reactive oxygen species,peptidyl-proli... [More]		protein disulfide isomerase activity,integrin bind... [More]		extracellular region,endoplasmic reticulum,endopla... [More]		156	62	113	ILFIFIDSDHTDNQR.3\|ILFIFIDSDHTDNQR.2\|VDATEESDLAQQYG... [More]
SEN / CTL	P42574		Caspase-3		CASP3		0		0.72		0.13		0.044		response to hypoxia,apoptotic DNA fragmentation,pr... [More]		protease binding,aspartic-type endopeptidase activ... [More]		nucleus,nucleoplasm,cytosol,plasma membrane,death-... [More]		12	16	19	LFIIQAC[CAM]R.2\|QYADKLEFMHILTR.3\|QYADKLEFMHILTR.4\|... [More]
SEN / CTL	P45974		Ubiquitin carboxyl-terminal hydrolase 5		USP5		-0.01		1.26		0.000149		0.000144		ubiquitin-dependent protein catabolic process,prot... [More]		cysteine-type endopeptidase activity,thiol-depende... [More]		lysosome		30	54	78	DGLGGLPDIVR.2\|DGLGGLPDIVRDR.3\|SAADSISESVPVGPK.2\|SA... [More]
SEN / CTL	P49720		Proteasome subunit beta type-3		PSMB3		-0.01		0.28		0.137		0.0454		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity,protein bind... [More]		proteasome complex,nucleus,nucleoplasm,cytoplasm,m... [More]		18	13	31	FGPYYTEPVIAGLDPK.2\|FGPYYTEPVIAGLDPK.3\|LYIGLAGLATDV... [More]
SEN / CTL	Q15843		NEDD8		NEDD8		-0.03		0.59		0.0474		0.0192		regulation of transcription from RNA polymerase II... [More]		protein binding,ubiquitin protein ligase binding		nucleus,cytosol,extracellular exosome		15	4	7	ILGGSVLHLVLALR.3\|ILGGSVLHLVLALR.2\|TLTGKEIEIDIEPTDK... [More]
SEN / CTL	Q9NTK5		Obg-like ATPase 1		OLA1		-0.03		0.52		0.081		0.0301		ATP metabolic process,cell-cell adhesion		ATP binding,GTP binding,ATPase activity,ribosome b... [More]		nucleolus,cytoplasm,centrosome,cell-cell adherens ... [More]		9	38	62	IPAFLNVVDIAGLVK.2\|IPAFLNVVDIAGLVK.3\|NYIVEDGDIIFFK.... [More]
SEN / CTL	P63241 Q6IS14		Eukaryotic translation initiation factor 5A-1;Eukaryotic translation initiation factor 5A-1-like		EIF5A EIF5AL1		-0.03		0.52		0.116		0.0401		mRNA export from nucleus,translational frameshifti... [More]		RNA binding,translation elongation factor activity... [More]		nucleus,annulate lamellae,nuclear pore,cytoplasm,e... [More]		36	7	21	VHLVGIDIFTGK.3\|VHLVGIDIFTGK.2\|YDC[CAM]GEEILITVLSAM... [More]
SEN / CTL	Q9H223		EH domain-containing protein 4		EHD4		-0.05		0.42		0.028		0.0125		pinocytosis,regulation of endocytosis,endocytic re... [More]		nucleic acid binding,calcium ion binding,protein b... [More]		nucleus,endoplasmic reticulum,plasma membrane,cell... [More]		9	32	46	EYQISAGDFPEVK.2\|EYQISAGDFPEVK.3\|YLLEQDFPGMR.2\|VYGA... [More]
SEN / CTL	O75223		Gamma-glutamylcyclotransferase		GGCT		-0.05		0.06		0.107		0.0378		release of cytochrome c from mitochondria,glutathi... [More]		gamma-glutamylcyclotransferase activity,protein ho... [More]		cytosol,extracellular exosome		3	15	18	NPSAAFFC[CAM]VAR.2\|NPSAAFFC[CAM]VAR.3\|VSEEIEDIIKK.... [More]
SEN / CTL	P49458		Signal recognition particle 9 kDa protein		SRP9		-0.06		0.24		0.102		0.0362		SRP-dependent cotranslational protein targeting to... [More]		RNA binding,signal recognition particle binding,pr... [More]		signal recognition particle receptor complex,signa... [More]		12	8	11	VTDDLVC[CAM]LVYK.2\|PQYQTWEEFSR.2\|PQYQTWEEFSR.3\|VTD... [More]
SEN / CTL	Q9HC38		Glyoxalase domain-containing protein 4		GLOD4		-0.06		0.32		0.151		0.049		cell-cell adhesion		cadherin binding involved in cell-cell adhesion		mitochondrion,cell-cell adherens junction,extracel... [More]		15	22	35	ILTPLVSLDTPGK.2\|ILTPLVSLDTPGK.3\|SLNYWC[CAM]NLLGMK.... [More]
SEN / CTL	P34932		Heat shock 70 kDa protein 4		HSPA4		-0.07		0.34		0.00000177		0.00000276		response to unfolded protein,protein import into m... [More]		protein binding,ATP binding		cytosol,extracellular exosome		66	85	157	EFSITDVVPYPISLR.2\|EFSITDVVPYPISLR.3\|AFSDPFVEAEKSNL... [More]
SEN / CTL	Q9BZK3		Putative nascent polypeptide-associated complex subunit alpha-like protein		NACAP1		-0.07		0.13		0.0187		0.00892								12	3	7	IEDLSQEAQLAAAEK.2\|IEDLSQEAQLAAAEK.3\|NILFVITKPDVYK.... [More]
SEN / CTL	P20618		Proteasome subunit beta type-1		PSMB1		-0.07		0.32		0.0361		0.0152		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity,protein bind... [More]		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		24	17	37	LVKDVFISAAERDVYTGDALR.4\|LVKDVFISAAERDVYTGDALR.3\|LS... [More]
SEN / CTL	P46108		Adapter molecule crk		CRK		-0.07		0.34		0.0621		0.0241		activation of MAPKK activity,regulation of transcr... [More]		SH3/SH2 adaptor activity,protein binding,enzyme bi... [More]		nucleus,cytoplasm,cytosol,plasma membrane,actin cy... [More]		21	23	29	VSHYIINSSGPRPPVPPSPAQPPPGVSPSR.4\|LSRQEAVALLQGQR.3\|... [More]
SEN / CTL	P09972		Fructose-bisphosphate aldolase C		ALDOC		-0.08		0.27		0.00157		0.00113		fructose metabolic process,gluconeogenesis,fructos... [More]		fructose-bisphosphate aldolase activity,protein bi... [More]		mitochondrion,cytosol,cytoskeleton,extracellular e... [More]		30	27	42	VDKGVVPLAGTDGETTTQGLDGLSER.3\|VDKGVVPLAGTDGETTTQGLD... [More]
SEN / CTL	P61970		Nuclear transport factor 2		NUTF2		-0.08		0.2		0.0406		0.0168		protein import into nucleus, translocation,protein... [More]		protein binding,protein transmembrane transporter ... [More]		nuclear outer membrane,nucleoplasm,cytosol,nuclear... [More]		12	8	20	NINDAWVC[CAM]TNDMFR.2\|NINDAWVC[CAM]TNDMFR.3\|NINDAW... [More]
SEN / CTL	E9PAV3 Q13765		Nascent polypeptide-associated complex subunit alpha, muscle-specific form;Nascent polypeptide-associated complex subunit alpha		NACA		-0.08		0.13		0.0487		0.0196		transcription, DNA-templated,regulation of transcr... [More]		DNA binding;		nucleus,cytoplasm;		9	2	4	IEDLSQQAQLAAAEK.3\|IEDLSQQAQLAAAEK.2\|SPASDTYIVFGEAK... [More]
SEN / CTL	P52209		6-phosphogluconate dehydrogenase, decarboxylating		PGD		-0.08		0.4		0.106		0.0373		pentose-phosphate shunt,pentose-phosphate shunt, o... [More]		phosphogluconate dehydrogenase (decarboxylating) a... [More]		nucleus,cytosol,extracellular exosome		42	36	73	GILFVGSGVSGGEEGAR.2\|GILFVGSGVSGGEEGAR.3\|GTGKWTAISA... [More]
SEN / CTL	O95757		Heat shock 70 kDa protein 4L		HSPA4L		-0.09		0.1		0.141		0.0467		protein folding,response to unfolded protein		ATP binding		nucleus,cytoplasm,cytosol		3	48	66	SGGIETIANEYSDR.2\|QDLPPLDEKPR.3\|SSGEM[Oxi]EVD.2\|MQV... [More]
SEN / CTL	P08133		Annexin A6		ANXA6		-0.1		0.34		0.00366		0.00234		calcium ion transport,regulation of muscle contrac... [More]		calcium ion binding,protein binding,GTP binding,ca... [More]		mitochondrion,lysosomal membrane,focal adhesion,me... [More]		96	72	121	GFGSDKEAILDIITSR.3\|GFGSDKEAILDIITSR.2\|ALIEILATR.2\|... [More]
SEN / CTL	Q04837		Single-stranded DNA-binding protein, mitochondrial		SSBP1		-0.11		0.35		0.0561		0.0222		DNA replication,mitochondrion organization,positiv... [More]		chromatin binding,single-stranded DNA binding,poly... [More]		nucleus,mitochondrion,mitochondrial matrix,mitocho... [More]		12	10	18	QVEGKNPVTIFSLATNEMWR.3\|NPVTIFSLATNEMWR.3\|NPVTIFSLA... [More]
SEN / CTL	P50395		Rab GDP dissociation inhibitor beta		GDI2		-0.12		0.71		0.0333		0.0143		signal transduction,small GTPase mediated signal t... [More]		Rab GDP-dissociation inhibitor activity,GTPase act... [More]		cytoplasm,Golgi apparatus,cytosol,focal adhesion,m... [More]		105	56	113	DLGTESQIFISR.2\|TDDYLDQPC[CAM]YETINR.2\|TDDYLDQPC[CA... [More]
SEN / CTL	P31150		Rab GDP dissociation inhibitor alpha		GDI1		-0.12		0.38		0.0472		0.0191		signal transduction,protein transport,Rab protein ... [More]		GDP-dissociation inhibitor activity,Rab GDP-dissoc... [More]		cytoplasm,Golgi apparatus,cytosol,midbody,neuron p... [More]		36	28	53	IIC[CAM]ILSHPIKNTNDANSC[CAM]QIIIPQNQVNR.4\|TDDYLDQP... [More]
SEN / CTL	P46976		Glycogenin-1		GYG1		-0.12		0.47		0.147		0.048		glycogen biosynthetic process,glycogen catabolic p... [More]		protein binding,glycogenin glucosyltransferase act... [More]		cytosol,membrane,lysosomal lumen,extracellular exo... [More]		9	11	16	GALVLGSSLK.2\|LVVLATPQVSDSMR.2\|LVVLATPQVSDSMR.3\|WEQ... [More]
SEN / CTL	P55786		Puromycin-sensitive aminopeptidase		NPEPPS		-0.13		0.55		0.00251		0.00166		protein polyubiquitination,proteolysis,peptide cat... [More]		aminopeptidase activity,zinc ion binding,peptide b... [More]		nucleus,cytosol,plasma membrane,extracellular exos... [More]		102	55	85	LNLGTVGFYR.2\|LGLQNDLFSLAR.2\|AGIISTVEVLK.2\|AFPC[CAM... [More]
SEN / CTL	P54802		Alpha-N-acetylglucosaminidase		NAGLU		-0.13		0.39		0.0324		0.014		glycosaminoglycan catabolic process,lysosome organ... [More]		alpha-N-acetylglucosaminidase activity		lysosome,lysosomal lumen,extracellular exosome		30	21	31	ALAAKPGLDTYSLGGGGAAR.3\|FLLGSWLEQAR.2\|KDPVPDLAAWVTS... [More]
SEN / CTL	P12956		X-ray repair cross-complementing protein 6		XRCC6		-0.13		0.51		0.112		0.0389		telomere maintenance,DNA ligation,double-strand br... [More]		DNA binding,damaged DNA binding,double-stranded DN... [More]		nuclear telomere cap complex,nuclear chromosome, t... [More]		42	66	122	DSLIFLVDASK.2\|SDSFENPVLQQHFR.3\|SDSFENPVLQQHFR.2\|NI... [More]
SEN / CTL	Q9UHV9		Prefoldin subunit 2		PFDN2		-0.13		0.23		0.147		0.048		protein folding,positive regulation of cytoskeleto... [More]		protein binding,protein binding involved in protei... [More]		nucleus,nucleoplasm,nucleolus,cytoplasm,mitochondr... [More]		12	9	15	GAVSAEQVIAGFNR.3\|GAVSAEQVIAGFNR.2\|IIETLTQQLQAK.2\|I... [More]
SEN / CTL	Q92945		Far upstream element-binding protein 2		KHSRP		-0.14		0.35		0.00666		0.00384		RNA splicing, via transesterification reactions,tr... [More]		DNA binding,protein binding,mRNA 3'-UTR AU-rich re... [More]		nucleoplasm,cytosol,cytoplasmic stress granule,mem... [More]		18	42	79	IINDLLQSLR.2\|IGGGIDVPVPR.2\|MMLDDIVSR.2\|M[Oxi]MLDDI... [More]
SEN / CTL	Q15459		Splicing factor 3A subunit 1		SF3A1		-0.14		0.06		0.0208		0.00969		regulation of alternative mRNA splicing, via splic... [More]		RNA binding,protein binding,poly(A) RNA binding		nucleoplasm,spliceosomal complex,U2-type spliceoso... [More]		3	50	82	LTAQFVAR.2\|GLVPEDDTKEK.3\|IRQNEINNPK.3\|IRQNEINNPK.2... [More]
SEN / CTL	Q86V81		THO complex subunit 4		ALYREF		-0.14		0.18		0.123		0.042		regulation of DNA recombination,mRNA splicing, via... [More]		nucleotide binding,protein binding,poly(A) RNA bin... [More]		transcription export complex,nucleus,nucleoplasm,c... [More]		6	12	20	SLGTADVHFER.3\|SLGTADVHFER.2\|LLVSNLDFGVSDADIQELFAEF... [More]
SEN / CTL	P62993		Growth factor receptor-bound protein 2		GRB2		-0.15		0.41		0.0207		0.00966		MAPK cascade,epidermal growth factor receptor sign... [More]		phosphotyrosine binding,SH3/SH2 adaptor activity,R... [More]		nucleus,nucleoplasm,nucleolus,cytoplasm,endosome,G... [More]		12	19	28	YFLWVVK.2\|FNSLNELVDYHR.3\|FNSLNELVDYHR.2\|RGDFIHVMDN... [More]
SEN / CTL	P05387		60S acidic ribosomal protein P2		RPLP2		-0.15		0.76		0.0746		0.028		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,large ribosomal... [More]		cytosol,focal adhesion,membrane,cytosolic large ri... [More]		45	13	30	NIEDVIAQGIGK.2\|NIEDVIAQGIGK.3\|ILDSVGIEADDDRLNK.3\|I... [More]
SEN / CTL	Q12765		Secernin-1		SCRN1		-0.15		0.48		0.0858		0.0317		proteolysis,exocytosis		molecular_function,dipeptidase activity		nucleus,cytoplasm,nuclear membrane		15	21	30	C[CAM]IC[CAM]SQLSLTTK.2\|SIFKPFIFVDDVK.3\|SIFKPFIFVD... [More]
SEN / CTL	P31946		14-3-3 protein beta/alpha		YWHAB		-0.16		0.74		0.00317		0.00205		MAPK cascade,protein targeting,viral process,negat... [More]		transcription corepressor activity,protein binding... [More]		nucleus,cytoplasm,mitochondrion,cytosol,cell-cell ... [More]		57	37	87	NLLSVAYK.2\|NLLSVAYK.1\|NLLSVAYKNVVGAR.3\|NLLSVAYKNVV... [More]
SEN / CTL	P51991		Heterogeneous nuclear ribonucleoprotein A3		HNRNPA3		-0.16		0.28		0.0302		0.0133		mRNA splicing, via spliceosome,gene expression,mRN... [More]		nucleotide binding,RNA binding,mRNA binding,protei... [More]		nucleus,nucleoplasm,cytoplasm,intracellular ribonu... [More]		12	32	62	YGKIETIEVMEDR.3\|YGKIETIEVMEDR.2\|IETIEVMEDR.2\|IETIE... [More]
SEN / CTL	P11166		Solute carrier family 2, facilitated glucose transporter member 1		SLC2A1		-0.16		0.31		0.0359		0.0152		lactose biosynthetic process,protein complex assem... [More]		glucose transmembrane transporter activity,protein... [More]		Golgi membrane,female pronucleus,cytosol,plasma me... [More]		9	10	17	TFDEIASGFR.2\|VTILELFR.2\|LRGTADVTHDLQEMKEESR.4\|LRGT... [More]
SEN / CTL	Q9HAT2		Sialate O-acetylesterase		SIAE		-0.16		0.3		0.0389		0.0162		regulation of immune system process,carbohydrate m... [More]		sialate O-acetylesterase activity		extracellular space,lysosome,extracellular exosome		12	18	31	WHQTADFGYVPNPK.3\|WHQTADFGYVPNPK.2\|YMSAVC[CAM]WLFGR... [More]
SEN / CTL	P18206		Vinculin		VCL		-0.17		0.9		0.0113		0.00589		morphogenesis of an epithelium,platelet degranulat... [More]		dystroglycan binding,actin binding,structural mole... [More]		extracellular region,cytosol,cytoskeleton,plasma m... [More]		198	102	192	AIPDLTAPVAAVQAAVSNLVR.3\|AIPDLTAPVAAVQAAVSNLVR.2\|GW... [More]
SEN / CTL	P09960		Leukotriene A-4 hydrolase		LTA4H		-0.17		0.7		0.0126		0.00644		proteolysis,leukotriene metabolic process,leukotri... [More]		aminopeptidase activity,epoxide hydrolase activity... [More]		nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr... [More]		48	45	79	PEIVDTC[CAM]SLASPASVC[CAM]R.3\|PEIVDTC[CAM]SLASPASV... [More]
SEN / CTL	O75083		WD repeat-containing protein 1		WDR1		-0.17		0.9		0.0267		0.0121		platelet degranulation,sensory perception of sound... [More]		actin filament binding		podosome,extracellular region,cytoplasm,cytosol,ac... [More]		87	47	76	LYSILGTTLKDEGK.3\|LYSILGTTLKDEGK.2\|VFASLPQVER.2\|YAP... [More]
SEN / CTL	P04424		Argininosuccinate lyase		ASL		-0.17		0.48		0.0355		0.0151		urea cycle,internal protein amino acid acetylation... [More]		argininosuccinate lyase activity,protein binding		cytoplasm,cytosol,extracellular exosome		12	29	36	FNASIAYDR.2\|MAEDLILYC[CAM]TK.2\|INVLPLGSGAIAGNPLGVD... [More]
SEN / CTL	Q13838		Spliceosome RNA helicase DDX39B		DDX39B		-0.17		0.39		0.0958		0.0344		spliceosomal complex assembly,mRNA splicing, via s... [More]		ATP-dependent RNA helicase activity,protein bindin... [More]		transcription export complex,nucleus,nucleoplasm,s... [More]		18	15	31	VAVFFGGLSIK.2\|C[CAM]IALAQLLVEQNFPAIAIHR.3\|C[CAM]IA... [More]
SEN / CTL	P24534		Elongation factor 1-beta		EEF1B2		-0.17		0.39		0.122		0.0419		translational elongation,response to ethanol		translation elongation factor activity,protein bin... [More]		cytoplasm,cytosol,eukaryotic translation elongatio... [More]		18	13	25	LVPVGYGIK.2\|SIQADGLVWGSSK.2\|SIQADGLVWGSSK.3\|SSILLD... [More]
SEN / CTL	P04075		Fructose-bisphosphate aldolase A		ALDOA		-0.18		0.88		0.000072		0.0000744		platelet degranulation,fructose metabolic process,... [More]		actin binding,fructose-bisphosphate aldolase activ... [More]		extracellular region,extracellular space,nucleus,c... [More]		153	51	110	VDKGVVPLAGTNGETTTQGLDGLSER.3\|VDKGVVPLAGTNGETTTQGLD... [More]
SEN / CTL	P31153		S-adenosylmethionine synthase isoform type-2		MAT2A		-0.18		0.27		0.0265		0.012		S-adenosylmethionine biosynthetic process,one-carb... [More]		methionine adenosyltransferase activity,protein bi... [More]		cytosol,methionine adenosyltransferase complex		15	24	40	NFDLRPGVIVR.3\|FVIGGPQGDAGLTGR.2\|FVIGGPQGDAGLTGR.3\|... [More]
SEN / CTL	P14174		Macrophage migration inhibitory factor		MIF		-0.18		0.33		0.135		0.0449		prostaglandin biosynthetic process,negative regula... [More]		dopachrome isomerase activity,receptor binding,cyt... [More]		extracellular region,extracellular space,nucleopla... [More]		30	10	22	PMFIVNTNVPR.2\|PMFIVNTNVPR.3\|PM[Oxi]FIVNTNVPR.2\|PM[... [More]
SEN / CTL	P04264		Keratin, type II cytoskeletal 1		KRT1		-0.19		0.72		0.0000149		0.000018		complement activation, lectin pathway,retina homeo... [More]		receptor activity,structural molecule activity,pro... [More]		extracellular space,nucleus,cytoskeleton,plasma me... [More]		87	64	116	LALDLEIATYR.2\|SLNNQFASFIDKVR.3\|SLNNQFASFIDKVR.2\|WE... [More]
SEN / CTL	P25787		Proteasome subunit alpha type-2		PSMA2		-0.19		0.18		0.000417		0.000354		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity,protein bind... [More]		proteasome complex,cytoplasmic mRNA processing bod... [More]		24	15	31	RLTPTEVKDYLAAIA.3\|KLAQQYYLVYQEPIPTAQLVQR.3\|KLAQQYY... [More]
SEN / CTL	O14818		Proteasome subunit alpha type-7		PSMA7		-0.19		0.74		0.0728		0.0274		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity,protein bind... [More]		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		39	16	28	LTVEDPVTVEYITR.2\|LTVEDPVTVEYITR.3\|KIC[CAM]ALDDNVC[... [More]
SEN / CTL	O75436		Vacuolar protein sorting-associated protein 26A		VPS26A		-0.19		0.41		0.103		0.0365		intracellular protein transport,Wnt signaling path... [More]		protein binding,protein transporter activity		endosome,early endosome,cytosol,endosome membrane,... [More]		21	22	31	YFLNLVLVDEEDRR.3\|ELALPGELTQSR.2\|LFLAGYDPTPTMR.2\|LF... [More]
SEN / CTL	P13861		cAMP-dependent protein kinase type II-alpha regulatory subunit		PRKAR2A		-0.19		1.19		0.134		0.0448		renal water homeostasis,blood coagulation,activati... [More]		cAMP-dependent protein kinase inhibitor activity,p... [More]		cytoplasm,centrosome,cytosol,plasma membrane,focal... [More]		18	23	31	SLEVSER.2\|NLDQEQLSQVLDAMFER.3\|NLDQEQLSQVLDAMFER.2\|... [More]
SEN / CTL	Q13510		Acid ceramidase		ASAH1		-0.2		0.12		0.00423		0.00258		ceramide metabolic process,glycosphingolipid metab... [More]		catalytic activity,ceramidase activity		extracellular space,lysosomal lumen,extracellular ... [More]		9	24	34	LTVYTTLIDVTK.2\|ESLDVYELDAK.2\|TSQENISFETMYDVLSTKPVL... [More]
SEN / CTL	P14854		Cytochrome c oxidase subunit 6B1		COX6B1		-0.2		0.2		0.0314		0.0137		mitochondrial electron transport, cytochrome c to ... [More]		cytochrome-c oxidase activity		mitochondrion,mitochondrial inner membrane,mitocho... [More]		9	9	12	GGDISVC[CAM]EWYQR.2\|NC[CAM]WQNYLDFHR.3\|NC[CAM]WQNY... [More]
SEN / CTL	O15230		Laminin subunit alpha-5		LAMA5		-0.21		0.59		3.62e-7		6.69e-7		angiogenesis,branching involved in ureteric bud mo... [More]		integrin binding,structural molecule activity		extracellular region,basement membrane,basal lamin... [More]		123	77	89	LGLVWAALQGAR.2\|ILQAVQAAEDAAGQALQQADHTWATVVR.3\|ILQA... [More]
SEN / CTL	P12429		Annexin A3		ANXA3		-0.21		0.35		0.00000406		0.00000579		phagocytosis,positive regulation of endothelial ce... [More]		calcium ion binding,calcium-dependent phospholipid... [More]		cytoplasm,plasma membrane,membrane,axon,dendrite,p... [More]		66	31	45	MLISILTER.2\|GAGTNEDALIEILTTR.2\|GAGTNEDALIEILTTR.3\|... [More]
SEN / CTL	Q9Y696		Chloride intracellular channel protein 4		CLIC4		-0.21		0.36		0.000272		0.000243		angiogenesis,endothelial cell morphogenesis,chlori... [More]		voltage-gated ion channel activity,chloride channe... [More]		intracellular,cytoplasm,mitochondrion,centrosome,c... [More]		30	24	43	GVVFSVTTVDLK.2\|YLTNAYSRDEFTNTC[CAM]PSDKEVEIAYSDVAK... [More]
SEN / CTL	Q9Y3B8		Oligoribonuclease, mitochondrial		REXO2		-0.21		0.12		0.000592		0.000481		nucleobase-containing compound metabolic process,n... [More]		3'-5'-exoribonuclease activity,nucleic acid bindin... [More]		nucleus,nucleolus,mitochondrion,mitochondrial inte... [More]		9	14	18	ESTITLQQAEYEFLSFVR.3\|ESTITLQQAEYEFLSFVR.2\|ALDDISES... [More]
SEN / CTL	P53634		Dipeptidyl peptidase 1		CTSC		-0.21		0.39		0.00183		0.00128		T cell mediated cytotoxicity,proteolysis,ER to Gol... [More]		cysteine-type endopeptidase activity,serine-type e... [More]		Golgi membrane,extracellular space,lysosome,endopl... [More]		24	16	31	GTDEC[CAM]AIESIAVAATPIPKL.2\|NSWGTGWGENGYFR.2\|RGTDE... [More]
SEN / CTL	P01034		Cystatin-C		CST3		-0.21		0.52		0.0102		0.00541		eye development,response to hypoxia,cell activatio... [More]		beta-amyloid binding,protease binding,endopeptidas... [More]		extracellular region,basement membrane,extracellul... [More]		27	7	11	ALDFAVGEYNK.2\|KQIVAGVNYFLDVELGR.3\|TQPNLDNC[CAM]PFH... [More]
SEN / CTL	Q03252		Lamin-B2		LMNB2		-0.21		0.62		0.0252		0.0115		biological_process		molecular_function,structural molecule activity		nuclear inner membrane,lamin filament		24	59	82	LQIEIGK.2\|GLESDVAELR.2\|ALELENDRLLLK.3\|ALELENDRLLLK... [More]
SEN / CTL	Q96G03		Phosphoglucomutase-2		PGM2		-0.21		0.44		0.0301		0.0133		glycogen biosynthetic process,glycogen catabolic p... [More]		magnesium ion binding,phosphoglucomutase activity,... [More]		cytosol,extracellular exosome		15	36	58	LAATTFISQGIPVYLFSDITPTPFVPFTVSHLK.4\|LAATTFISQGIPVY... [More]
SEN / CTL	P20810		Calpastatin		CAST		-0.21		1.1		0.0374		0.0156		negative regulation of endopeptidase activity,cell... [More]		endopeptidase inhibitor activity,cysteine-type end... [More]		cytoplasm,endoplasmic reticulum,cytosol,cell-cell ... [More]		15	48	69	C[CAM]GEDDETIPSEYR.2\|SESELIDELSEDFDRSEC[CAM]K.3\|GT... [More]
SEN / CTL	Q99497		Protein deglycase DJ-1		PARK7		-0.22		0.4		2.38e-8		5.64e-8		negative regulation of protein phosphorylation,neg... [More]		transcription coactivator activity,mRNA binding,re... [More]		chromatin,nucleus,cytoplasm,mitochondrion,mitochon... [More]		45	27	55	DGLILTSR.2\|GPGTSFEFALAIVEALNGKEVAAQVK.3\|GPGTSFEFAL... [More]
SEN / CTL	P13929		Beta-enolase		ENO3		-0.22		0.3		0.0103		0.00543		gluconeogenesis,aging,response to drug,skeletal mu... [More]		magnesium ion binding,phosphopyruvate hydratase ac... [More]		phosphopyruvate hydratase complex,extracellular sp... [More]		9	14	19	VNQIGSVTESIQAC[CAM]K.2\|VNQIGSVTESIQAC[CAM]K.3\|YGKD... [More]
SEN / CTL	Q9Y5Z4		Heme-binding protein 2		HEBP2		-0.22		0.59		0.0949		0.0342		negative regulation of mitochondrial membrane pote... [More]		protein binding		cytoplasm,mitochondrion,extracellular exosome		9	10	11	AEMTVFVR.2\|NQEQLLTLASILR.2\|NQEQLLTLASILR.3\|VYYTAGY... [More]
SEN / CTL	O95967		EGF-containing fibulin-like extracellular matrix protein 2		EFEMP2		-0.22		0.42		0.0958		0.0344				extracellular matrix structural constituent,calciu... [More]		extracellular region,basement membrane,extracellul... [More]		6	6	6	C[CAM]INHYGGYLC[CAM]LPR.3\|LC[CAM]QDIDEC[CAM]ESGAHQ... [More]
SEN / CTL	P07858		Cathepsin B		CTSB		-0.23		0.44		0.00219		0.0015		toll-like receptor signaling pathway,proteolysis,c... [More]		cysteine-type endopeptidase activity,serine-type e... [More]		extracellular region,extracellular space,intracell... [More]		39	22	46	VMFTEDLKLPASFDAR.3\|EQWPQC[CAM]PTIK.2\|GQDHC[CAM]GIE... [More]
SEN / CTL	P05386		60S acidic ribosomal protein P1		RPLP1		-0.23		0.24		0.00921		0.00498		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,protein binding... [More]		cytoplasm,cytosol,focal adhesion,cytosolic large r... [More]		15	5	12	AAGVNVEPFWPGLFAK.2\|AAGVNVEPFWPGLFAK.3\|ALANVNIGSLIC... [More]
SEN / CTL	O00148		ATP-dependent RNA helicase DDX39A		DDX39A		-0.23		0.39		0.108		0.0378		mRNA splicing, via spliceosome,termination of RNA ... [More]		ATP-dependent RNA helicase activity,protein bindin... [More]		nucleus,nucleoplasm,spliceosomal complex,membrane,... [More]		27	28	52	ILVATNLFGR.2\|GLAITFVSDENDAK.2\|GLAITFVSDENDAK.3\|DFL... [More]
SEN / CTL	P29401		Transketolase		TKT		-0.24		0.69		3.26e-8		7.34e-8		xylulose biosynthetic process,pentose-phosphate sh... [More]		transketolase activity,protein homodimerization ac... [More]		nucleus,nucleoplasm,peroxisome,cytosol,vesicle,mye... [More]		150	53	103	TVPFC[CAM]STFAAFFTR.2\|TVPFC[CAM]STFAAFFTR.3\|VLDPFT... [More]
SEN / CTL	P11021		78 kDa glucose-regulated protein		HSPA5		-0.24		1.05		0.0202		0.0095		ER overload response,activation of signaling prote... [More]		glycoprotein binding,calcium ion binding,protein b... [More]		nucleus,mitochondrion,endoplasmic reticulum,endopl... [More]		165	68	133	IINEPTAAAIAYGLDKR.3\|IINEPTAAAIAYGLDKR.2\|VLEDSDLKKS... [More]
SEN / CTL	O00469		Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2		PLOD2		-0.24		0.59		0.143		0.0471		response to hypoxia,cellular protein modification ... [More]		iron ion binding,procollagen-lysine 5-dioxygenase ... [More]		endoplasmic reticulum,endoplasmic reticulum membra... [More]		33	33	47	SEDYVDIVQGNR.2\|VLGQGEEWRGGDGINSIGGGQK.3\|IFTENIVEQP... [More]
SEN / CTL	P08758		Annexin A5		ANXA5		-0.25		0.74		0.000369		0.000319		signal transduction,blood coagulation,response to ... [More]		phospholipase inhibitor activity,calcium ion bindi... [More]		intracellular,cytoplasm,focal adhesion,external si... [More]		108	45	70	GLGTDEESILTLLTSR.3\|GLGTDEESILTLLTSR.2\|VLTEIIASR.2\|... [More]
SEN / CTL	Q9NUQ9		Protein FAM49B		FAM49B		-0.26		0.32		0.00323		0.00208						cilium,membrane,extracellular exosome		12	23	41	VLKDQPPNSVEGLLNALR.3\|VLKDQPPNSVEGLLNALR.2\|INNVPAEG... [More]
SEN / CTL	Q9Y287		Integral membrane protein 2B		ITM2B		-0.26		0.66		0.0316		0.0138		nervous system development,negative regulation of ... [More]		beta-amyloid binding,protein binding,ATP binding		Golgi membrane,extracellular region,extracellular ... [More]		6	6	6	NLLELLINIK.2\|FAVETLIC[CAM]S.2\|VTFNSALAQK.2\|IENIDHL... [More]
SEN / CTL	Q15274		Nicotinate-nucleotide pyrophosphorylase [carboxylating]		QPRT		-0.27		0.27		0.00000734		0.00000976		NAD biosynthetic process,NAD metabolic process,qui... [More]		nicotinate-nucleotide diphosphorylase (carboxylati... [More]		cytoplasm,cytosol,extracellular exosome		18	11	15	C[CAM]SGIASAAAAAVEAAR.3\|C[CAM]SGIASAAAAAVEAAR.2\|YD... [More]
SEN / CTL	Q96C90		Protein phosphatase 1 regulatory subunit 14B		PPP1R14B		-0.27		0.28		0.000734		0.000581		regulation of protein dephosphorylation,regulation... [More]		protein serine/threonine phosphatase inhibitor act... [More]		cytoplasm		15	9	14	VKELLVDC[CAM]YKPTEAFISGLLDKIR.4\|VYFQSPPGAAGEGPGGAD... [More]
SEN / CTL	Q9NVN3		Synembryn-B		RIC8B		-0.27		0.19		0.121		0.0416		regulation of G-protein coupled receptor protein s... [More]		G-protein alpha-subunit binding,guanyl-nucleotide ... [More]		cytoplasm,centrosome,cytosol,plasma membrane,cell ... [More]		3	1	1	GSSYREGLTPVLSLLTEC[CAM]SR.3
SEN / CTL	P30101		Protein disulfide-isomerase A3		PDIA3		-0.28		0.98		0.00000233		0.00000355		antigen processing and presentation of peptide ant... [More]		protein disulfide isomerase activity,cysteine-type... [More]		nucleus,endoplasmic reticulum,endoplasmic reticulu... [More]		120	62	120	FLQDYFDGNLKR.3\|FLQDYFDGNLKR.2\|KTFSHELSDFGLESTAGEIP... [More]
SEN / CTL	O14979		Heterogeneous nuclear ribonucleoprotein D-like		HNRNPDL		-0.28		0.3		0.0000807		0.0000819		transcription, DNA-templated,regulation of transcr... [More]		nucleotide binding,DNA binding,poly(A) RNA binding		nucleoplasm,cytoplasm,extracellular exosome		18	22	35	DLTEYLSR.2\|FGEVVDC[CAM]TIK.2\|GFGFVLFK.2\|GFGFVLFK.1... [More]
SEN / CTL	P10599		Thioredoxin		TXN		-0.28		0.27		0.000516		0.00043		sulfate assimilation,negative regulation of transc... [More]		protein binding,protein disulfide oxidoreductase a... [More]		nucleus,nucleoplasm,cytoplasm,mitochondrion,cytoso... [More]		24	12	20	TAFQEALDAAGDKLVVVDFSATWC[CAM]GPC[CAM]K.4\|TAFQEALDA... [More]
SEN / CTL	P25789		Proteasome subunit alpha type-4		PSMA4		-0.28		0.91		0.00263		0.00173		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity,protein bind... [More]		proteasome complex,cytoplasmic mRNA processing bod... [More]		36	18	30	LLDEVFFSEK.2\|IYKLNEDMAC[CAM]SVAGITSDANVLTNELR.3\|YL... [More]
SEN / CTL	P63104		14-3-3 protein zeta/delta		YWHAZ		-0.28		1.42		0.00692		0.00396		protein targeting,signal transduction,platelet act... [More]		protein binding,transcription factor binding,prote... [More]		extracellular space,nucleus,nucleoplasm,cytoplasm,... [More]		84	22	53	IETELRDIC[CAM]NDVLSLLEK.3\|IETELRDIC[CAM]NDVLSLLEK.... [More]
SEN / CTL	Q14393		Growth arrest-specific protein 6		GAS6		-0.28		0.62		0.019		0.00903		neuron migration,positive regulation of protein ph... [More]		phosphatidylserine binding,receptor binding,voltag... [More]		extracellular region,extracellular space,cytoplasm... [More]		15	11	13	SPVLTFAGGLPDVPVTSAPVTAFYR.3\|AVPLSVALVDYHSTK.3\|AVPL... [More]
SEN / CTL	O43670		BUB3-interacting and GLEBS motif-containing protein ZNF207		ZNF207		-0.28		0.1		0.0231		0.0107		mitotic sister chromatid segregation,microtubule b... [More]		DNA binding,transcription factor activity, sequenc... [More]		kinetochore,condensed chromosome kinetochore,nucle... [More]		3	10	12	LIHPDEDISLEER.3\|LIHPDEDISLEER.2\|LIHPDEDISLEERR.4\|L... [More]
SEN / CTL	P98172		Ephrin-B1		EFNB1		-0.28		0.19		0.112		0.0389		neural crest cell migration,cell adhesion,cell-cel... [More]		protein binding,ephrin receptor binding		nucleus,cytoplasm,plasma membrane,integral compone... [More]		3	4	4	LYLVRPEQAAAC[CAM]STVLDPNVLVTC[CAM]NRPEQEIR.4\|AAALS... [More]
SEN / CTL	O43278		Kunitz-type protease inhibitor 1		SPINT1		-0.28		0.19		0.15		0.0488		neural tube closure,negative regulation of endopep... [More]		serine-type endopeptidase inhibitor activity		extracellular region,extracellular space,plasma me... [More]		6	11	13	EGFINYLTR.2\|WYYNPFSEHC[CAM]AR.3\|GHC[CAM]VDLPDTGLC[... [More]
SEN / CTL	P06733		Alpha-enolase		ENO1		-0.29		0.83		7.16e-10		2.25e-9		gluconeogenesis,transcription, DNA-templated,respo... [More]		magnesium ion binding,DNA binding,phosphopyruvate ... [More]		phosphopyruvate hydratase complex,extracellular sp... [More]		228	56	121	VNQIGSVTESLQAC[CAM]K.2\|VNQIGSVTESLQAC[CAM]K.3\|YISP... [More]
SEN / CTL	P00338		L-lactate dehydrogenase A chain		LDHA		-0.29		1.05		0.000129		0.000126		response to hypoxia,lactate metabolic process,pyru... [More]		L-lactate dehydrogenase activity,protein binding,k... [More]		nucleus,cytosol,cell-cell adherens junction,membra... [More]		123	38	92	LVIITAGAR.2\|VTLTSEEEAR.2\|QVVESAYEVIK.2\|QVVESAYEVIK... [More]
SEN / CTL	P60174		Triosephosphate isomerase		TPI1		-0.29		0.74		0.000129		0.000126		gluconeogenesis,glycolytic process,pentose-phospha... [More]		triose-phosphate isomerase activity,ubiquitin prot... [More]		extracellular space,nucleus,cytosol,extracellular ... [More]		156	37	70	VVLAYEPVWAIGTGK.2\|VVLAYEPVWAIGTGK.3\|VPADTEVVC[CAM]... [More]
SEN / CTL	Q13442		28 kDa heat- and acid-stable phosphoprotein		PDAP1		-0.29		0.31		0.0002		0.000189		signal transduction,cell proliferation		poly(A) RNA binding				12	15	23	KGVEGLIDIENPNR.3\|KGVEGLIDIENPNR.2\|GVEGLIDIENPNR.2\|... [More]
SEN / CTL	P60900		Proteasome subunit alpha type-6		PSMA6		-0.29		0.39		0.000979		0.000751		MAPK cascade,protein polyubiquitination,stimulator... [More]		RNA binding,endopeptidase activity,threonine-type ... [More]		proteasome complex,cytoplasmic mRNA processing bod... [More]		30	20	30	LYQVEYAFK.2\|KVPDKLLDSSTVTHLFK.4\|KVPDKLLDSSTVTHLFK.... [More]
SEN / CTL	P30040		Endoplasmic reticulum resident protein 29		ERP29		-0.3		0.37		0.000115		0.000114		activation of MAPK activity,positive regulation of... [More]		protein homodimerization activity,chaperone bindin... [More]		endoplasmic reticulum,endoplasmic reticulum lumen,... [More]		30	22	35	SLNILTAFQK.2\|DGDFENPVPYTGAVK.2\|DGDFENPVPYTGAVK.3\|Y... [More]
SEN / CTL	Q96AE4		Far upstream element-binding protein 1		FUBP1		-0.3		0.99		0.0539		0.0215		regulation of transcription, DNA-templated,transcr... [More]		single-stranded DNA binding,transcription factor a... [More]		nucleus,nucleoplasm		21	39	63	FAVGIVIGR.2\|IGGNEGIDVPIPR.2\|IGGNEGIDVPIPR.3\|C[CAM]... [More]
SEN / CTL	P61960		Ubiquitin-fold modifier 1		UFM1		-0.3		0.4		0.0938		0.0338		regulation of intracellular estrogen receptor sign... [More]				nucleus,cytoplasm,extracellular exosome		9	5	9	VLSVPESTPFTAVLK.2\|VLSVPESTPFTAVLK.3\|FAAEEFKVPAATSA... [More]
SEN / CTL	P09651		Heterogeneous nuclear ribonucleoprotein A1		HNRNPA1		-0.31		0.37		1.11e-8		2.83e-8		mRNA splicing, via spliceosome,mRNA processing,RNA... [More]		nucleotide binding,single-stranded DNA binding,RNA... [More]		nucleus,nucleoplasm,spliceosomal complex,cytoplasm... [More]		42	41	92	LFIGGLSFETTDESLR.2\|LFIGGLSFETTDESLR.3\|KLFIGGLSFETT... [More]
SEN / CTL	O00410		Importin-5		IPO5		-0.31		0.6		0.000453		0.00038		protein import into nucleus, docking,protein impor... [More]		GTPase inhibitor activity,protein binding,nuclear ... [More]		nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla... [More]		39	61	119	ITFLLQAIR.2\|VIAALLQTMEDQGNQR.2\|VIAALLQTMEDQGNQR.3\|... [More]
SEN / CTL	Q8IWT0		Protein archease		ZBTB8OS		-0.31		0.16		0.0638		0.0246		tRNA splicing, via endonucleolytic cleavage and li... [More]		metal ion binding		nucleoplasm,extracellular exosome,tRNA-splicing li... [More]		3	2	2	FSADEFFIPR.2\|SIGWGEEFSLSK.2
SEN / CTL	P35237		Serpin B6		SERPINB6		-0.32		0.3		5.51e-7		9.73e-7		sensory perception of sound,negative regulation of... [More]		protease binding,serine-type endopeptidase inhibit... [More]		extracellular space,cytoplasm,cytosol,protein comp... [More]		45	28	44	LVLVNAVYFR.2\|SC[CAM]DFLSSFR.2\|IAELLSPGSVDPLTR.2\|IA... [More]
SEN / CTL	P26599		Polypyrimidine tract-binding protein 1		PTBP1		-0.32		0.48		0.0267		0.0121		alternative mRNA splicing, via spliceosome,regulat... [More]		nucleotide binding,RNA binding,protein binding,pol... [More]		nucleoplasm,nucleolus,membrane,extracellular exoso... [More]		18	35	87	VTPQSLFILFGVYGDVQR.3\|VTPQSLFILFGVYGDVQR.2\|KLPIDVTE... [More]
SEN / CTL	Q6PCB0		von Willebrand factor A domain-containing protein 1		VWA1		-0.32		0.24		0.0361		0.0152		extracellular matrix organization,behavioral respo... [More]		identical protein binding		basement membrane,interstitial matrix,extracellula... [More]		6	15	25	EQLFAEASGARPGVPK.3\|EQLFAEASGARPGVPK.2\|VREFVGQLVAPL... [More]
SEN / CTL	Q9Y2B0		Protein canopy homolog 2		CNPY2		-0.33		0.33		0.000063		0.000067		enzyme linked receptor protein signaling pathway,t... [More]		protein binding		endoplasmic reticulum,integral component of plasma... [More]		21	15	27	INPDGSQSVVEVPYAR.2\|INPDGSQSVVEVPYAR.3\|SEAHLTELLEEI... [More]
SEN / CTL	Q969H8		Myeloid-derived growth factor		MYDGF		-0.33		0.36		0.000689		0.000555		angiogenesis,positive regulation of protein phosph... [More]		protein binding		extracellular space,endoplasmic reticulum lumen,en... [More]		18	8	13	SYLYFTQFK.2\|ESDVPLKTEEFEVTK.3\|ESDVPLKTEEFEVTK.2\|AA... [More]
SEN / CTL	Q07021		Complement component 1 Q subcomponent-binding protein, mitochondrial		C1QBP		-0.33		0.18		0.00187		0.0013		negative regulation of transcription from RNA poly... [More]		complement component C1q binding,transcription cor... [More]		extracellular space,nucleus,nucleolus,cytoplasm,mi... [More]		6	12	21	ALVLDC[CAM]HYPEDEVGQEDEAESDIFSIR.3\|ALVLDC[CAM]HYPE... [More]
SEN / CTL	P36551		Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial		CPOX		-0.33		0.5		0.00743		0.00419		protoporphyrinogen IX biosynthetic process,heme bi... [More]		coproporphyrinogen oxidase activity,structural con... [More]		cytoplasm,mitochondrion,mitochondrial inner membra... [More]		9	29	42	AVVPSYIPLVK.2\|IESILMSLPLTAR.2\|IESILMSLPLTAR.3\|IESI... [More]
SEN / CTL	P62857		40S ribosomal protein S28		RPS28		-0.33		0.59		0.0626		0.0243		ribosomal small subunit assembly,nuclear-transcrib... [More]		RNA binding,structural constituent of ribosome,pol... [More]		nucleoplasm,cytoplasm,cytosol,small ribosomal subu... [More]		21	8	13	EGDVLTLLESEREAR.3\|NVKGPVREGDVLTLLESER.3\|GPVREGDVLT... [More]
SEN / CTL	Q04760		Lactoylglutathione lyase		GLO1		-0.34		0.25		0.0000223		0.0000259		carbohydrate metabolic process,pyruvate metabolic ... [More]		lactoylglutathione lyase activity,zinc ion binding		cytoplasm,cytosol,extracellular exosome		18	16	31	GFGHIGIAVPDVYSAC[CAM]KR.4\|GFGHIGIAVPDVYSAC[CAM]KR.... [More]
SEN / CTL	Q9UKK9		ADP-sugar pyrophosphatase		NUDT5		-0.34		0.39		0.00612		0.00358		chromatin remodeling,nucleotide metabolic process,... [More]		magnesium ion binding,protein binding,nucleotidylt... [More]		intracellular,nucleus,cytosol,extracellular exosom... [More]		21	17	27	VYSYALALK.2\|TLHYEC[CAM]IVLVK.3\|TLHYEC[CAM]IVLVK.2\|... [More]
SEN / CTL	Q9BVG4		Protein PBDC1		PBDC1		-0.35		0.14		0.00019		0.00018		biological_process		molecular_function		cellular_component		9	12	17	IQFFAIEIAR.2\|LISSVDPQFLK.2\|FNGIVEDFNYGTLLR.2\|AMQHA... [More]
SEN / CTL	P49327		Fatty acid synthase		FASN		-0.35		0.88		0.00057		0.000467		osteoblast differentiation,acetyl-CoA metabolic pr... [More]		fatty acid synthase activity,[acyl-carrier-protein... [More]		cytoplasm,mitochondrion,Golgi apparatus,cytosol,pl... [More]		57	162	312	TGTVSLEVR.2\|SEGVVAVLLTK.2\|FC[CAM]FTPHTEEGC[CAM]LSE... [More]
SEN / CTL	Q99873		Protein arginine N-methyltransferase 1		PRMT1		-0.35		0.32		0.0016		0.00114		regulation of transcription, DNA-templated,protein... [More]		protein binding,methyltransferase activity,N-methy... [More]		nucleus,nucleoplasm,cytoplasm,cytosol,methylosome		15	32	48	DKWLAPDGLIFPDR.3\|DKWLAPDGLIFPDR.2\|KVIGIEC[CAM]SSIS... [More]
SEN / CTL	P49721		Proteasome subunit beta type-2		PSMB2		-0.35		0.92		0.0154		0.00758		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		18	21	33	FILNLPTFSVR.2\|IIDKNGIHDLDNISFPK.4\|NGYELSPTAAANFTR.... [More]
SEN / CTL	Q14696		LDLR chaperone MESD		MESDC2		-0.35		0.27		0.0191		0.00904		protein folding,mesoderm development,Wnt signaling... [More]		molecular_function,low-density lipoprotein particl... [More]		cellular_component,endoplasmic reticulum,plasma me... [More]		6	15	22	DGSYAWEIKDFLVGQDR.3\|DGSYAWEIKDFLVGQDR.2\|IDPSKPESIL... [More]
SEN / CTL	O15240		Neurosecretory protein VGF		VGF		-0.35		0.26		0.133		0.0446		ovarian follicle development,response to dietary e... [More]		molecular_function,hormone activity,neuropeptide h... [More]		extracellular space,transport vesicle,cytoplasmic ... [More]		3	10	11	LADLASDLLLQYLLQGGAR.3\|LADLASDLLLQYLLQGGAR.2\|RAQEEA... [More]
SEN / CTL	Q9UBG0		C-type mannose receptor 2		MRC2		-0.36		0.33		0.0204		0.00956		osteoblast differentiation,endocytosis,signal tran... [More]		transmembrane signaling receptor activity,protein ... [More]		integral component of plasma membrane,focal adhesi... [More]		12	30	39	TLGDQLSLLLGAR.2\|DC[CAM]SIALPYVC[CAM]K.2\|GAWLGMNFNP... [More]
SEN / CTL	Q9NQP4		Prefoldin subunit 4		PFDN4		-0.36		0.5		0.0727		0.0274		protein folding		protein binding,unfolded protein binding,chaperone... [More]		nucleus,cytoplasm,mitochondrion,cytosol,prefoldin ... [More]		9	7	10	ITELKEEIEVK.3\|ITELKEEIEVK.2\|NLQEEIDALESR.2\|NLQEEID... [More]
SEN / CTL	O00391		Sulfhydryl oxidase 1		QSOX1		-0.36		0.79		0.1		0.0358		platelet degranulation,negative regulation of macr... [More]		protein disulfide isomerase activity,flavin-linked... [More]		extracellular region,extracellular space,Golgi app... [More]		51	23	29	DFNIPGFPTVR.2\|VGSPNAAVLWLWSSHNR.3\|SFYTAYLQR.2\|NNEE... [More]
SEN / CTL	P09211		Glutathione S-transferase P		GSTP1		-0.37		0.63		0.000541		0.000445		response to reactive oxygen species,negative regul... [More]		glutathione transferase activity,glutathione perox... [More]		extracellular space,intracellular,nucleus,cytoplas... [More]		48	20	44	ALPGQLKPFETLLSQNQGGK.3\|ALPGQLKPFETLLSQNQGGK.2\|ALPG... [More]
SEN / CTL	O43854		EGF-like repeat and discoidin I-like domain-containing protein 3		EDIL3		-0.38		0.46		0.00476		0.00286		cell adhesion,multicellular organism development,p... [More]		integrin binding,calcium ion binding		extracellular matrix,extracellular exosome,extrace... [More]		15	11	13	SGHIQDYQITASSIFR.3\|SGHIQDYQITASSIFR.2\|GNIDNNTPYANS... [More]
SEN / CTL	P62258		14-3-3 protein epsilon		YWHAE		-0.38		1.2		0.00699		0.00398		G2/M transition of mitotic cell cycle,neuron migra... [More]		protein binding,potassium channel regulator activi... [More]		mitochondrion,cytosol,kinesin complex,cell-cell ad... [More]		90	36	102	LIC[CAM]C[CAM]DILDVLDKHLIPAANTGESK.4\|LIC[CAM]C[CAM... [More]
SEN / CTL	P15374		Ubiquitin carboxyl-terminal hydrolase isozyme L3		UCHL3		-0.38		0.36		0.00704		0.004		ubiquitin-dependent protein catabolic process,prot... [More]		thiol-dependent ubiquitin-specific protease activi... [More]		nucleus,cytoplasm,extracellular exosome		12	15	26	FLEESVSMSPEER.2\|FLEESVSM[Oxi]SPEER.2\|SQGQDVTSSVYFM... [More]
SEN / CTL	P13667		Protein disulfide-isomerase A4		PDIA4		-0.38		1.14		0.00841		0.00465		protein folding,protein secretion,response to endo... [More]		protein disulfide isomerase activity,protein bindi... [More]		endoplasmic reticulum lumen,cell surface,melanosom... [More]		60	69	125	FDVSGYPTIK.2\|FDVSGYPTLK.2\|IANILKDKDPPIPVAK.4\|IANIL... [More]
SEN / CTL	Q9UHY7		Enolase-phosphatase E1		ENOPH1		-0.38		0.34		0.0136		0.00682		dephosphorylation,L-methionine biosynthetic proces... [More]		magnesium ion binding,acireductone synthase activi... [More]		nucleus,cytosol,extracellular exosome		9	11	14	LLFGHSTEGDILELVDGHFDTK.4\|LLFGHSTEGDILELVDGHFDTK.3\|... [More]
SEN / CTL	O00584		Ribonuclease T2		RNASET2		-0.38		0.89		0.0223		0.0104		RNA catabolic process,RNA phosphodiester bond hydr... [More]		RNA binding,ribonuclease activity,ribonuclease T2 ... [More]		extracellular region,extracellular space,lysosome,... [More]		33	17	29	SWPFNLEEIKDLLPEMR.3\|ELDLNSVLLK.2\|LGIKPSINYYQVADFKD... [More]
SEN / CTL	P25788		Proteasome subunit alpha type-3		PSMA3		-0.38		1.23		0.033		0.0143		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity,protein bind... [More]		proteasome complex,nucleus,nucleoplasm,cytoplasm,c... [More]		24	15	25	AVENSSTAIGIR.2\|LFNVDRHVGMAVAGLLADAR.4\|VFQVEYAMK.2\|... [More]
SEN / CTL	Q92820		Gamma-glutamyl hydrolase		GGH		-0.39		0.21		1.34e-12		6.7e-12		proteolysis,glutamine metabolic process,response t... [More]		exopeptidase activity,omega peptidase activity,gam... [More]		extracellular space,nucleus,lysosome,vacuole,cytos... [More]		30	19	26	YYIAASYVK.2\|SINGILFPGGSVDLRR.3\|VVPVRLDLTEKDYEILFK.... [More]
SEN / CTL	P07942		Laminin subunit beta-1		LAMB1		-0.39		0.48		1.47e-12		7.23e-12		cell adhesion,neuronal-glial interaction involved ... [More]		structural molecule activity,extracellular matrix ... [More]		extracellular region,basement membrane,laminin-1 c... [More]		84	76	100	YSDIEPSTEGEVIFR.2\|YSDIEPSTEGEVIFR.3\|ISGVIGPYRETVDS... [More]
SEN / CTL	P06748		Nucleophosmin		NPM1		-0.39		0.23		4.35e-11		1.68e-10		DNA repair,nucleosome assembly,intracellular prote... [More]		DNA binding,transcription coactivator activity,RNA... [More]		nucleus,nucleoplasm,nucleolus,cytoplasm,centrosome... [More]		30	26	61	MSVQPTVSLGGFEITPPVVLR.3\|MSVQPTVSLGGFEITPPVVLR.2\|M[... [More]
SEN / CTL	P00491		Purine nucleoside phosphorylase		PNP		-0.39		0.39		1.81e-8		4.4e-8		nucleobase-containing compound metabolic process,i... [More]		nucleoside binding,purine nucleobase binding,purin... [More]		intracellular,nucleus,cytoplasm,cytosol,cytoskelet... [More]		48	26	53	VFGFSLITNK.2\|HRPQVAIIC[CAM]GSGLGGLTDKLTQAQIFDYGEIP... [More]
SEN / CTL	Q6YP21		Kynurenine--oxoglutarate transaminase 3		CCBL2		-0.39		0.25		0.0121		0.00624		2-oxoglutarate metabolic process,cellular amino ac... [More]		kynurenine-oxoglutarate transaminase activity,pyri... [More]		mitochondrion		6	19	24	IAAIDSLNQYTR.2\|MAGATPVFIPLR.2\|M[Oxi]AGATPVFIPLR.2\|... [More]
SEN / CTL	P37837		Transaldolase		TALDO1		-0.39		0.89		0.013		0.0066		carbohydrate metabolic process,xylulose biosynthet... [More]		sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosp... [More]		nucleus,cytoplasm,cytosol,extracellular exosome		30	31	43	LLGELLQDNAK.2\|LLGELLQDNAK.3\|LIELYKEAGISKDR.4\|NAIDK... [More]
SEN / CTL	P10155		60 kDa SS-A/Ro ribonucleoprotein		TROVE2		-0.39		0.66		0.0168		0.00818		immune system development,transcription from RNA p... [More]		RNA binding,U2 snRNA binding,metal ion binding		nucleus,cytoplasm,intracellular ribonucleoprotein ... [More]		24	27	39	LGLENAEALIR.2\|ALLQEMPLTALLR.2\|ALLQEMPLTALLR.3\|ALLQ... [More]
SEN / CTL	P11047		Laminin subunit gamma-1		LAMC1		-0.4		0.39		2.94e-12		1.39e-11		protein complex assembly,cell adhesion,endoderm de... [More]		extracellular matrix structural constituent		extracellular region,basement membrane,laminin-1 c... [More]		72	77	97	LSAEDLVLEGAGLR.2\|LSAEDLVLEGAGLR.3\|SQEC[CAM]YFDPELY... [More]
SEN / CTL	Q9BRA2		Thioredoxin domain-containing protein 17		TXNDC17		-0.4		0.3		0.00000664		0.00000898		tumor necrosis factor-mediated signaling pathway,o... [More]		peroxidase activity,protein binding,protein-disulf... [More]		cytosol,extracellular exosome		21	11	18	TIFAYFTGSK.2\|SWC[CAM]PDC[CAM]VQAEPVVR.2\|SWC[CAM]PD... [More]
SEN / CTL	Q12907		Vesicular integral-membrane protein VIP36		LMAN2		-0.4		0.36		0.0125		0.00641		ER to Golgi vesicle-mediated transport,retrograde ... [More]		glycoprotein binding,mannose binding,carbohydrate ... [More]		Golgi membrane,extracellular space,endoplasmic ret... [More]		9	21	31	WTELAGC[CAM]TADFR.2\|NLHGDGIALWYTR.3\|NLHGDGIALWYTR.... [More]
SEN / CTL	Q9NWV4		UPF0587 protein C1orf123		C1orf123		-0.4		0.09		0.0126		0.00644		biological_process		molecular_function		extracellular exosome		3	8	11	ATLENITNLRPVGEDFR.3\|ATLENITNLRPVGEDFR.4\|ATLENITNLR... [More]
SEN / CTL	Q9BWS9		Chitinase domain-containing protein 1		CHID1		-0.41		0.07		0.0109		0.00572		carbohydrate metabolic process,chitin catabolic pr... [More]		chitinase activity,protein binding,chitin binding,... [More]		extracellular space,nucleus,lysosome,late endosome... [More]		3	18	27	FTQISPVWLQLK.2\|FTQISPVWLQLK.3\|GLVVTDLK.2\|SQFSDKPVQ... [More]
SEN / CTL	P04439 P13746		HLA class I histocompatibility antigen, A-3 alpha chain;HLA class I histocompatibility antigen, A-11 alpha chain		HLA-A		-0.41		0.65		0.0267		0.0121		;		;		;		39	10	16	WAAVVVPSGEEQR.2\|SWTAADMAAQITKR.3\|SWTAADMAAQITKR.2\|... [More]
SEN / CTL	Q86U42		Polyadenylate-binding protein 2		PABPN1		-0.41		0.21		0.0713		0.027		MAPK cascade,mRNA splicing, via spliceosome,termin... [More]		nucleotide binding,RNA binding,protein binding,pol... [More]		nucleus,nucleoplasm,cytoplasm,nuclear speck,intrac... [More]		3	10	15	TSLALDESLFR.2\|VREMEEEAEK.3\|VREM[Oxi]EEEAEK.3\|VTILC... [More]
SEN / CTL	Q16881		Thioredoxin reductase 1, cytoplasmic		TXNRD1		-0.42		0.27		1.06e-16		7.99e-16		response to reactive oxygen species,mesoderm forma... [More]		thioredoxin-disulfide reductase activity,electron ... [More]		nucleus,mitochondrion,cytosol,extracellular exosom... [More]		48	37	60	QFVPIKVEQIEAGTPGR.3\|VVAQSTNSEEIIEGEYNTVMLAIGR.3\|KV... [More]
SEN / CTL	P63220		40S ribosomal protein S21		RPS21		-0.42		0.23		0.000153		0.000148		nuclear-transcribed mRNA catabolic process, nonsen... [More]		structural constituent of ribosome,poly(A) RNA bin... [More]		nucleoplasm,cytoplasm,cytosol,small ribosomal subu... [More]		9	7	18	TYAIC[CAM]GAIR.2\|DHASIQMNVAEVDKVTGR.4\|DHASIQMNVAEV... [More]
SEN / CTL	Q15631		Translin		TSN		-0.42		0.37		0.000169		0.000161		DNA recombination,RNA metabolic process,gene silen... [More]		DNA binding,single-stranded DNA binding,mRNA bindi... [More]		nucleus,cytosol		15	16	25	KVEEVVYDLSIR.3\|KVEEVVYDLSIR.2\|EAVTEILGIEPDREK.3\|LS... [More]
SEN / CTL	Q16363		Laminin subunit alpha-4		LAMA4		-0.42		0.46		0.00411		0.00253		cell adhesion,regulation of cell adhesion,extracel... [More]		receptor binding,extracellular matrix structural c... [More]		extracellular region,basement membrane,basal lamin... [More]		12	42	51	SLLSDVEELVEKENQASR.3\|C[CAM]LDGYIGDSIR.2\|ELVDEEADEA... [More]
SEN / CTL	Q8IZ83		Aldehyde dehydrogenase family 16 member A1		ALDH16A1		-0.42		0.08		0.00705		0.004		oxidation-reduction process		aminobutyraldehyde dehydrogenase activity,4-trimet... [More]		membrane,extracellular exosome		3	23	29	AALLWALAAALER.2\|LAEVIQK.2\|LLWTLESLVTGR.3\|LLWTLESLV... [More]
SEN / CTL	Q8N1N4		Keratin, type II cytoskeletal 78		KRT78		-0.42		0.15		0.0339		0.0145				structural molecule activity		extracellular space,keratin filament,extracellular... [More]		3	13	14	TLNNQFASFIDKVR.3\|VQISQLHQEIQR.3\|VQISQLHQEIQR.2\|TQE... [More]
SEN / CTL	P10586		Receptor-type tyrosine-protein phosphatase F		PTPRF		-0.43		0.26		1.63e-15		1.08e-14		cell adhesion,transmembrane receptor protein tyros... [More]		protein tyrosine phosphatase activity,transmembran... [More]		plasma membrane,integral component of plasma membr... [More]		45	55	65	NVLELSNVVR.2\|IISYTVVFR.2\|WFYIVVVPIDR.2\|SDMGVGVFTPT... [More]
SEN / CTL	P28066		Proteasome subunit alpha type-5		PSMA5		-0.43		0.33		0.000014		0.0000173		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity,protein bind... [More]		proteasome complex,nucleus,nucleoplasm,cytoplasm,c... [More]		21	17	34	LFQVEYAIEAIK.2\|LFQVEYAIEAIK.3\|SEYDRGVNTFSPEGR.3\|AI... [More]
SEN / CTL	P22352		Glutathione peroxidase 3		GPX3		-0.43		0.18		0.00041		0.000349		response to reactive oxygen species,response to li... [More]		glutathione peroxidase activity,transcription fact... [More]		extracellular region,extracellular space,extracell... [More]		6	7	10	MDILSYMR.2\|FLVGPDGIPIMR.2\|FLVGPDGIPIM[Oxi]R.2\|LFWE... [More]
SEN / CTL	Q16836		Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial		HADH		-0.43		0.43		0.00265		0.00175		fatty acid beta-oxidation,response to activity,res... [More]		3-hydroxyacyl-CoA dehydrogenase activity,NAD+ bind... [More]		nucleoplasm,cytoplasm,mitochondrion,mitochondrial ... [More]		12	22	45	TFESLVDFSK.2\|TLSTIATSTDAASVVHSTDLVVEAIVENLK.4\|TLST... [More]
SEN / CTL	P07686		Beta-hexosaminidase subunit beta		HEXB		-0.43		0.31		0.0129		0.0066		skeletal system development,glycosphingolipid meta... [More]		beta-N-acetylhexosaminidase activity,acetylglucosa... [More]		acrosomal vesicle,extracellular space,membrane,azu... [More]		9	27	38	VLDIIATINK.2\|LAPGTIVEVWKDSAYPEELSR.3\|LAPGTIVEVWKDS... [More]
SEN / CTL	Q9Y646		Carboxypeptidase Q		CPQ		-0.43		0.54		0.0373		0.0156		proteolysis,thyroid hormone generation,tissue rege... [More]		carboxypeptidase activity,protein homodimerization... [More]		extracellular space,cytoplasm,lysosome,endoplasmic... [More]		6	10	10	LALLVDTVGPR.2\|AIINLAVYGK.2\|VHLEPVRIPHWER.4\|VGALASL... [More]
SEN / CTL	P19338		Nucleolin		NCL		-0.44		0.66		7.97e-12		3.36e-11		angiogenesis,positive regulation of transcription ... [More]		nucleotide binding,RNA binding,protein binding,pro... [More]		nucleus,nucleoplasm,nucleolus,cell cortex,membrane... [More]		60	63	97	NDLAVVDVR.2\|GFGFVDFNSEEDAK.2\|EVFEDAAEIR.2\|NLPYKVTQ... [More]
SEN / CTL	P48637		Glutathione synthetase		GSS		-0.44		0.42		3.09e-7		5.84e-7		cellular amino acid metabolic process,glutathione ... [More]		magnesium ion binding,glutathione synthase activit... [More]		cytosol,extracellular exosome		30	27	39	AWELYGSPNALVLLIAQEKER.3\|ALAEGVLLR.2\|EGIAQTVFLGLNR.... [More]
SEN / CTL	P28065		Proteasome subunit beta type-9		PSMB9		-0.44		0.33		0.00113		0.000838		MAPK cascade,protein polyubiquitination,stimulator... [More]		threonine-type endopeptidase activity		proteasome complex,nucleoplasm,cytoplasm,cytosol,p... [More]		12	8	12	FTTDAIALAMSR.2\|FTTDAIALAMSR.3\|EGGQVYGTLGGMLTR.2\|VI... [More]
SEN / CTL	P30086		Phosphatidylethanolamine-binding protein 1		PEBP1		-0.45		0.78		0.00386		0.00242		MAPK cascade,negative regulation of endopeptidase ... [More]		serine-type endopeptidase inhibitor activity,prote... [More]		nucleus,cytosol,extracellular exosome		57	25	48	YVWLVYEQDRPLKC[CAM]DEPILSNR.4\|YVWLVYEQDRPLKC[CAM]D... [More]
SEN / CTL	P62310		U6 snRNA-associated Sm-like protein LSm3		LSM3		-0.45		0.38		0.00605		0.00355		mRNA splicing, via spliceosome,mRNA processing,cyt... [More]		RNA binding,protein binding,poly(A) RNA binding		cytoplasmic mRNA processing body,nucleus,nucleopla... [More]		9	4	4	GDGVVLVAPPLRVG.2\|NIPMLFVR.2\|GDGVVLVAPPLR.2\|RNIPMLF... [More]
SEN / CTL	Q9H299		SH3 domain-binding glutamic acid-rich-like protein 3		SH3BGRL3		-0.45		1.47		0.116		0.0401		regulation of actin filament depolymerization,regu... [More]		GTPase activator activity,electron carrier activit... [More]		nucleus,cytoplasm,lamellipodium,extracellular exos... [More]		12	7	15	ATPPQIVNGDQYC[CAM]GDYELFVEAVEQNTLQEFLK.4\|IQYQLVDIS... [More]
SEN / CTL	P17174		Aspartate aminotransferase, cytoplasmic		GOT1		-0.46		0.23		1.75e-10		6.2e-10		gluconeogenesis,2-oxoglutarate metabolic process,o... [More]		L-aspartate:2-oxoglutarate aminotransferase activi... [More]		nucleus,cytoplasm,lysosome,cytosol,axon terminus,e... [More]		30	36	57	VGGVQSLGGTGALR.2\|IGADFLAR.2\|TDDC[CAM]HPWVLPVVK.3\|T... [More]
SEN / CTL	Q9NZ08		Endoplasmic reticulum aminopeptidase 1		ERAP1		-0.46		0.29		1e-8		2.58e-8		angiogenesis,adaptive immune response,antigen proc... [More]		endopeptidase activity,aminopeptidase activity,int... [More]		extracellular region,extracellular space,endoplasm... [More]		24	41	61	GFPLITITVR.2\|ILASTQFEPTAAR.2\|TKTDVLILPEEVEWIK.3\|TK... [More]
SEN / CTL	Q9BWD1		Acetyl-CoA acetyltransferase, cytosolic		ACAT2		-0.46		0.2		2.49e-8		5.86e-8		lipid metabolic process,fatty acid beta-oxidation		acetyl-CoA C-acetyltransferase activity		nucleus,nucleolus,cytoplasm,mitochondrion,extracel... [More]		18	22	41	ILVTLLHTLER.3\|ILVTLLHTLER.2\|AGHFDKEIVPVLVSTR.4\|AGH... [More]
SEN / CTL	Q02818		Nucleobindin-1		NUCB1		-0.46		0.99		0.00000375		0.00000545		response to cisplatin,regulation of protein target... [More]		G-protein alpha-subunit binding,DNA binding,calciu... [More]		extracellular space,nucleus,early endosome,rough e... [More]		63	33	46	DLELLIQTATR.2\|LLERLPEVEVPQHL.3\|LPEVEVPQHL.2\|ELQQAV... [More]
SEN / CTL	P40925		Malate dehydrogenase, cytoplasmic		MDH1		-0.46		0.39		0.00000443		0.00000623		gluconeogenesis,tricarboxylic acid cycle,oxaloacet... [More]		malic enzyme activity,L-malate dehydrogenase activ... [More]		extracellular space,cytoplasm,mitochondrion,centro... [More]		33	23	39	FVEGLPINDFSR.2\|VIVVGNPANTNC[CAM]LTASK.2\|VIVVGNPANT... [More]
SEN / CTL	P45877		Peptidyl-prolyl cis-trans isomerase C		PPIC		-0.46		0.26		0.00292		0.0019		protein peptidyl-prolyl isomerization,protein fold... [More]		peptidyl-prolyl cis-trans isomerase activity,prote... [More]		cytoplasm,extracellular exosome		6	3	3	TPFVVEIADW.2\|IVIGLFGK.2\|TVENFVALATGEK.2
SEN / CTL	Q6UVY6		DBH-like monooxygenase protein 1		MOXD1		-0.46		0.05		0.00312		0.00202		oxidation-reduction process		copper ion binding,protein binding,oxidoreductase ... [More]		endoplasmic reticulum membrane,integral component ... [More]		3	2	2	LVLSLPVNVR.2\|ELHTC[CAM]DINDK.2
SEN / CTL	P67936		Tropomyosin alpha-4 chain		TPM4		-0.46		1.24		0.00439		0.00267		osteoblast differentiation,movement of cell or sub... [More]		actin binding,calcium ion binding,protein binding,... [More]		stress fiber,podosome,cytosol,cytoskeleton,muscle ... [More]		99	36	62	IQLVEEELDRAQER.3\|IQLVEEELDRAQER.2\|RIQLVEEELDRAQER.... [More]
SEN / CTL	Q13740		CD166 antigen		ALCAM		-0.47		0.48		1.63e-10		5.93e-10		adaptive immune response,cell adhesion,heterophili... [More]		receptor binding,protein binding		immunological synapse,integral component of plasma... [More]		51	30	45	ALFLETEQLK.2\|ESLTLIVEGKPQIK.3\|ESLTLIVEGKPQIK.2\|WKY... [More]
SEN / CTL	P35052		Glypican-1		GPC1		-0.47		0.36		0.0000317		0.0000352		retinoid metabolic process,glycosaminoglycan biosy... [More]		copper ion binding,fibroblast growth factor bindin... [More]		proteinaceous extracellular matrix,extracellular s... [More]		21	13	13	VLQAMLATQLR.2\|SFVQGLGVASDVVR.2\|GFSLSDVPQAEISGEHLR.... [More]
SEN / CTL	P61086		Ubiquitin-conjugating enzyme E2 K		UBE2K		-0.47		0.49		0.126		0.0429		ubiquitin-dependent protein catabolic process,posi... [More]		ubiquitin-protein transferase activity,protein bin... [More]		nucleus,cytoplasm,filopodium tip,extracellular exo... [More]		6	16	27	LWAHVYAGAPVSSPEYTK.3\|LWAHVYAGAPVSSPEYTK.4\|LWAHVYAG... [More]
SEN / CTL	P62158		Calmodulin		CALM1		-0.48		0.46		4.79e-8		1.05e-7		G2/M transition of mitotic cell cycle,MAPK cascade... [More]		Ras guanyl-nucleotide exchange factor activity,cal... [More]		spindle pole,extracellular region,nucleus,nucleopl... [More]		33	14	31	VFDKDGNGYISAAELR.3\|VFDKDGNGYISAAELR.2\|EAFSLFDKDGDG... [More]
SEN / CTL	O75347		Tubulin-specific chaperone A		TBCA		-0.48		1.08		0.0133		0.00674		protein folding,tubulin complex assembly,post-chap... [More]		poly(A) RNA binding,beta-tubulin binding,chaperone... [More]		nucleolus,cytoplasm,microtubule,microtubule cytosk... [More]		24	14	23	LVLDSVKLEA.2\|ILENEKDLEEAEEYKEAR.4\|ILENEKDLEEAEEYKE... [More]
SEN / CTL	Q15637		Splicing factor 1		SF1		-0.48		0.12		0.0157		0.00767		spliceosomal complex assembly,mRNA 3'-splice site ... [More]		transcription corepressor activity,RNA binding,pro... [More]		nucleus,nucleoplasm,spliceosomal complex,ribosome		3	20	37	VSDKVMIPQDEYPEINFVGLLIGPR.3\|C[CAM]GGAGHIASDC[CAM]K... [More]
SEN / CTL	Q16531		DNA damage-binding protein 1		DDB1		-0.49		0.45		1.45e-14		7.99e-14		nucleotide-excision repair, DNA damage recognition... [More]		DNA binding,protein binding,damaged DNA binding		nuclear chromosome, telomeric region,extracellular... [More]		87	71	100	IGRPSETGIIGIIDPEC[CAM]R.3\|LLASINSTVR.2\|QSGESIDIITR... [More]
SEN / CTL	P13798		Acylamino-acid-releasing enzyme		APEH		-0.49		0.37		2.5e-7		4.79e-7		translational termination,proteolysis,beta-amyloid... [More]		serine-type endopeptidase activity,omega peptidase... [More]		cytoplasm,cytosol,nuclear membrane,extracellular e... [More]		33	34	45	VTSVVVDVVPR.2\|QVLLSEPEEAAALYR.2\|QVLLSEPEEAAALYR.3\|... [More]
SEN / CTL	P12955		Xaa-Pro dipeptidase		PEPD		-0.49		0.45		0.0000146		0.0000178		proteolysis,cellular amino acid metabolic process,... [More]		aminopeptidase activity,metallocarboxypeptidase ac... [More]		extracellular exosome		24	27	41	VPLALFALNR.2\|YAVDDVQYVDEIASVLTSQKPSVLLTLR.3\|YAVDDV... [More]
SEN / CTL	O95777		U6 snRNA-associated Sm-like protein LSm8		LSM8		-0.49		0.19		0.034		0.0145		mRNA splicing, via spliceosome		RNA binding,protein binding,U6 snRNA binding,poly(... [More]		nucleoplasm,spliceosomal complex,U4/U6 x U5 tri-sn... [More]		3	4	6	GFDQTINLILDESHER.3\|GFDQTINLILDESHER.2\|TVAVITSDGR.2... [More]
SEN / CTL	Q15393		Splicing factor 3B subunit 3		SF3B3		-0.5		0.19		2.67e-8		6.21e-8		RNA splicing, via transesterification reactions,mR... [More]		RNA binding		nucleus,nucleoplasm,spliceosomal complex,U12-type ... [More]		15	61	96	FLAVGLVDNTVR.2\|TVLDPVTGDLSDTR.2\|TVLDPVTGDLSDTR.3\|M... [More]
SEN / CTL	Q9GZT8		NIF3-like protein 1		NIF3L1		-0.5		0.37		0.000213		0.000198		neuron differentiation,positive regulation of tran... [More]		protein binding,transcription factor binding,ident... [More]		nucleus,cytoplasm,mitochondrion		12	15	19	GIDGVSVTSFSAR.2\|ALMQVVDFLSR.2\|ALM[Oxi]QVVDFLSR.2\|V... [More]
SEN / CTL	P30481 P30483		HLA class I histocompatibility antigen, B-44 alpha chain;HLA class I histocompatibility antigen, B-45 alpha chain		HLA-B		-0.5		1.16		0.00919		0.00498		;		;		;		9	3	4	DGEDQTQDTELVETRPAGDR.3\|DGEDQTQDTELVETRPAGDR.4\|AYLE... [More]
SEN / CTL	P55145		Mesencephalic astrocyte-derived neurotrophic factor		MANF		-0.51		0.25		0.0000114		0.0000145		response to unfolded protein,biological_process,ne... [More]		growth factor activity,poly(A) RNA binding		extracellular space,nucleus,endoplasmic reticulum		12	16	22	FYQDLKDRDVTFSPATIENELIK.4\|IINEVSKPLAHHIPVEK.4\|IINE... [More]
SEN / CTL	P22626		Heterogeneous nuclear ribonucleoproteins A2/B1		HNRNPA2B1		-0.51		1.1		0.0000242		0.0000281		negative regulation of transcription from RNA poly... [More]		nucleotide binding,RNA binding,mRNA 3'-UTR binding... [More]		nucleus,nucleoplasm,spliceosomal complex,cytoplasm... [More]		60	47	96	IDTIEIITDR.2\|LFIGGLSFETTEESLR.3\|LFIGGLSFETTEESLR.2... [More]
SEN / CTL	Q9BYZ2		L-lactate dehydrogenase A-like 6B		LDHAL6B		-0.51		0.3		0.00467		0.00282		carbohydrate metabolic process,pyruvate metabolic ... [More]		L-lactate dehydrogenase activity		nucleus,mitochondrial matrix		6	1	2	LIIVSNPVDILTYVAWK.3\|LIIVSNPVDILTYVAWK.2
SEN / CTL	P16070		CD44 antigen		CD44		-0.51		0.46		0.00762		0.00427		cell-matrix adhesion,single organismal cell-cell a... [More]		collagen binding,hyaluronic acid binding,cytokine ... [More]		cytoplasm,Golgi apparatus,plasma membrane,integral... [More]		12	12	18	YGFIEGHVVIPR.3\|YGFIEGHVVIPR.2\|ALSIGFETC[CAM]R.2\|SQ... [More]
SEN / CTL	P06865		Beta-hexosaminidase subunit alpha		HEXA		-0.52		0.37		0.00000154		0.00000247		carbohydrate metabolic process,glycosaminoglycan b... [More]		beta-N-acetylhexosaminidase activity,acetylglucosa... [More]		membrane,azurophil granule,lysosomal lumen,extrace... [More]		24	21	32	ALLSAPWYLNR.2\|GLETFSQLVWK.2\|SNPEIQDFMR.2\|LTSDLTFAY... [More]
SEN / CTL	P80723		Brain acid soluble protein 1		BASP1		-0.52		0.72		0.049		0.0197		thorax and anterior abdomen determination,gonad de... [More]		transcription corepressor activity,protein binding... [More]		nucleus,cytoplasm,cytoskeleton,plasma membrane,nuc... [More]		9	28	41	AQGPAASAEEPKPVEAPAANSDQTVTVKE.3\|AQGPAASAEEPKPVEAPA... [More]
SEN / CTL	P00390		Glutathione reductase, mitochondrial		GSR		-0.53		0.86		0.0503		0.0201		response to reactive oxygen species,glutathione me... [More]		glutathione-disulfide reductase activity,electron ... [More]		mitochondrial matrix,cytosol,external side of plas... [More]		33	32	54	GIYAVGDVC[CAM]GK.2\|ALLTPVAIAAGR.2\|GHAAFTSDPKPTIEVS... [More]
SEN / CTL	P54727		UV excision repair protein RAD23 homolog B		RAD23B		-0.54		0.32		2.45e-7		4.72e-7		nucleotide-excision repair, DNA damage recognition... [More]		damaged DNA binding,single-stranded DNA binding,pr... [More]		proteasome complex,nucleus,nucleoplasm,cytoplasm,X... [More]		21	20	33	NFVVVMVTKPK.2\|NFVVVMVTKPK.3\|ILNDDTALKEYKIDEK.4\|ILN... [More]
SEN / CTL	P00492		Hypoxanthine-guanine phosphoribosyltransferase		HPRT1		-0.54		0.52		0.0000751		0.0000768		response to amphetamine,purine nucleotide biosynth... [More]		nucleotide binding,magnesium ion binding,hypoxanth... [More]		cytoplasm,cytosol,extracellular exosome		21	17	27	SIPMTVDFIR.2\|NVLIVEDIIDTGK.2\|TMQTLLSLVR.2\|TM[Oxi]Q... [More]
SEN / CTL	P98066		Tumor necrosis factor-inducible gene 6 protein		TNFAIP6		-0.54		0.15		0.0274		0.0123		inflammatory response,cell adhesion,signal transdu... [More]		protein binding,hyaluronic acid binding		extracellular space		3	1	1	FLSDASVTAGGFQIK.2
SEN / CTL	P06132		Uroporphyrinogen decarboxylase		UROD		-0.55		0.52		0.00116		0.000858		protoporphyrinogen IX biosynthetic process,heme bi... [More]		uroporphyrinogen decarboxylase activity		nucleoplasm,cytoplasm,cytosol		12	12	18	LRDPEVVASELGYVFQAITLTR.3\|LRDPEVVASELGYVFQAITLTR.4\|... [More]
SEN / CTL	O43505		Beta-1,4-glucuronyltransferase 1		B4GAT1		-0.55		0.29		0.00393		0.00244		axon guidance,keratan sulfate biosynthetic process... [More]		N-acetyllactosaminide beta-1,3-N-acetylglucosaminy... [More]		Golgi membrane,Golgi apparatus,integral component ... [More]		6	5	5	TALASGGVLDASGDYR.2\|TTMDPNDVILATHASVDNLLHLSGLLER.4\|... [More]
SEN / CTL	P07954		Fumarate hydratase, mitochondrial		FH		-0.55		0.71		0.0054		0.00321		tricarboxylic acid cycle,fumarate metabolic proces... [More]		fumarate hydratase activity		cytoplasm,mitochondrion,mitochondrial matrix,cytos... [More]		18	30	61	IYELAAGGTAVGTGLNTR.2\|IYELAAGGTAVGTGLNTR.3\|THTQDAVP... [More]
SEN / CTL	P51858		Hepatoma-derived growth factor		HDGF		-0.56		0.36		8.89e-9		2.31e-8		negative regulation of transcription from RNA poly... [More]		nucleotide binding,RNA polymerase II transcription... [More]		extracellular space,nucleoplasm,cytoplasm,transcri... [More]		21	29	48	KGFSEGLWEIENNPTVK.3\|KGFSEGLWEIENNPTVK.2\|GPPQEEEEEE... [More]
SEN / CTL	O14907		Tax1-binding protein 3		TAX1BP3		-0.56		0.19		0.0205		0.00959		Rho protein signal transduction,negative regulatio... [More]		protein binding,beta-catenin binding,protein C-ter... [More]		nucleus,cytoplasm,cytosol,plasma membrane,extracel... [More]		3	4	5	VSEGGPAEIAGLQIGDK.2\|VSEGGPAEIAGLQIGDK.3\|AVQQSMLS.2... [More]
SEN / CTL	Q15424		Scaffold attachment factor B1		SAFB		-0.56		0.54		0.0448		0.0183		chromatin organization,transcription, DNA-template... [More]		nucleotide binding,core promoter binding,chromatin... [More]		nucleus,nucleoplasm		6	36	54	AIEDEGGNPDEIEITSEGNKK.3\|AIEDEGGNPDEIEITSEGNKK.4\|AI... [More]
SEN / CTL	P13497		Bone morphogenetic protein 1		BMP1		-0.56		0.25		0.0591		0.0231		skeletal system development,cartilage condensation... [More]		metalloendopeptidase activity,serine-type endopept... [More]		extracellular region,proteinaceous extracellular m... [More]		3	2	2	AGFAVNFFK.2\|NC[CAM]IWQLVAPTQYR.2
SEN / CTL	P05067		Amyloid beta A4 protein		APP		-0.58		0.44		1.25e-9		3.71e-9		response to yeast,suckling behavior,platelet degra... [More]		DNA binding,serine-type endopeptidase inhibitor ac... [More]		extracellular region,extracellular space,nuclear e... [More]		36	21	26	LALENYITALQAVPPRPR.3\|WYFDVTEGK.2\|ISYGNDALMPSLTETK.... [More]
SEN / CTL	P00736		Complement C1r subcomponent		C1R		-0.58		0.34		7.26e-9		1.92e-8		proteolysis,immune response,complement activation,... [More]		serine-type endopeptidase activity,calcium ion bin... [More]		extracellular region,extracellular exosome,blood m... [More]		27	25	35	M[Oxi]GNFPWQVFTNIHGR.3\|MGNFPWQVFTNIHGR.3\|LPVANPQAC... [More]
SEN / CTL	Q8NBS9		Thioredoxin domain-containing protein 5		TXNDC5		-0.58		0.79		0.0000669		0.00007		protein folding,response to endoplasmic reticulum ... [More]		protein disulfide isomerase activity		endoplasmic reticulum,endoplasmic reticulum lumen,... [More]		33	30	49	GYPTLLLFR.2\|GYPTLLWFR.2\|FVLSQAKDEL.2\|IGKVDC[CAM]TQ... [More]
SEN / CTL	Q99729		Heterogeneous nuclear ribonucleoprotein A/B		HNRNPAB		-0.58		0.4		0.000905		0.000702		epithelial to mesenchymal transition,positive regu... [More]		nucleotide binding,RNA binding,mRNA binding,protei... [More]		nucleus,nucleoplasm,cytoplasm,intracellular ribonu... [More]		9	14	26	GFGFILFK.2\|MFVGGLSWDTSKK.3\|M[Oxi]FVGGLSWDTSKK.3\|M[... [More]
SEN / CTL	P35908		Keratin, type II cytoskeletal 2 epidermal		KRT2		-0.58		0.94		0.00103		0.000779		keratinocyte development,epidermis development,ker... [More]		structural constituent of cytoskeleton,protein bin... [More]		extracellular space,nucleus,cytoplasm,Golgi appara... [More]		54	56	105	YEELQVTVGR.2\|FLEQQNQVLQTK.2\|FLEQQNQVLQTK.3\|VDLLNQE... [More]
SEN / CTL	Q71DI3		Histone H3.2		HIST2H3A		-0.58		0.35		0.017		0.00825		negative regulation of transcription from RNA poly... [More]		protein binding,nucleosomal DNA binding,histone bi... [More]		nucleosome,extracellular region,nucleus,nucleoplas... [More]		6	1	4	FQSSAVMALQEASEAYLVGLFEDTNLC[CAM]AIHAK.4\|FQSSAVM[Ox... [More]
SEN / CTL	Q9GZM7		Tubulointerstitial nephritis antigen-like		TINAGL1		-0.59		0.41		0.00000325		0.0000048		receptor-mediated endocytosis,immune response,cell... [More]		scavenger receptor activity,extracellular matrix s... [More]		extracellular region,extracellular space,extracell... [More]		21	21	33	ITGWGEETLPDGR.2\|LDGAWWFLR.2\|QATAHC[CAM]PNSYVNNNDIY... [More]
SEN / CTL	P06744		Glucose-6-phosphate isomerase		GPI		-0.63		0.6		7.28e-20		8.55e-19		angiogenesis,in utero embryonic development,mesode... [More]		glucose-6-phosphate isomerase activity,cytokine ac... [More]		extracellular space,nucleoplasm,cytoplasm,cytosol,... [More]		141	49	107	TLAQLNPESSLFIIASK.2\|TLAQLNPESSLFIIASK.3\|VKEFGIDPQN... [More]
SEN / CTL	Q06481		Amyloid-like protein 2		APLP2		-0.63		0.34		2.46e-9		7.08e-9		platelet degranulation,G-protein coupled receptor ... [More]		DNA binding,serine-type endopeptidase inhibitor ac... [More]		nucleus,plasma membrane,membrane,integral componen... [More]		24	16	20	C[CAM]LVGEFVSDVLLVPEK.3\|C[CAM]LVGEFVSDVLLVPEK.2\|VP... [More]
SEN / CTL	P09493		Tropomyosin alpha-1 chain		TPM1		-0.64		1.39		0.029		0.0128		in utero embryonic development,positive regulation... [More]		actin binding,structural constituent of cytoskelet... [More]		stress fiber,cytosol,cytoskeleton,muscle thin fila... [More]		60	27	42	AQKDEEKMEIQEIQLK.4\|AQKDEEKMEIQEIQLK.3\|SKQLEDELVSLQ... [More]
SEN / CTL	O75144		ICOS ligand		ICOSLG		-0.64		0.27		0.0458		0.0186		adaptive immune response,defense response,hyperosm... [More]		receptor binding		plasma membrane,integral component of membrane,ext... [More]		3	1	1	GLYDVVSVLR.2
SEN / CTL	P07195		L-lactate dehydrogenase B chain		LDHB		-0.65		1.22		5.72e-8		1.22e-7		carbohydrate metabolic process,lactate metabolic p... [More]		L-lactate dehydrogenase activity,protein binding,k... [More]		cytoplasm,mitochondrion,cytosol,membrane,myelin sh... [More]		99	35	73	IVVVTAGVR.2\|SADTLWDIQKDLKDL.2\|SADTLWDIQKDLKDL.3\|FI... [More]
SEN / CTL	Q01130		Serine/arginine-rich splicing factor 2		SRSF2		-0.65		0.2		0.00000388		0.00000561		regulation of alternative mRNA splicing, via splic... [More]		nucleotide binding,transcription corepressor activ... [More]		nucleus,nucleoplasm,spliceosomal complex,nuclear s... [More]		9	7	13	FHDKRDAEDAMDAMDGAVLDGR.4\|VGDVYIPR.2\|DAEDAMDAMDGAVL... [More]
SEN / CTL	P00441		Superoxide dismutase [Cu-Zn]		SOD1		-0.66		0.61		0.0000181		0.0000217		activation of MAPK activity,response to reactive o... [More]		superoxide dismutase activity,copper ion binding,p... [More]		extracellular region,extracellular space,nucleus,n... [More]		30	20	39	LAC[CAM]GVIGIAQ.2\|HVGDLGNVTADKDGVADVSIEDSVISLSGDHC... [More]
SEN / CTL	P09341 P19875 P19876		Growth-regulated alpha protein;C-X-C motif chemokine 2;C-X-C motif chemokine 3		CXCL1 CXCL2 CXCL3		-0.66		0.28		0.0011		0.000827		chemotaxis,inflammatory response,immune response,s... [More]		receptor binding,chemokine activity,enzyme activat... [More]		extracellular region,extracellular space,intracell... [More]		6	1	2	SPGPHC[CAM]AQTEVIATLK.3\|SPGPHC[CAM]AQTEVIATLK.2
SEN / CTL	P28070		Proteasome subunit beta type-4		PSMB4		-0.66		0.59		0.0392		0.0162		MAPK cascade,protein polyubiquitination,stimulator... [More]		lipopolysaccharide binding,threonine-type endopept... [More]		proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More]		15	10	21	TQNPMVTGTSVLGVK.2\|TQNPMVTGTSVLGVK.3\|TQNPM[Oxi]VTGT... [More]
SEN / CTL	Q15582		Transforming growth factor-beta-induced protein ig-h3		TGFBI		-0.67		0.69		1.25e-17		9.89e-17		angiogenesis,chondrocyte differentiation,cell adhe... [More]		integrin binding,protein binding,collagen binding,... [More]		extracellular region,proteinaceous extracellular m... [More]		93	38	60	LTLLAPLNSVFKDGTPPIDAHTR.4\|LTLLAPLNSVFKDGTPPIDAHTR.... [More]
SEN / CTL	Q9P2B2		Prostaglandin F2 receptor negative regulator		PTGFRN		-0.68		0.41		1.96e-10		6.87e-10		lipid particle organization		protein binding		endoplasmic reticulum membrane,Golgi apparatus,pla... [More]		24	22	23	FTVSWYYR.2\|LDRDSLVHSSPHVALSHVDAR.5\|LDRDSLVHSSPHVAL... [More]
SEN / CTL	P27695		DNA-(apurinic or apyrimidinic site) lyase		APEX1		-0.69		0.64		0.00000673		0.00000904		telomere maintenance,DNA repair,base-excision repa... [More]		DNA binding,damaged DNA binding,double-stranded te... [More]		nuclear chromosome, telomeric region,nucleus,nucle... [More]		27	28	52	QGFGELLQAVPLADSFR.2\|QGFGELLQAVPLADSFR.3\|IC[CAM]SWN... [More]
SEN / CTL	P60033		CD81 antigen		CD81		-0.69		0.36		0.000016		0.0000193		activation of MAPK activity,cell surface receptor ... [More]		protein binding,MHC class II protein complex bindi... [More]		immunological synapse,plasma membrane,integral com... [More]		12	5	8	TFHETLDC[CAM]C[CAM]GSSTLTALTTSVLK.3\|TFHETLDC[CAM]C... [More]
SEN / CTL	P07108		Acyl-CoA-binding protein		DBI		-0.7		0.19		0.00000345		0.00000503		transport,phosphatidylcholine acyl-chain remodelin... [More]		lipid binding,benzodiazepine receptor binding,long... [More]		endoplasmic reticulum,Golgi apparatus,extracellula... [More]		9	8	18	TKPSDEEMLFIYGHYK.3\|TKPSDEEMLFIYGHYK.4\|TKPSDEEM[Oxi... [More]
SEN / CTL	P99999		Cytochrome c		CYCS		-0.71		0.36		0.0000636		0.0000673		response to reactive oxygen species,mitochondrial ... [More]		protein binding,heme binding,electron transporter,... [More]		protein phosphatase type 2A complex,nucleus,mitoch... [More]		9	13	27	ADLIAYLK.2\|ADLIAYLK.1\|MIFVGIK.2\|M[Oxi]IFVGIK.2\|MIF... [More]
SEN / CTL	P63165		Small ubiquitin-related modifier 1		SUMO1		-0.71		0.48		0.116		0.0402		DNA repair,double-strand break repair via nonhomol... [More]		protein binding,transcription factor binding,potas... [More]		heterochromatin,fibrillar center,XY body,nucleus,n... [More]		3	6	8	VIGQDSSEIHFK.3\|VIGQDSSEIHFK.2\|FLFEGQR.2\|IADNHTPK.2... [More]
SEN / CTL	P15291		Beta-1,4-galactosyltransferase 1		B4GALT1		-0.72		0.26		5.53e-9		1.52e-8		epithelial cell development,acute inflammatory res... [More]		beta-N-acetylglucosaminylglycopeptide beta-1,4-gal... [More]		Golgi trans cisterna,Golgi membrane,extracellular ... [More]		15	7	9	VAIIIPFR.2\|YWLYYLHPVLQR.3\|QQLDYGIYVINQAGDTIFNR.3\|E... [More]
SEN / CTL	O00560		Syntenin-1		SDCBP		-0.72		0.37		0.0000198		0.0000233		negative regulation of receptor internalization,pr... [More]		glycoprotein binding,frizzled binding,interleukin-... [More]		extracellular space,nucleus,cytoplasm,endoplasmic ... [More]		12	13	25	SLMDHTIPEV.2\|DSTGHVGFIFK.3\|DSTGHVGFIFK.2\|SIDNGIFVQ... [More]
SEN / CTL	Q16629		Serine/arginine-rich splicing factor 7		SRSF7		-0.72		0.38		0.00567		0.00335		mRNA splicing, via spliceosome,termination of RNA ... [More]		nucleotide binding,protein binding,zinc ion bindin... [More]		nucleus,nucleoplasm,cytoplasm,extracellular exosom... [More]		6	10	17	VYVGNLGTGAGKGELER.3\|VYVGNLGTGAGKGELER.2\|VRVELSTGMP... [More]
SEN / CTL	Q9NX55		Huntingtin-interacting protein K		HYPK		-0.72		0.4		0.0902		0.0329				protein binding		nucleoplasm,cytoplasm,microtubule cytoskeleton		3	11	15	SLREHMGNVVEALIALTN.3\|KHDSGAADLER.3\|KHDSGAADLER.2\|H... [More]
SEN / CTL	P07093		Glia-derived nexin		SERPINE2		-0.73		0.22		1.55e-15		1.04e-14		blood coagulation,negative regulation of cell prol... [More]		serine-type endopeptidase inhibitor activity,recep... [More]		extracellular region,extracellular space,cytosol,e... [More]		27	11	14	LVLVNAVYFK.2\|SYQVPMLAQLSVFR.2\|ASAATTAILIAR.2\|TIDSW... [More]
SEN / CTL	P01130		Low-density lipoprotein receptor		LDLR		-0.73		0.43		0.00722		0.00408		lipid metabolic process,endocytosis,receptor-media... [More]		virus receptor activity,glycoprotein binding,prote... [More]		lysosome,early endosome,late endosome,Golgi appara... [More]		6	18	20	NVVALDTEVASNR.2\|AVGSIAYLFFTNR.2\|AHGVSSYDTVISR.3\|AH... [More]
SEN / CTL	O14786		Neuropilin-1		NRP1		-0.74		0.31		2.94e-10		9.92e-10		angiogenesis,patterning of blood vessels,neuron mi... [More]		vascular endothelial growth factor-activated recep... [More]		semaphorin receptor complex,extracellular space,ea... [More]		21	12	14	FVTAVGTQGAISK.2\|IAPPPVVSSGPFLFIK.3\|IAPPPVVSSGPFLFI... [More]
SEN / CTL	P24592		Insulin-like growth factor-binding protein 6		IGFBP6		-0.74		0.09		0.00000478		0.00000658		regulation of cell growth,signal transduction,nega... [More]		receptor binding,insulin-like growth factor I bind... [More]		extracellular region,extracellular space,Golgi app... [More]		6	4	4	HLDSVLQQLQTEVYR.3\|EGQEC[CAM]GVYTPNC[CAM]APGLQC[CAM... [More]
SEN / CTL	P13645		Keratin, type I cytoskeletal 10		KRT10		-0.75		0.83		2.62e-12		1.26e-11		keratinocyte differentiation		structural constituent of epidermis		extracellular space,nucleus,cytoplasm,intermediate... [More]		93	52	104	IRLENEIQTYR.3\|IRLENEIQTYR.2\|LKYENEVALR.3\|LKYENEVAL... [More]
SEN / CTL	P27797		Calreticulin		CALR		-0.75		1.08		1.94e-8		4.67e-8		negative regulation of transcription from RNA poly... [More]		complement component C1q binding,glycoprotein bind... [More]		acrosomal vesicle,extracellular region,proteinaceo... [More]		87	52	95	EQFLDGDGWTSR.2\|FYALSASFEPFSNK.2\|FYALSASFEPFSNK.3\|G... [More]
SEN / CTL	Q14767		Latent-transforming growth factor beta-binding protein 2		LTBP2		-0.75		0.17		0.0145		0.00722		protein targeting,transforming growth factor beta ... [More]		calcium ion binding,protein binding,heparin bindin... [More]		proteinaceous extracellular matrix,extracellular s... [More]		3	8	8	SSEVYAQLC[CAM]NVAR.2\|RSTPLGQQQPAPR.3\|SSAAGEGTLAR.2... [More]
SEN / CTL	P56159		GDNF family receptor alpha-1		GFRA1		-0.75		0.29		0.0621		0.0241		MAPK cascade,cell surface receptor signaling pathw... [More]		Ras guanyl-nucleotide exchange factor activity,rec... [More]		intracellular,plasma membrane,extrinsic component ... [More]		3	5	5	LADFFTNC[CAM]QPESR.2\|EGLGASSHITTK.3\|NKPLGPAGSENEIP... [More]
SEN / CTL	P07951		Tropomyosin beta chain		TPM2		-0.75		0.76		0.0846		0.0314		muscle contraction,muscle filament sliding,regulat... [More]		actin binding,structural constituent of muscle		cytosol,muscle thin filament tropomyosin		12	24	37	AMKDEEKMELQEMQLK.4\|AMKDEEKMELQEMQLK.3\|KLVILEGELERS... [More]
SEN / CTL	Q9C005		Protein dpy-30 homolog		DPY30		-0.75		2.58		0.0928		0.0336		chromatin silencing at telomere,transcription, DNA... [More]		protein binding,histone-lysine N-methyltransferase... [More]		chromosome, telomeric region,nucleus,nucleoplasm,G... [More]		6	4	6	ERPPNPIEFLASYLLK.3\|ERPPNPIEFLASYLLK.4\|ERPPNPIEFLAS... [More]
SEN / CTL	P16035		Metalloproteinase inhibitor 2		TIMP2		-0.76		0.26		6.22e-12		2.75e-11		central nervous system development,aging,negative ... [More]		protease binding,integrin binding,metalloendopepti... [More]		extracellular region,proteinaceous extracellular m... [More]		21	8	11	AVSEKEVDSGNDIYGNPIKR.4\|AVSEKEVDSGNDIYGNPIKR.3\|GAAP... [More]
SEN / CTL	P62906		60S ribosomal protein L10a		RPL10A		-0.77		0.32		1.64e-10		5.93e-10		nuclear-transcribed mRNA catabolic process, nonsen... [More]		RNA binding,structural constituent of ribosome,pro... [More]		nucleus,nucleolus,cytoplasm,cytosol,focal adhesion... [More]		21	19	35	KYDAFLASESLIK.3\|KYDAFLASESLIK.2\|FSVC[CAM]VLGDQQHC[... [More]
SEN / CTL	Q01469		Fatty acid-binding protein, epidermal		FABP5		-0.77		0.91		0.00134		0.000975		glucose metabolic process,lipid metabolic process,... [More]		transporter activity,fatty acid binding,protein bi... [More]		nucleoplasm,cytoplasm,cytosol,extracellular exosom... [More]		24	17	34	ELGVGIALR.2\|TTQFSC[CAM]TLGEKFEETTADGRK.4\|TTQFSC[CA... [More]
SEN / CTL	P04156		Major prion protein		PRNP		-0.77		0.3		0.039		0.0162		negative regulation of protein phosphorylation,cel... [More]		copper ion binding,lamin binding,microtubule bindi... [More]		nucleus,cytoplasm,endoplasmic reticulum,Golgi appa... [More]		3	4	5	VVEQMC[CAM]ITQYER.2\|VVEQM[Oxi]C[CAM]ITQYER.2\|PIIHF... [More]
SEN / CTL	Q92688		Acidic leucine-rich nuclear phosphoprotein 32 family member B		ANP32B		-0.78		0.37		2.89e-7		5.5e-7		vasculature development,nucleosome assembly,activa... [More]		protein binding,histone binding,RNA polymerase bin... [More]		nucleus,cytoplasm,extracellular exosome,nucleolus		15	10	17	SLDLFNC[CAM]EVTNLNDYRESVFK.3\|IFGGLDM[Oxi]LAEKLPNLT... [More]
SEN / CTL	P20700		Lamin-B1		LMNB1		-0.78		0.78		0.00226		0.00154				structural molecule activity,phospholipase binding		nuclear envelope,nuclear inner membrane,lamin fila... [More]		30	59	97	LQIELGK.2\|SLEGDLEDLKDQIAQLEASLAAAK.4\|SLEGDLEDLKDQI... [More]
SEN / CTL	P33908		Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA		MAN1A1		-0.78		0.85		0.058		0.0228		N-glycan processing,Golgi apparatus mannose trimmi... [More]		mannosyl-oligosaccharide 1,2-alpha-mannosidase act... [More]		Golgi membrane,cytoplasm,endoplasmic reticulum,end... [More]		6	12	15	FDGGVEAIATR.2\|WAWEAVEALENHC[CAM]R.3\|HEFEEAK.2\|MYFD... [More]
SEN / CTL	Q93088		Betaine--homocysteine S-methyltransferase 1		BHMT		-0.79		0.57		0.0154		0.00758		sulfur amino acid metabolic process,protein methyl... [More]		zinc ion binding,S-adenosylmethionine-homocysteine... [More]		cytoplasm,cytosol,extracellular exosome		6	35	57	ISGQEVNEAAC[CAM]DIAR.2\|ISGQEVNEAAC[CAM]DIAR.3\|AGPW... [More]
SEN / CTL	P13693		Translationally-controlled tumor protein		TPT1		-0.8		0.56		0.00000815		0.0000107		calcium ion transport,cellular calcium ion homeost... [More]		calcium ion binding,protein binding,microtubule bi... [More]		extracellular space,nucleus,cytoplasm,multivesicul... [More]		18	14	26	VKPFMTGAAEQIKHILANFK.4\|IREIADGLC[CAM]LEVEGK.3\|IREI... [More]
SEN / CTL	P05155		Plasma protease C1 inhibitor		SERPING1		-0.81		0.69		5.39e-8		1.17e-7		negative regulation of complement activation, lect... [More]		serine-type endopeptidase inhibitor activity,prote... [More]		extracellular region,extracellular space,platelet ... [More]		51	19	34	FQPTLLTLPR.2\|LVLLNAIYLSAK.2\|LLDSLPSDTR.2\|TNLESILSY... [More]
SEN / CTL	Q16610		Extracellular matrix protein 1		ECM1		-0.82		0.51		1.73e-8		4.29e-8		ossification,angiogenesis,positive regulation of e... [More]		protease binding,signal transducer activity,interl... [More]		extracellular region,proteinaceous extracellular m... [More]		24	22	28	ELLALIQLER.2\|LVWEEAMSR.2\|FC[CAM]EAEFSVK.2\|RAPYPNYD... [More]
SEN / CTL	P39687		Acidic leucine-rich nuclear phosphoprotein 32 family member A		ANP32A		-0.82		0.92		0.0000266		0.0000304		transcription, DNA-templated,regulation of transcr... [More]		histone binding,poly(A) RNA binding		nucleus,nucleoplasm,cytoplasm,endoplasmic reticulu... [More]		27	19	33	SNEGKLEGLTDEFEELEFLSTINVGLTSIANLPK.4\|VSGGLEVLAEK.2... [More]
SEN / CTL	Q92859		Neogenin		NEO1		-0.82		0.29		0.0368		0.0154		cell adhesion,axon guidance,positive regulation of... [More]		receptor activity,protein binding,co-receptor bind... [More]		nucleoplasm,Golgi apparatus,plasma membrane,integr... [More]		3	6	6	QLLPDGSLFISNVVHSK.3\|SHLYHPGSPWPIGTSMSLSDR.4\|EHNLQV... [More]
SEN / CTL	Q15904		V-type proton ATPase subunit S1		ATP6AP1		-0.83		0.16		0.0000492		0.0000526		insulin receptor signaling pathway,ATP hydrolysis ... [More]		transporter activity,ATP binding,Rab GTPase bindin... [More]		endosome membrane,integral component of membrane,p... [More]		6	9	11	LGASPLHVDLATLR.3\|LGASPLHVDLATLR.2\|EVLTGNDEVIGQVLST... [More]
SEN / CTL	P12004		Proliferating cell nuclear antigen		PCNA		-0.83		0.72		0.00129		0.000946		G1/S transition of mitotic cell cycle,regulation o... [More]		purine-specific mismatch base pair DNA N-glycosyla... [More]		nuclear chromosome, telomeric region,nucleus,nucle... [More]		18	21	41	DLSHIGDAVVISC[CAM]AK.3\|DLSHIGDAVVISC[CAM]AK.2\|YLNF... [More]
SEN / CTL	Q07955		Serine/arginine-rich splicing factor 1		SRSF1		-0.84		0.48		0.0000431		0.0000463		alternative mRNA splicing, via spliceosome,mRNA 5'... [More]		nucleotide binding,RNA binding,mRNA binding,protei... [More]		nucleus,nucleoplasm,cytoplasm,nuclear speck,extrac... [More]		15	24	32	EAGDVC[CAM]YADVYR.2\|EAGDVC[CAM]YADVYRDGTGVVEFVR.3\|... [More]
SEN / CTL	P07225		Vitamin K-dependent protein S		PROS1		-0.84		0.48		0.0021		0.00144		platelet degranulation,signal peptide processing,E... [More]		endopeptidase inhibitor activity,calcium ion bindi... [More]		Golgi membrane,extracellular region,extracellular ... [More]		9	20	26	SFQTGLFTAAR.2\|VYFAGFPR.2\|NNLELSTPLKIETISHEDLQR.4\|N... [More]
SEN / CTL	P24844		Myosin regulatory light polypeptide 9		MYL9		-0.84		0.42		0.00399		0.00247		muscle contraction,regulation of muscle contractio... [More]		calcium ion binding,structural constituent of musc... [More]		stress fiber,cytosol,muscle myosin complex,Z disc		6	6	10	GNFNYVEFTR.2\|NAFAC[CAM]FDEEASGFIHEDHLR.4\|NAFAC[CAM... [More]
SEN / CTL	Q86SF2		N-acetylgalactosaminyltransferase 7		GALNT7		-0.85		0.67		0.00073		0.000579		carbohydrate metabolic process,protein O-linked gl... [More]		polypeptide N-acetylgalactosaminyltransferase acti... [More]		Golgi membrane,membrane,integral component of memb... [More]		15	23	30	GFETAYC[CAM]IDSMGK.2\|C[CAM]LDRSEVLHQVFISNC[CAM]DSS... [More]
SEN / CTL	P35555		Fibrillin-1		FBN1		-0.86		0.68		5.7e-19		5.5e-18		skeletal system development,metanephros developmen... [More]		integrin binding,hormone activity,extracellular ma... [More]		microfibril,extracellular region,proteinaceous ext... [More]		66	32	32	ILELLPALTTLTNHNR.3\|TLPGGNQC[CAM]IVPIC[CAM]R.2\|TC[C... [More]
SEN / CTL	P16949		Stathmin		STMN1		-0.87		0.4		9.85e-10		2.98e-9		mitotic cytokinesis,microtubule depolymerization,m... [More]		signal transducer activity,tubulin binding		intracellular,cytoplasm,cytosol,microtubule,membra... [More]		21	18	24	ASGQAFELILSPR.2\|ASGQAFELILSPR.3\|SKESVPEFPLSPPK.3\|S... [More]
SEN / CTL	Q8TEA8		D-tyrosyl-tRNA(Tyr) deacylase 1		DTD1		-0.87		0.3		0.0317		0.0138		DNA replication,tRNA metabolic process,regulation ... [More]		aminoacyl-tRNA editing activity,DNA binding,metal ... [More]		nucleus,cytoplasm		3	6	8	ASVTVGGEQISAIGR.2\|SASSGAEGDVSSEREP.3\|SASSGAEGDVSSE... [More]
SEN / CTL	Q9H910		Hematological and neurological expressed 1-like protein		HN1L		-0.88		0.42		5.63e-9		1.54e-8						nucleus,cytoplasm,plasma membrane		21	11	17	TSDIFGSPVTATSR.2\|GSGIFDESTPVQTR.2\|AMKPPGGESSNLFGSP... [More]
SEN / CTL	P23142		Fibulin-1		FBLN1		-0.88		0.44		0.000581		0.000474		negative regulation of protein phosphorylation,neg... [More]		fibronectin binding,extracellular matrix structura... [More]		extracellular region,proteinaceous extracellular m... [More]		9	25	36	RGYQLSDVDGVTC[CAM]EDIDEC[CAM]ALPTGGHIC[CAM]SYR.4\|Y... [More]
SEN / CTL	P84090		Enhancer of rudimentary homolog		ERH		-0.88		0.54		0.00627		0.00365		nucleobase-containing compound metabolic process,p... [More]		protein binding,methyl-CpG binding,poly(A) RNA bin... [More]		midbody,methylosome		6	5	10	TYADYESVNEC[CAM]MEGVC[CAM]K.2\|TYADYESVNEC[CAM]MEGV... [More]
SEN / CTL	P17858		ATP-dependent 6-phosphofructokinase, liver type		PFKL		-0.88		1.2		0.0179		0.00859		fructose 6-phosphate metabolic process,glycolytic ... [More]		6-phosphofructokinase activity,protein binding,ATP... [More]		cytosol,6-phosphofructokinase complex,membrane,ext... [More]		30	42	74	GQLESIVENIR.2\|TFVLEVMGR.2\|TFVLEVM[Oxi]GR.2\|AIGVLTS... [More]
SEN / CTL	Q9UBR2		Cathepsin Z		CTSZ		-0.88		1.57		0.0207		0.00966		angiotensin maturation,proteolysis,ER to Golgi ves... [More]		cysteine-type endopeptidase activity,protein bindi... [More]		Golgi membrane,extracellular space,lysosome,endopl... [More]		15	16	25	NVDGVNYASITR.2\|NVDGVNYASITR.3\|NQHIPQYC[CAM]GSC[CAM... [More]
SEN / CTL	P29279		Connective tissue growth factor		CTGF		-0.89		0.54		0.00528		0.00314		cartilage condensation,ossification,angiogenesis,r... [More]		fibronectin binding,integrin binding,protein bindi... [More]		extracellular region,proteinaceous extracellular m... [More]		9	8	8	DGAPC[CAM]IFGGTVYR.2\|C[CAM]PAGVSLVLDGC[CAM]GC[CAM]... [More]
SEN / CTL	Q13308		Inactive tyrosine-protein kinase 7		PTK7		-0.9		0.38		3.97e-10		1.29e-9		establishment of planar polarity,ventricular septu... [More]		protein kinase activity,protein binding,ATP bindin... [More]		integral component of plasma membrane,cell-cell ju... [More]		24	30	35	VVLAPQDVVVAR.2\|ADGSSLPEWVTDNAGTLHFAR.3\|INSVEVYDGTW... [More]
SEN / CTL	Q96PU4		E3 ubiquitin-protein ligase UHRF2		UHRF2		-0.9		0.22		0.0202		0.00952		cell cycle,cell proliferation,maintenance of DNA m... [More]		DNA binding,ubiquitin-protein transferase activity... [More]		nucleus,nucleoplasm,nuclear heterochromatin		3	14	15	IISVDEIFK.2\|RPISDDDC[CAM]PSASK.3\|IERPGAHPLSFADGK.3... [More]
SEN / CTL	Q16270		Insulin-like growth factor-binding protein 7		IGFBP7		-0.91		0.98		4.86e-10		1.56e-9		regulation of cell growth,cell adhesion,embryo imp... [More]		protein binding,insulin-like growth factor binding		extracellular region,extracellular space,extracell... [More]		36	12	15	TELLPGDRDNLAIQTR.3\|TELLPGDRDNLAIQTR.2\|SRYPVC[CAM]G... [More]
SEN / CTL	P78324 Q5TFQ8		Tyrosine-protein phosphatase non-receptor type substrate 1;Signal-regulatory protein beta-1 isoform 3		SIRPA SIRPB1		-0.91		0.29		0.0314		0.0137		cell adhesion,leukocyte migration;		SH3 domain binding;		plasma membrane,membrane,integral component of mem... [More]		3	1	2	ATPQHTVSFTC[CAM]ESHGFSPR.4\|ATPQHTVSFTC[CAM]ESHGFSP... [More]
SEN / CTL	O75882		Attractin		ATRN		-0.92		0.09		0.00292		0.0019		inflammatory response,response to oxidative stress... [More]		receptor activity,carbohydrate binding		extracellular space,cytoplasm,plasma membrane,inte... [More]		3	29	41	LTLTPWVGLR.2\|EQYAVVGHSAHIVTLK.4\|EQYAVVGHSAHIVTLK.3... [More]
SEN / CTL	O00241		Signal-regulatory protein beta-1		SIRPB1		-0.92		0.27		0.0286		0.0127		signal transduction,cell surface receptor signalin... [More]				plasma membrane,integral component of plasma membr... [More]		3	2	2	ATPEHTVSFTC[CAM]ESHGFSPR.4\|SVSVAAGESATLR.2
SEN / CTL	O00468		Agrin		AGRN		-0.93		0.81		1.72e-26		3.1e-25		retinoid metabolic process,glycosaminoglycan biosy... [More]		dystroglycan binding,structural constituent of cyt... [More]		extracellular region,basal lamina,cytoplasm,Golgi ... [More]		159	54	64	SFLAFPTLR.2\|KFDGPC[CAM]DPC[CAM]QGALPDPSR.3\|KFDGPC[... [More]
SEN / CTL	P61916		Epididymal secretory protein E1		NPC2		-0.94		0.48		7.02e-8		1.45e-7		cholesterol metabolic process,response to virus,ph... [More]		protein binding,cholesterol binding,enzyme binding		lysosome,endoplasmic reticulum,extracellular exoso... [More]		21	12	19	AVVHGILMGVPVPFPIPEPDGC[CAM]K.3\|AVVHGILMGVPVPFPIPEP... [More]
SEN / CTL	Q8WUT4		Leucine-rich repeat neuronal protein 4		LRRN4		-0.94		0.25		0.0209		0.00975		long-term memory,visual learning				integral component of plasma membrane,extracellula... [More]		3	2	2	ALSTSELGHLEQLQVLTLR.3\|HLQTPC[CAM]AELQR.2
SEN / CTL	P05156		Complement factor I		CFI		-0.96		0.79		0.00000132		0.00000216		proteolysis,receptor-mediated endocytosis,compleme... [More]		serine-type endopeptidase activity,scavenger recep... [More]		extracellular region,extracellular space,membrane,... [More]		18	26	36	VFSLQWGEVK.2\|GLETSLAEC[CAM]TFTK.2\|IVIEYVDR.2\|AC[CA... [More]
SEN / CTL	P00751		Complement factor B		CFB		-0.96		0.49		0.0121		0.00624		proteolysis,complement activation,complement activ... [More]		complement binding,serine-type endopeptidase activ... [More]		extracellular region,extracellular space,plasma me... [More]		6	51	78	DFHINLFQVLPWLK.3\|DFHINLFQVLPWLK.4\|DFHINLFQVLPWLK.2... [More]
SEN / CTL	Q13185		Chromobox protein homolog 3		CBX3		-0.97		0.32		8.82e-9		2.31e-8		chromatin remodeling,transcription, DNA-templated,... [More]		protein binding,enzyme binding,protein domain spec... [More]		chromosome, centromeric region,condensed chromosom... [More]		15	13	22	C[CAM]PQIVIAFYEER.2\|C[CAM]PQIVIAFYEER.3\|WKDSDEADLV... [More]
SEN / CTL	Q13867		Bleomycin hydrolase		BLMH		-0.97		0.18		0.00945		0.00509		protein polyubiquitination,proteolysis,response to... [More]		aminopeptidase activity,carboxypeptidase activity,... [More]		nucleus,cytoplasm,cytosol,extracellular exosome		3	32	47	IGPITPLEFYR.2\|IGPITPLEFYR.3\|AQHVFQHAVPQEGKPITNQK.5... [More]
SEN / CTL	Q6EMK4		Vasorin		VASN		-0.98		0.31		9.34e-8		1.88e-7		negative regulation of epithelial to mesenchymal t... [More]		transforming growth factor beta binding,cadherin b... [More]		extracellular space,mitochondrion,lysosomal membra... [More]		12	8	8	SLTLGIEPVSPTSLR.2\|NPFNC[CAM]VC[CAM]PLSWFGPWVR.3\|LL... [More]
SEN / CTL	O00193		Small acidic protein		SMAP		-0.98		0.57		0.00569		0.00336		biological_process		molecular_function		cellular_component		6	6	12	SASPDDDLGSSNWEAADLGNEER.3\|TGEEDKKINEELESQYQQSMDSK.... [More]
SEN / CTL	O14672		Disintegrin and metalloproteinase domain-containing protein 10		ADAM10		-1		0.88		0.000983		0.000752		in utero embryonic development,protein phosphoryla... [More]		endopeptidase activity,metalloendopeptidase activi... [More]		nucleus,cytoplasm,Golgi apparatus,Golgi-associated... [More]		21	21	28	EAVIAQISSHVK.3\|EAVIAQISSHVK.2\|AIDTIYQTTDFSGIR.2\|AI... [More]
SEN / CTL	P0C0S8 P20671 Q96KK5 Q99878 Q9BTM1		Histone H2A type 1;Histone H2A type 1-D;Histone H2A type 1-H;Histone H2A type 1-J;Histone H2A.J		HIST1H2AG HIST1H2AD HIST1H2AH HIST1H2AJ H2AFJ		-1		1.08		0.0364		0.0153		chromatin silencing,biological_process;chromatin s... [More]		DNA binding,protein binding,enzyme binding,protein... [More]		nucleosome,nuclear chromatin,nucleus,extracellular... [More]		6	1	3	HLQLAIRNDEELNKLLGK.4\|HLQLAIRNDEELNKLLGK.3\|HLQLAIRN... [More]
SEN / CTL	P07996		Thrombospondin-1		THBS1		-1.01		0.97		2.94e-21		3.78e-20		activation of MAPK activity,response to hypoxia,ne... [More]		phosphatidylserine binding,glycoprotein binding,fi... [More]		extracellular region,fibrinogen complex,extracellu... [More]		129	63	89	FVFGTTPEDILR.2\|TIVTTLQDSIR.2\|GFLLLASLR.2\|SITLFVQED... [More]
SEN / CTL	Q10471		Polypeptide N-acetylgalactosaminyltransferase 2		GALNT2		-1.02		0.81		1.35e-7		2.65e-7		immunoglobulin biosynthetic process,protein O-link... [More]		polypeptide N-acetylgalactosaminyltransferase acti... [More]		Golgi membrane,endoplasmic reticulum membrane,Golg... [More]		27	28	40	VWQC[CAM]GGSLEIIPC[CAM]SR.2\|VLTFLDSHC[CAM]EC[CAM]N... [More]
SEN / CTL	Q9H773		dCTP pyrophosphatase 1		DCTPP1		-1.03		0.6		0.0875		0.0322		nucleoside triphosphate catabolic process,protein ... [More]		magnesium ion binding,pyrimidine deoxyribonucleoti... [More]		cytosol		3	12	18	C[CAM]RVDLPLAVLSK.3\|C[CAM]RVDLPLAVLSK.2\|RLHAEFAAER... [More]
SEN / CTL	Q02388		Collagen alpha-1(VII) chain		COL7A1		-1.06		0.78		4.01e-12		1.84e-11		ER to Golgi vesicle-mediated transport,cell adhesi... [More]		serine-type endopeptidase inhibitor activity,prote... [More]		Golgi membrane,extracellular region,collagen type ... [More]		33	34	44	QHVPGVMVLLVDEPLRGDIFSPIR.4\|SFLEGLVLPFSGAASAQGVR.3\|... [More]
SEN / CTL	P29323		Ephrin type-B receptor 2		EPHB2		-1.06		0.73		0.00000665		0.00000898		angiogenesis,urogenital system development,nervous... [More]		protein tyrosine kinase activity,transmembrane-eph... [More]		extracellular region,cytosol,plasma membrane,integ... [More]		21	21	25	AGAIYVFQVR.2\|VDTIAADESFSQVDLGGR.2\|WTAPEAIQYR.2\|AMA... [More]
SEN / CTL	P12109		Collagen alpha-1(VI) chain		COL6A1		-1.08		0.87		6.2e-10		1.97e-9		osteoblast differentiation,cell adhesion,extracell... [More]		platelet-derived growth factor binding		extracellular region,collagen type VI trimer,lysos... [More]		48	49	69	VFSVAITPDHLEPR.3\|VFSVAITPDHLEPR.2\|LLLFSDGNSQGATPAA... [More]
SEN / CTL	P09871		Complement C1s subcomponent		C1S		-1.08		0.97		0.0000247		0.0000284		proteolysis,complement activation,complement activ... [More]		serine-type endopeptidase activity,calcium ion bin... [More]		extracellular region,extracellular exosome,blood m... [More]		15	26	38	TNFDNDIALVR.2\|MLTPEHVFIHPGWK.4\|M[Oxi]LTPEHVFIHPGWK... [More]
SEN / CTL	P19320		Vascular cell adhesion protein 1		VCAM1		-1.09		0.79		0.00000591		0.0000081		response to hypoxia,acute inflammatory response,ch... [More]		integrin binding,primary amine oxidase activity,ce... [More]		podosome,extracellular space,early endosome,endopl... [More]		18	11	11	QSTQTLYVNVAPR.2\|MEDSGVYLC[CAM]EGINQAGR.2\|SLEVTFTPV... [More]
SEN / CTL	P35442		Thrombospondin-2		THBS2		-1.11		0.59		0.0000131		0.0000162		cell adhesion,negative regulation of angiogenesis,... [More]		calcium ion binding,heparin binding		extracellular region,basement membrane,platelet al... [More]		15	8	9	GTLLALEGPGLSQR.2\|SC[CAM]DVTSNTC[CAM]LGPSIQTR.2\|GLL... [More]
SEN / CTL	P14324		Farnesyl pyrophosphate synthase		FDPS		-1.11		0.78		0.0000651		0.0000684		cholesterol biosynthetic process,viral process,ger... [More]		dimethylallyltranstransferase activity,geranyltran... [More]		nucleoplasm,cytoplasm,cytosol		15	17	27	GLTVVVAFR.2\|LKEVLEYNAIGGK.3\|LKEVLEYNAIGGK.2\|C[CAM]... [More]
SEN / CTL	P55285		Cadherin-6		CDH6		-1.12		0.4		0.0000118		0.0000148		cell adhesion,homophilic cell adhesion via plasma ... [More]		calcium ion binding		plasma membrane,integral component of membrane,ext... [More]		9	12	12	IVVEDVDEPPVFSK.2\|LAYILQIR.2\|FLYLGPFKDSATVR.3\|LHSDQ... [More]
SEN / CTL	P15151		Poliovirus receptor		PVR		-1.12		0.39		0.0000405		0.0000439		positive regulation of natural killer cell mediate... [More]		virus receptor activity,receptor activity,receptor... [More]		extracellular space,cytoplasm,plasma membrane,inte... [More]		9	5	6	VQLTGEPVPMAR.2\|HGESGSMAVFHQTQGPSYSESK.4\|HGESGSMAVF... [More]
SEN / CTL	Q01105		Protein SET		SET		-1.12		1.12		0.0000737		0.0000757		DNA replication,nucleosome assembly,nucleosome dis... [More]		DNA binding,protein phosphatase inhibitor activity... [More]		nucleus,nucleoplasm,cytoplasm,endoplasmic reticulu... [More]		24	18	30	VEVTEFEDIK.2\|VEVTEFEDIKSGYR.3\|IPNFWVTTFVNHPQVSALLG... [More]
SEN / CTL	Q08380		Galectin-3-binding protein		LGALS3BP		-1.14		0.72		1.31e-18		1.18e-17		platelet degranulation,receptor-mediated endocytos... [More]		scavenger receptor activity		extracellular region,proteinaceous extracellular m... [More]		72	23	30	SDLAVPSELALLK.2\|ELSEALGQIFDSQR.2\|ELSEALGQIFDSQR.3\|... [More]
SEN / CTL	P08294		Extracellular superoxide dismutase [Cu-Zn]		SOD3		-1.14		1.47		0.0000979		0.0000979		response to reactive oxygen species,response to hy... [More]		superoxide dismutase activity,copper ion binding,p... [More]		extracellular region,extracellular space,nucleus,c... [More]		33	10	14	VTGVVLFR.2\|AVVVHAGEDDLGRGGNQASVENGNAGR.4\|DDDGALHAA... [More]
SEN / CTL	O95881		Thioredoxin domain-containing protein 12		TXNDC12		-1.15		0.65		0.00379		0.0024		cell differentiation,cell redox homeostasis,oxidat... [More]		peptide disulfide oxidoreductase activity,protein-... [More]		endoplasmic reticulum lumen		9	10	16	ILFLDPSGK.2\|EAAASGLPLMVIIHK.3\|EAAASGLPLM[Oxi]VIIHK... [More]
SEN / CTL	O94973		AP-2 complex subunit alpha-2		AP2A2		-1.15		1.06		0.135		0.0449		intracellular protein transport,microtubule-based ... [More]		molecular_function,lipid binding,protein transport... [More]		cytosol,plasma membrane,cytoplasmic, membrane-boun... [More]		18	41	64	GLAVFISDIR.2\|TSVSLAVSR.2\|NAVLFEAISLIIHHDSEPNLLVR.4... [More]
SEN / CTL	Q9GZX9		Twisted gastrulation protein homolog 1		TWSG1		-1.16		0.4		0.00175		0.00123		ossification,mesoderm formation,salivary gland mor... [More]				extracellular space,extracellular exosome		6	4	6	STVEELHEPIPSLFR.3\|STVEELHEPIPSLFR.2\|WFHNAC[CAM]C[C... [More]
SEN / CTL	P10412 P16402 P16403 P22492 Q02539		Histone H1.4;Histone H1.3;Histone H1.2;Histone H1t;Histone H1.1		HIST1H1E HIST1H1D HIST1H1C HIST1H1T HIST1H1A		-1.16		1.07		0.0639		0.0246		negative regulation of transcription from RNA poly... [More]		protein binding,chromatin DNA binding,poly(A) RNA ... [More]		nucleosome,nucleus,nuclear heterochromatin,extrace... [More]		6	2	3	ALAAAGYDVEK.2\|ALAAAGYDVEKNNSR.3\|ALAAAGYDVEKNNSR.2
SEN / CTL	P62979		Ubiquitin-40S ribosomal protein S27a		RPS27A		-1.18		0.86		4.94e-7		8.78e-7		G2/M transition of mitotic cell cycle,negative reg... [More]		structural constituent of ribosome,protein binding... [More]		extracellular space,nucleus,nucleoplasm,nucleolus,... [More]		27	9	19	TITLEVEPSDTIENVK.2\|TITLEVEPSDTIENVK.3\|ESTLHLVLR.2\|... [More]
SEN / CTL	P12259		Coagulation factor V		F5		-1.2		0.28		0.0156		0.00765		platelet degranulation,proteolysis,ER to Golgi ves... [More]		serine-type endopeptidase activity,copper ion bind... [More]		Golgi membrane,extracellular region,extracellular ... [More]		3	40	46	AEVDDVIQVR.2\|FC[CAM]ENPDEVKR.3\|SQHLDNFSNQIGK.3\|SQH... [More]
SEN / CTL	Q9UEE9		Craniofacial development protein 1		CFDP1		-1.21		0.54		0.0806		0.03		cell adhesion,multicellular organism development,b... [More]		molecular_function		condensed chromosome kinetochore,cellular_componen... [More]		3	9	11	VFDFAGEEVR.2\|SSGMSSLLGK.2\|EKPQANVPSALPSLPAGSGLKR.4... [More]
SEN / CTL	Q14118		Dystroglycan		DAG1		-1.22		0.22		0.0000296		0.0000332		morphogenesis of an epithelial sheet,protein O-lin... [More]		virus receptor activity,dystroglycan binding,actin... [More]		extracellular region,basement membrane,extracellul... [More]		6	17	21	VTIPTDLIASSGDIIK.2\|LGC[CAM]SLNQNSVPDIHGVEAPAR.3\|GG... [More]
SEN / CTL	P36955		Pigment epithelium-derived factor		SERPINF1		-1.25		0.94		0.000385		0.000331		kidney development,multicellular organism developm... [More]		serine-type endopeptidase inhibitor activity,prote... [More]		extracellular region,basement membrane,extracellul... [More]		12	20	26	SSTSPTTNVLLSPLSVATALSALSLGAEQR.3\|DTDTGALLFIGK.2\|LA... [More]
SEN / CTL	O75937		DnaJ homolog subfamily C member 8		DNAJC8		-1.25		0.97		0.00385		0.00242		mRNA splicing, via spliceosome				nucleoplasm,cytoplasm,intercellular bridge		9	21	31	LFAELEIK.2\|EGKPTIVEEDDPELFK.3\|EGKPTIVEEDDPELFK.2\|L... [More]
SEN / CTL	Q08629		Testican-1		SPOCK1		-1.28		0.07		0.000902		0.000701		regulation of cell growth,neuron migration,cell ad... [More]		serine-type endopeptidase inhibitor activity,cyste... [More]		proteinaceous extracellular matrix,extracellular s... [More]		3	2	2	SLLGAFIPR.2\|ATQC[CAM]HGSTGQC[CAM]WC[CAM]VDK.3
SEN / CTL	Q8NBJ4		Golgi membrane protein 1		GOLM1		-1.3		0.54		0.00661		0.00383		nucleus organization,regulation of lipid metabolic... [More]		protein binding		extracellular space,Golgi apparatus,integral compo... [More]		6	21	27	DTINLLDQR.2\|KFSYDLSQC[CAM]INQMK.3\|KNEFQGELEK.3\|KNE... [More]
SEN / CTL	P14543		Nidogen-1		NID1		-1.33		0.91		2.03e-8		4.84e-8		cell-matrix adhesion,positive regulation of cell-s... [More]		calcium ion binding,collagen binding,laminin bindi... [More]		extracellular region,basement membrane,basal lamin... [More]		27	39	51	VLFETDLVNPR.2\|VYYREDLSPSITQR.3\|TQFTC[CAM]EC[CAM]SI... [More]
SEN / CTL	Q15262		Receptor-type tyrosine-protein phosphatase kappa		PTPRK		-1.35		0.24		3.35e-10		1.12e-9		protein dephosphorylation,cell adhesion,signal tra... [More]		protein tyrosine phosphatase activity,transmembran... [More]		photoreceptor outer segment,integral component of ... [More]		12	12	13	VLLTRPGEGGTGLPGPPLITR.3\|GLNPGTLNILVR.2\|GSGVSNFAQLI... [More]
SEN / CTL	P08572		Collagen alpha-2(IV) chain		COL4A2		-1.36		0.94		4.26e-12		1.92e-11		angiogenesis,transcription, DNA-templated,negative... [More]		extracellular matrix structural constituent		extracellular region,collagen type IV trimer,endop... [More]		39	15	19	SVSIGYLLVK.2\|FSTMPFLYC[CAM]NPGDVC[CAM]YYASR.3\|C[CA... [More]
SEN / CTL	Q01995		Transgelin		TAGLN		-1.36		0.93		7.03e-9		1.88e-8		muscle organ development,epithelial cell different... [More]		actin binding		cytoplasm		30	24	41	LGFQVWLK.2\|EFTESQLQEGKHVIGLQMGSNR.4\|QMEQVAQFLK.2\|Q... [More]
SEN / CTL	P51884		Lumican		LUM		-1.38		0.79		3.39e-8		7.56e-8		visual perception,response to organic cyclic compo... [More]		extracellular matrix structural constituent,collag... [More]		extracellular region,proteinaceous extracellular m... [More]		18	21	29	FNALQYLR.2\|SLEYLDLSFNQIAR.3\|SLEYLDLSFNQIAR.2\|LPSGL... [More]
SEN / CTL	P13611		Versican core protein		VCAN		-1.39		0.98		9.82e-17		7.58e-16		skeletal system development,osteoblast differentia... [More]		extracellular matrix structural constituent,calciu... [More]		extracellular region,proteinaceous extracellular m... [More]		60	17	23	LATVGELQAAWR.2\|YTLNFEAAQK.2\|VSVPTHPEAVGDASLTVVK.3\|... [More]
SEN / CTL	P10321		HLA class I histocompatibility antigen, Cw-7 alpha chain		HLA-C		-1.39		0.37		1.16e-11		4.73e-11								18	9	11	SWTAADTAAQITQR.2\|SWTAADTAAQITQR.3\|FISVGYVDDTQFVR.2... [More]
SEN / CTL	P45973		Chromobox protein homolog 5		CBX5		-1.39		0.25		0.00902		0.00492		blood coagulation,viral process,negative regulatio... [More]		chromatin binding,protein binding,protein binding,... [More]		histone deacetylase complex,kinetochore,nuclear ch... [More]		3	14	21	WKDTDEADLVLAK.3\|WKDTDEADLVLAK.2\|GQVEYLLK.2\|WKGFSEE... [More]
SEN / CTL	P49321		Nuclear autoantigenic sperm protein		NASP		-1.42		0.56		0.00000332		0.00000487		blastocyst development,DNA replication,DNA replica... [More]		Hsp90 protein binding		nuclear chromatin,nucleus,nucleoplasm,cytoplasm,pr... [More]		12	59	92	KPTDGASSSNC[CAM]VTDISHLVR.4\|KPTDGASSSNC[CAM]VTDISH... [More]
SEN / CTL	Q9Y4K0		Lysyl oxidase homolog 2		LOXL2		-1.47		1.43		5.99e-7		0.00000105		response to hypoxia,epithelial to mesenchymal tran... [More]		chromatin binding,transcription corepressor activi... [More]		basement membrane,extracellular space,nucleus,nucl... [More]		42	16	19	VVC[CAM]GMFGFPGER.2\|LGQGIGPIHLNEIQC[CAM]TGNEK.3\|NG... [More]
SEN / CTL	P02774		Vitamin D-binding protein		GC		-1.48		1.58		0.132		0.0444		vitamin D metabolic process,vitamin transport		actin binding,vitamin D binding,vitamin transporte... [More]		extracellular region,extracellular space,cytosol,l... [More]		15	46	77	HQPQEFPTYVEPTNDEIC[CAM]EAFRKDPK.5\|HQPQEFPTYVEPTNDE... [More]
SEN / CTL	P02452		Collagen alpha-1(I) chain		COL1A1		-1.53		0.58		2.94e-14		1.59e-13		skeletal system development,blood vessel developme... [More]		extracellular matrix structural constituent,protei... [More]		extracellular region,collagen type I trimer,extrac... [More]		33	46	54	SLSQQIENIRSPEGSR.3\|DRDLEVDTTLK.3\|DRDLEVDTTLK.2\|VLC... [More]
SEN / CTL	P02462		Collagen alpha-1(IV) chain		COL4A1		-1.55		1.61		0.00144		0.00104		patterning of blood vessels,brain development,neur... [More]		extracellular matrix structural constituent,extrac... [More]		extracellular region,collagen type IV trimer,basem... [More]		15	7	11	GTC[CAM]NYYANAYSFWLATIER.3\|FSTMPFLFC[CAM]NINNVC[CA... [More]
SEN / CTL	Q9UNN8		Endothelial protein C receptor		PROCR		-1.57		0.36		1.65e-10		5.93e-10		blood coagulation,negative regulation of coagulati... [More]		receptor activity		extracellular region,centrosome,plasma membrane,in... [More]		15	5	7	TLAFPLTIR.2\|LHMLQISYFR.3\|EFLEDTC[CAM]VQYVQK.2\|TQSG... [More]
SEN / CTL	P61457		Pterin-4-alpha-carbinolamine dehydratase		PCBD1		-1.58		0.32		0.0136		0.00681		transcription, DNA-templated,L-phenylalanine catab... [More]		transcription coactivator activity,phenylalanine 4... [More]		nucleoplasm,cytoplasm,cytosol,extracellular exosom... [More]		3	10	15	LSAEERDQLLPNLR.3\|AFGFMTR.2\|LDHHPEWFNVYNK.4\|LDHHPEW... [More]
SEN / CTL	P02751		Fibronectin		FN1		-1.66		1.04		1.96e-140		5.29e-138		angiogenesis,regulation of protein phosphorylation... [More]		protease binding,integrin binding,protein binding,... [More]		extracellular region,fibrinogen complex,basal lami... [More]		474	126	209	VTWAPPPSIDLTNFLVR.2\|VTWAPPPSIDLTNFLVR.3\|WLPSSSPVTG... [More]
SEN / CTL	Q9BYT8		Neurolysin, mitochondrial		NLN		-1.77		1.2		0.029		0.0128		regulation of gluconeogenesis,proteolysis,peptide ... [More]		metalloendopeptidase activity,peptide binding,meta... [More]		mitochondrial intermembrane space,plasma membrane		9	35	48	LVNTGLLTLR.2\|LKPLGEAEREFILNLK.4\|C[CAM]KEENTIILQQLL... [More]
SEN / CTL	O00160		Unconventional myosin-If		MYO1F		-1.77		0.88		0.0653		0.025		biological_process		motor activity,actin binding,calmodulin binding,AT... [More]		unconventional myosin complex		3	27	32	GFGDLAVLK.2\|GRLHGQEGLFPGNYVEK.4\|GRLHGQEGLFPGNYVEK.... [More]
SEN / CTL	Q12841		Follistatin-related protein 1		FSTL1		-1.81		0.86		3.28e-7		6.14e-7		BMP signaling pathway,response to starvation		calcium ion binding,protein binding,heparin bindin... [More]		extracellular region,extracellular space,extracell... [More]		15	12	12	IIQWLEAEIIPDGWFSK.3\|LSFQEFLK.2\|IC[CAM]ANVFC[CAM]GA... [More]
SEN / CTL	P01033		Metalloproteinase inhibitor 1		TIMP1		-1.84		0.45		5.33e-16		3.79e-15		cell activation,platelet degranulation,aging,posit... [More]		protease binding,cytokine activity,protein binding... [More]		extracellular region,proteinaceous extracellular m... [More]		27	7	11	LQDGLLHITTC[CAM]SFVAPWNSLSLAQR.3\|TYTVGC[CAM]EEC[CA... [More]
SEN / CTL	P22692		Insulin-like growth factor-binding protein 4		IGFBP4		-1.86		0.78		6.31e-8		1.33e-7		skeletal system development,regulation of cell gro... [More]		receptor binding,insulin-like growth factor I bind... [More]		extracellular region,extracellular space		15	3	5	EDARPVPQGSC[CAM]QSELHR.4\|THEDLYIIPIPNC[CAM]DR.3\|TH... [More]
SEN / CTL	P61769		Beta-2-microglobulin		B2M		-1.9		1.53		0.000351		0.000305		retina homeostasis,positive regulation of T cell m... [More]		glycoprotein binding,protein binding,identical pro... [More]		Golgi membrane,extracellular region,extracellular ... [More]		15	7	9	SNFLNC[CAM]YVSGFHPSDIEVDLLK.3\|SNFLNC[CAM]YVSGFHPSD... [More]
SEN / CTL	P05121		Plasminogen activator inhibitor 1		SERPINE1		-1.92		1.85		0.000425		0.000359		chronological cell aging,angiogenesis,platelet deg... [More]		protease binding,serine-type endopeptidase inhibit... [More]		extracellular region,extracellular space,plasma me... [More]		21	9	10	MAPEEIIMDRPFLFVVR.3\|HNPTGTVLFMGQVMEP.2\|QFQADFTSLSD... [More]
SEN / CTL	P01023		Alpha-2-macroglobulin		A2M		-1.92		1.55		0.0937		0.0338		negative regulation of complement activation, lect... [More]		protease binding,serine-type endopeptidase inhibit... [More]		extracellular region,cytosol,platelet alpha granul... [More]		18	89	144	ATVLNYLPK.2\|QTVSWAVTPK.2\|MVSGFIPLKPTVK.3\|M[Oxi]VSG... [More]
SEN / CTL	P41222		Prostaglandin-H2 D-isomerase		PTGDS		-1.94		0.06		0.000274		0.000244		prostaglandin biosynthetic process,transport,cyclo... [More]		prostaglandin-D synthase activity,transporter acti... [More]		extracellular region,extracellular space,endoplasm... [More]		3	2	4	TMLLQPAGSLGSYSYR.2\|TM[Oxi]LLQPAGSLGSYSYR.2\|AQGFTED... [More]
SEN / CTL	P02768		Serum albumin		ALB		-2.04		1.07		1.53e-42		8.26e-41		retina homeostasis,platelet degranulation,transpor... [More]		DNA binding,fatty acid binding,copper ion binding,... [More]		extracellular region,extracellular space,nucleus,e... [More]		201	107	232	KVPQVSTPTLVEVSR.3\|KVPQVSTPTLVEVSR.2\|KVPQVSTPTLVEVS... [More]
SEN / CTL	Q8IUX7		Adipocyte enhancer-binding protein 1		AEBP1		-2.05		2.39		0.0245		0.0112		negative regulation of transcription from RNA poly... [More]		RNA polymerase II regulatory region sequence-speci... [More]		extracellular space,nucleus,cytoplasm,extracellula... [More]		15	9	11	YLSPDATVSTEVR.2\|YTAGIHGNEVLGR.3\|YTAGIHGNEVLGR.2\|VV... [More]
SEN / CTL	P14780		Matrix metalloproteinase-9		MMP9		-2.07		0.79		1.41e-14		7.93e-14		skeletal system development,ossification,positive ... [More]		endopeptidase activity,metalloendopeptidase activi... [More]		extracellular region,proteinaceous extracellular m... [More]		30	30	40	SLGPALLLLQK.2\|AFALWSAVTPLTFTR.2\|AFALWSAVTPLTFTR.3\|... [More]
SEN / CTL	P54710		Sodium/potassium-transporting ATPase subunit gamma		FXYD2		-2.07		1.16		0.0194		0.00914		regulation of cell growth,transport,establishment ... [More]		transporter activity,ion channel activity,sodium:p... [More]		plasma membrane,sodium:potassium-exchanging ATPase... [More]		6	2	3	GDVDPFYYDYETVR.2\|TGLSMDGGGSPK.2\|TGLSM[Oxi]DGGGSPK.... [More]
SEN / CTL	P09486		SPARC		SPARC		-2.15		0.6		5.19e-23		7.78e-22		ossification,negative regulation of endothelial ce... [More]		calcium ion binding,protein binding,collagen bindi... [More]		extracellular region,basement membrane,extracellul... [More]		42	14	22	YIPPC[CAM]LDSELTEFPLR.3\|YIPPC[CAM]LDSELTEFPLR.2\|FF... [More]
SEN / CTL	P02787		Serotransferrin		TF		-2.26		1.19		1.14e-53		1.03e-51		retina homeostasis,platelet degranulation,cellular... [More]		protein binding,ferrous iron binding,ferric iron b... [More]		extracellular region,extracellular space,early end... [More]		240	86	160	SASDLTWDNLK.2\|SVIPSDGPSVAC[CAM]VK.2\|LKC[CAM]DEWSVN... [More]
SEN / CTL	P02788		Lactotransferrin		LTF		-2.5		1.1		0.00237		0.00159		ossification,regulation of cytokine production,ret... [More]		DNA binding,serine-type endopeptidase activity,iro... [More]		extracellular region,extracellular space,nucleus,c... [More]		9	76	117	C[CAM]GLVPVLAENYK.2\|YYGYTGAFR.2\|C[CAM]LAENAGDVAFVK... [More]
SEN / CTL	P30530		Tyrosine-protein kinase receptor UFO		AXL		-2.52		0.43		0.0135		0.00679		neuron migration,natural killer cell differentiati... [More]		virus receptor activity,phosphatidylserine binding... [More]		extracellular space,intracellular,plasma membrane,... [More]		3	9	10	APLQGTLLGYR.2\|HGDLHSFLLYSR.3\|HGDLHSFLLYSR.2\|YGEVFE... [More]
SEN / CTL	Q99969		Retinoic acid receptor responder protein 2		RARRES2		-2.67		0.44		7.63e-8		1.56e-7		retinoid metabolic process,in utero embryonic deve... [More]		receptor binding,protein binding		extracellular region,extracellular matrix,platelet... [More]		9	4	5	GLQVALEEFHK.3\|LVHC[CAM]PIETQVLR.3\|LVHC[CAM]PIETQVL... [More]
SEN / CTL	P20742		Pregnancy zone protein		PZP		-2.69		0.99		0.075		0.0281		female pregnancy,negative regulation of endopeptid... [More]		endopeptidase inhibitor activity,serine-type endop... [More]		extracellular region,extracellular exosome,blood m... [More]		3	23	26	DLFHC[CAM]VSFTLPR.3\|DLFHC[CAM]VSFTLPR.2\|SGTHTLPVES... [More]
SEN / CTL	P01009		Alpha-1-antitrypsin		SERPINA1		-2.93		1.4		1.82e-30		4.9e-29		platelet degranulation,ER to Golgi vesicle-mediate... [More]		glycoprotein binding,protease binding,serine-type ... [More]		Golgi membrane,extracellular region,proteinaceous ... [More]		105	44	85	LSITGTYDLK.2\|ITPNLAEFAFSLYR.2\|ITPNLAEFAFSLYR.3\|SVL... [More]
Reference: SenQuest