| Comparison | UniProtIds | Protein Description | Genes | Log2 Ratio | Std. Dev. | PValue | QValue | GO Biological Process | GO Molecular Process | GO Cellular Process | Ratios | Unique Peptides | Elution Groups | Elution Group | ||||||||||||||
| SEN / CTL |
P09341 P19875 P19876 |
Growth-regulated alpha protein;C-X-C motif chemokine 2;C-X-C motif chemokine 3 |
CXCL1 CXCL2 CXCL3 |
4.6 | 1.28 | 0.0179 | 0.00467 |
chemotaxis,inflammatory response,immune response,s... [More] |
receptor binding,chemokine activity,enzyme activat... [More] |
extracellular region,extracellular space,intracell... [More] |
3 | 1 | 2 | SPGPHC[CAM]AQTEVIATLK.3|SPGPHC[CAM]AQTEVIATLK.2 | ||||||||||||||
| SEN / CTL | Q8NBJ7 | Sulfatase-modifying factor 2 | SUMF2 | 4.33 | 0.81 | 0.012 | 0.00329 | post-translational protein modification | metal ion binding | endoplasmic reticulum,endoplasmic reticulum lumen | 3 | 14 | 22 |
SVLWWLPVEK.2|LEHPVLHVSWNDAR.4|LEHPVLHVSWNDAR.3|LEH... [More] |
||||||||||||||
| SEN / CTL | P01889 | HLA class I histocompatibility antigen, B-7 alpha chain | HLA-B | 4.13 | 1 | 0.0159 | 0.00418 | 3 | 4 | 4 |
AYLEGEC[CAM]VEWLR.2|RAYLEGEC[CAM]VEWLR.3|GHDQYAYDG... [More] |
|||||||||||||||||
| SEN / CTL | Q9Y287 | Integral membrane protein 2B | ITM2B | 3.98 | 0.51 | 0.00584 | 0.00173 |
nervous system development,negative regulation of ... [More] |
beta-amyloid binding,protein binding,ATP binding |
Golgi membrane,extracellular region,extracellular ... [More] |
3 | 6 | 6 |
NLLELLINIK.2|FAVETLIC[CAM]S.2|VTFNSALAQK.2|IENIDHL... [More] |
||||||||||||||
| SEN / CTL | P26022 | Pentraxin-related protein PTX3 | PTX3 | 3.77 | 1.12 | 5.33e-9 | 4.71e-9 |
response to yeast,inflammatory response,opsonizati... [More] |
complement component C1q binding,(1->3)-beta-D-glu... [More] |
extracellular region,extracellular space | 15 | 7 | 7 |
LTSALDELLQATR.2|ALAAVLEELR.2|SWLPAGC[CAM]ETAILFPMR... [More] |
||||||||||||||
| SEN / CTL | P03956 | Interstitial collagenase | MMP1 | 3.72 | 1.13 | 3.1e-8 | 2.43e-8 |
proteolysis,viral process,extracellular matrix dis... [More] |
endopeptidase activity,metalloendopeptidase activi... [More] |
extracellular region,proteinaceous extracellular m... [More] |
12 | 6 | 6 |
AFQLWSNVTPLTFTK.2|DGFFYFFHGTR.3|SQNPVQPIGPQTPK.2|T... [More] |
||||||||||||||
| SEN / CTL | P17096 | High mobility group protein HMG-I/HMG-Y | HMGA1 | 3.59 | 1.1 | 0.0235 | 0.00595 |
DNA unwinding involved in DNA replication,nucleoso... [More] |
transcriptional activator activity, RNA polymerase... [More] |
nucleus,nucleoplasm,transcription factor complex,c... [More] |
3 | 9 | 13 |
KQPPVSPGTALVGSQKEPSEVPTPK.4|KQPPVSPGTALVGSQKEPSEVP... [More] |
||||||||||||||
| SEN / CTL | Q6UVY6 | DBH-like monooxygenase protein 1 | MOXD1 | 3.48 | 1.94 | 0.0697 | 0.0157 | oxidation-reduction process |
copper ion binding,protein binding,oxidoreductase ... [More] |
endoplasmic reticulum membrane,integral component ... [More] |
3 | 2 | 2 | LVLSLPVNVR.2|ELHTC[CAM]DINDK.2 | ||||||||||||||
| SEN / CTL | P02765 | Alpha-2-HS-glycoprotein | AHSG | 3.32 | 3.73 | 0.0383 | 0.0093 |
skeletal system development,ossification,platelet ... [More] |
endopeptidase inhibitor activity,cysteine-type end... [More] |
extracellular region,extracellular space,extracell... [More] |
9 | 15 | 28 |
C[CAM]NLLAEK.2|C[CAM]DSSPDSAEDVR.2|C[CAM]DSSPDSAED... [More] |
||||||||||||||
| SEN / CTL | P78417 | Glutathione S-transferase omega-1 | GSTO1 | 3.25 | 1.38 | 0.0000576 | 0.0000281 |
glutathione metabolic process,regulation of releas... [More] |
glutathione transferase activity,oxidoreductase ac... [More] |
cytoplasm,cytosol,extracellular exosome | 9 | 28 | 41 |
VPSLVGSFIR.2|MILELFSK.2|M[Oxi]ILELFSK.2|GIRHEVININ... [More] |
||||||||||||||
| SEN / CTL | Q15904 | V-type proton ATPase subunit S1 | ATP6AP1 | 3.16 | 1.16 | 0.0299 | 0.00746 |
insulin receptor signaling pathway,ATP hydrolysis ... [More] |
transporter activity,ATP binding,Rab GTPase bindin... [More] |
endosome membrane,integral component of membrane,p... [More] |
3 | 9 | 11 |
LGASPLHVDLATLR.3|LGASPLHVDLATLR.2|DVAVVAGGLGR.2|LF... [More] |
||||||||||||||
| SEN / CTL | Q99988 | Growth/differentiation factor 15 | GDF15 | 3.08 | 0.59 | 0.00953 | 0.00266 |
signal transduction,transforming growth factor bet... [More] |
cytokine activity,transforming growth factor beta ... [More] |
extracellular region,extracellular space,nucleus,c... [More] |
3 | 7 | 7 |
ASLEDLGWADWVLSPR.2|ASFPGPSELHSEDSR.3|RYEDLLTR.2|AA... [More] |
||||||||||||||
| SEN / CTL | P04156 | Major prion protein | PRNP | 2.97 | 1.37 | 0.0423 | 0.0101 |
negative regulation of protein phosphorylation,cel... [More] |
copper ion binding,lamin binding,microtubule bindi... [More] |
nucleus,cytoplasm,endoplasmic reticulum,Golgi appa... [More] |
3 | 4 | 5 |
VVEQMC[CAM]ITQYER.2|VVEQM[Oxi]C[CAM]ITQYER.2|PIIHF... [More] |
||||||||||||||
| SEN / CTL | P20962 | Parathymosin | PTMS | 2.94 | 1.39 | 0.0535 | 0.0126 | immune system process,DNA replication | zinc ion binding | nucleus,cytosol | 3 | 5 | 8 |
SVEAAAELSAK.2|AAEEEDEADPKR.3|AAEEEDEADPKR.2|RAAEEE... [More] |
||||||||||||||
| SEN / CTL | Q06323 | Proteasome activator complex subunit 1 | PSME1 | 2.94 | 1.76 | 0.0589 | 0.0136 |
MAPK cascade,protein polyubiquitination,stimulator... [More] |
endopeptidase activator activity |
proteasome complex,nucleoplasm,cytoplasm,cytosol,p... [More] |
3 | 26 | 39 |
NAYAVLYDIILK.2|NAYAVLYDIILK.3|IVVLLQR.2|VFELMTSLHT... [More] |
||||||||||||||
| SEN / CTL | P30048 | Thioredoxin-dependent peroxide reductase, mitochondrial | PRDX3 | 2.92 | 1.48 | 0.0593 | 0.0136 |
response to reactive oxygen species,maternal place... [More] |
protein binding,protein C-terminus binding,thiored... [More] |
cytoplasm,mitochondrion,mitochondrial matrix,early... [More] |
3 | 19 | 41 |
GLFIIDPNGVIK.2|HLSVNDLPVGR.3|HLSVNDLPVGR.2|SVEETLR... [More] |
||||||||||||||
| SEN / CTL | P07585 | Decorin | DCN | 2.9 | 1.29 | 1.14e-19 | 3.93e-19 |
kidney development,placenta development,negative r... [More] |
protein kinase inhibitor activity,protein binding,... [More] |
extracellular region,collagen type VI trimer,extra... [More] |
45 | 22 | 33 |
VSPGAFTPLVKLER.3|ASYSGVSLFSNPVQYWEIQPSTFR.3|KVTFNG... [More] |
||||||||||||||
| SEN / CTL | P04632 | Calpain small subunit 1 | CAPNS1 | 2.71 | 0.33 | 0.00589 | 0.00173 |
proteolysis,positive regulation of cell proliferat... [More] |
calcium-dependent cysteine-type endopeptidase acti... [More] |
cytosol,plasma membrane,membrane,extracellular exo... [More] |
3 | 18 | 39 |
THYSNIEANESEEVR.3|THYSNIEANESEEVR.2|LGFEEFK.2|VVTR... [More] |
||||||||||||||
| SEN / CTL | Q9UHL4 | Dipeptidyl peptidase 2 | DPP7 | 2.71 | 2.36 | 0.234 | 0.0476 | proteolysis |
serine-type carboxypeptidase activity,serine-type ... [More] |
lysosome,Golgi apparatus,cytosol,cytoplasmic, memb... [More] |
3 | 18 | 27 |
GHTELLTVEQALADFAELLR.3|KLEATIIGEWVK.3|KLEATIIGEWVK... [More] |
||||||||||||||
| SEN / CTL | Q9UNW1 | Multiple inositol polyphosphate phosphatase 1 | MINPP1 | 2.63 | 0.66 | 0.0000716 | 0.000034 |
ossification,polyphosphate metabolic process,depho... [More] |
acid phosphatase activity,phosphohistidine phospha... [More] |
endoplasmic reticulum,endoplasmic reticulum lumen,... [More] |
6 | 12 | 13 |
LASLFPALFSR.2|SGLIVPYASNLIFVLYHC[CAM]ENAK.3|DKEPLT... [More] |
||||||||||||||
| SEN / CTL | P01033 | Metalloproteinase inhibitor 1 | TIMP1 | 2.62 | 1.29 | 5e-15 | 9.5e-15 |
cell activation,platelet degranulation,aging,posit... [More] |
protease binding,cytokine activity,protein binding... [More] |
extracellular region,proteinaceous extracellular m... [More] |
33 | 7 | 11 |
TYTVGC[CAM]EEC[CAM]TVFPC[CAM]LSIPC[CAM]K.3|LQDGLLH... [More] |
||||||||||||||
| SEN / CTL | Q08629 | Testican-1 | SPOCK1 | 2.62 | 0.17 | 0.00147 | 0.000501 |
regulation of cell growth,neuron migration,cell ad... [More] |
serine-type endopeptidase inhibitor activity,cyste... [More] |
proteinaceous extracellular matrix,extracellular s... [More] |
3 | 2 | 2 | SLLGAFIPR.2|ATQC[CAM]HGSTGQC[CAM]WC[CAM]VDK.3 | ||||||||||||||
| SEN / CTL | Q9Y646 | Carboxypeptidase Q | CPQ | 2.54 | 0.82 | 0.000366 | 0.000148 |
proteolysis,thyroid hormone generation,tissue rege... [More] |
carboxypeptidase activity,protein homodimerization... [More] |
extracellular space,cytoplasm,lysosome,endoplasmic... [More] |
6 | 10 | 10 |
LALLVDTVGPR.2|AIINLAVYGK.2|VHLEPVRIPHWER.4|VGALASL... [More] |
||||||||||||||
| SEN / CTL | P39059 | Collagen alpha-1(XV) chain | COL15A1 | 2.52 | 1.37 | 7.05e-8 | 5.1e-8 |
angiogenesis,cell adhesion,signal transduction,cel... [More] |
extracellular matrix structural constituent |
extracellular region,collagen type XV trimer,extra... [More] |
18 | 14 | 24 |
NLVTAFSNMDDMLQK.2|AFLSSHLQDLSTIVR.3|AFLSSHLQDLSTIV... [More] |
||||||||||||||
| SEN / CTL | P23284 | Peptidyl-prolyl cis-trans isomerase B | PPIB | 2.5 | 1.54 | 0.00000254 | 0.00000148 |
protein peptidyl-prolyl isomerization,positive reg... [More] |
peptidyl-prolyl cis-trans isomerase activity,prote... [More] |
nucleus,endoplasmic reticulum,endoplasmic reticulu... [More] |
15 | 28 | 56 |
TVDNFVALATGEK.2|TVDNFVALATGEK.3|VLEGMEVVR.2|VLEGM[... [More] |
||||||||||||||
| SEN / CTL | P52823 | Stanniocalcin-1 | STC1 | 2.49 | 0.27 | 0.00386 | 0.00118 |
ossification,endothelial cell morphogenesis,growth... [More] |
hormone activity |
extracellular space,nucleus,cytoplasm,apical plasm... [More] |
3 | 2 | 3 |
RNPEAITEVVQLPNHFSNR.3|IGPNMASLFHILQTDHC[CAM]AQTHPR... [More] |
||||||||||||||
| SEN / CTL | P07858 | Cathepsin B | CTSB | 2.47 | 1.67 | 5.55e-13 | 8.79e-13 |
toll-like receptor signaling pathway,proteolysis,c... [More] |
cysteine-type endopeptidase activity,serine-type e... [More] |
extracellular region,extracellular space,intracell... [More] |
51 | 22 | 46 |
VMFTEDLKLPASFDAR.3|EQWPQC[CAM]PTIK.2|GQDHC[CAM]GIE... [More] |
||||||||||||||
| SEN / CTL | P24821 | Tenascin | TNC | 2.46 | 1.4 | 1.5e-22 | 7.62e-22 |
osteoblast differentiation,cell adhesion,negative ... [More] |
syndecan binding |
extracellular region,basement membrane,interstitia... [More] |
63 | 77 | 105 |
TAHISGLPPSTDFIVYLSGLAPSIR.3|TAHISGLPPSTDFIVYLSGLAP... [More] |
||||||||||||||
| SEN / CTL | P09429 | High mobility group protein B1 | HMGB1 | 2.46 | 0.87 | 0.0333 | 0.00821 |
negative regulation of transcription from RNA poly... [More] |
four-way junction DNA binding,bubble DNA binding,l... [More] |
condensed chromosome,extracellular region,extracel... [More] |
3 | 26 | 57 |
RPPSAFFLFC[CAM]SEYRPK.3|RPPSAFFLFC[CAM]SEYRPK.4|RP... [More] |
||||||||||||||
| SEN / CTL | Q14766 | Latent-transforming growth factor beta-binding protein 1 | LTBP1 | 2.43 | 1.51 | 9.2e-7 | 5.55e-7 |
ventricular septum development,transmembrane recep... [More] |
transforming growth factor beta-activated receptor... [More] |
microfibril,extracellular region,proteinaceous ext... [More] |
18 | 35 | 44 |
VQEGYTC[CAM]DC[CAM]FDGYHLDTAK.3|MTC[CAM]VDVNEC[CAM... [More] |
||||||||||||||
| SEN / CTL | P10619 | Lysosomal protective protein | CTSA | 2.41 | 1.89 | 0.0109 | 0.003 |
proteolysis,glycosphingolipid metabolic process,in... [More] |
carboxypeptidase activity,serine-type carboxypepti... [More] |
nucleoplasm,lysosome,endoplasmic reticulum,membran... [More] |
6 | 15 | 29 |
C[CAM]NFYDNKDLEC[CAM]VTNLQEVAR.3|GAGHMVPTDKPLAAFTM... [More] |
||||||||||||||
| SEN / CTL | P07339 | Cathepsin D | CTSD | 2.39 | 1.33 | 1.42e-9 | 1.34e-9 |
proteolysis,autophagy,antigen processing and prese... [More] |
aspartic-type endopeptidase activity,cysteine-type... [More] |
extracellular region,extracellular space,lysosome,... [More] |
24 | 30 | 62 |
FDGILGMAYPR.2|FDGILGM[Oxi]AYPR.2|QVFGEATKQPGITFIAA... [More] |
||||||||||||||
| SEN / CTL | P40261 | Nicotinamide N-methyltransferase | NNMT | 2.37 | 0.9 | 0.000598 | 0.000229 |
response to organonitrogen compound,animal organ r... [More] |
nicotinamide N-methyltransferase activity,pyridine... [More] |
cytosol | 6 | 13 | 20 |
NLGSLLKPGGFLVIMDALK.3|NLGSLLKPGGFLVIM[Oxi]DALK.3|N... [More] |
||||||||||||||
| SEN / CTL | Q15149 | Plectin | PLEC | 2.35 | 1.93 | 5.4e-22 | 2.41e-21 | hemidesmosome assembly,cell-cell adhesion |
actin binding,protein binding,structural constitue... [More] |
cytoplasm,cytosol,plasma membrane,brush border,cel... [More] |
117 | 489 | 728 |
VLADPSDDTKGFFDPNTHENLTYR.4|IISLETYNLLR.2|SQVEEELFS... [More] |
||||||||||||||
| SEN / CTL | Q7Z304 | MAM domain-containing protein 2 | MAMDC2 | 2.33 | 0.37 | 0.00776 | 0.00219 |
proteinaceous extracellular matrix,endoplasmic ret... [More] |
3 | 1 | 1 | AGDHTTGLGYYLLANTK.3 | ||||||||||||||||
| SEN / CTL | Q13443 | Disintegrin and metalloproteinase domain-containing protein 9 | ADAM9 | 2.33 | 1.23 | 0.0603 | 0.0138 |
activation of MAPKK activity,membrane protein ecto... [More] |
metalloendopeptidase activity,protein kinase C bin... [More] |
extracellular space,focal adhesion,cell surface,in... [More] |
3 | 22 | 24 |
QVSYVIQAEGK.2|EGTLITDHPNIQNHC[CAM]HYR.5|EGTLITDHPN... [More] |
||||||||||||||
| SEN / CTL | P53621 | Coatomer subunit alpha | COPA | 2.3 | 0.67 | 0.00000113 | 6.78e-7 |
intracellular protein transport,ER to Golgi vesicl... [More] |
hormone activity,structural molecule activity |
Golgi membrane,extracellular space,cytoplasm,endop... [More] |
9 | 92 | 167 |
VTTVTEIGKDVIGLR.3|VTTVTEIGKDVIGLR.2|TLDLPIYVTR.2|L... [More] |
||||||||||||||
| SEN / CTL |
O60814 P06899 P23527 P33778 P57053 P58876 P62807 Q16778 Q5QNW6 Q8N257 Q93079 Q99877 Q99879 Q99880 |
Histone H2B type 1-K;Histone H2B type 1-J;Histone H2B type 1-O;Histone H2B type 1-B;Histone H2B type F-S;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 2-E;Histone H2B type 2-F;Histone H2B type 3-B;Histone H2B type 1-H;Histone H2B type 1-N;Histone H2B type 1-M;Histone H2B type 1-L |
HIST1H2BK HIST1H2BJ HIST1H2BO HIST1H2BB H2BFS HIST1H2BD HIST1H2BC HIST2H2BE HIST2H2BF HIST3H2BB HIST1H2BH HIST1H2BN HIST1H2BM HIST1H2BL |
2.3 | 0.56 | 0.0153 | 0.00405 |
innate immune response in mucosa,nucleosome assemb... [More] |
molecular_function,DNA binding,protein heterodimer... [More] |
nuclear nucleosome,extracellular space,nucleus,nuc... [More] |
3 | 1 | 8 |
AMGIMNSFVNDIFER.2|AM[Oxi]GIMNSFVNDIFER.3|AMGIM[Oxi... [More] |
||||||||||||||
| SEN / CTL | Q96AY3 | Peptidyl-prolyl cis-trans isomerase FKBP10 | FKBP10 | 2.28 | 1.06 | 0.00000836 | 0.00000454 |
protein peptidyl-prolyl isomerization,chaperone-me... [More] |
peptidyl-prolyl cis-trans isomerase activity,calci... [More] |
endoplasmic reticulum lumen,endoplasmic reticulum ... [More] |
12 | 34 | 53 |
IIIPPFLAYGEK.2|GMDQGLLGMC[CAM]PGER.2|GM[Oxi]DQGLLG... [More] |
||||||||||||||
| SEN / CTL | P22392 | Nucleoside diphosphate kinase B | NME2 | 2.28 | 0.67 | 0.000179 | 0.0000792 |
negative regulation of myeloid leukocyte different... [More] |
DNA binding,transcription factor activity, sequenc... [More] |
ruffle,nucleus,cytoplasm,cytosol,intermediate fila... [More] |
6 | 19 | 36 |
SAEKEISLWFKPEELVDYK.4|SAEKEISLWFKPEELVDYK.3|SAEKEI... [More] |
||||||||||||||
| SEN / CTL | Q15113 | Procollagen C-endopeptidase enhancer 1 | PCOLCE | 2.26 | 1.64 | 0.000396 | 0.000158 |
proteolysis,multicellular organism development,pos... [More] |
protein binding,collagen binding,heparin binding,p... [More] |
extracellular space,extracellular exosome,extracel... [More] |
9 | 9 | 10 |
YDALEVFAGSGTSGQR.2|TGGLDLPSPPTGASLK.2|FDLEPDTYC[CA... [More] |
||||||||||||||
| SEN / CTL | O60506 | Heterogeneous nuclear ribonucleoprotein Q | SYNCRIP | 2.24 | 0.51 | 0.0136 | 0.00367 |
mRNA splicing, via spliceosome,osteoblast differen... [More] |
nucleotide binding,RNA binding,poly(A) binding,pol... [More] |
nucleus,nucleoplasm,endoplasmic reticulum,membrane... [More] |
3 | 48 | 77 |
LMMDPLTGLNR.2|LM[Oxi]MDPLTGLNR.2|LMM[Oxi]DPLTGLNR.... [More] |
||||||||||||||
| SEN / CTL | Q7Z7M9 | Polypeptide N-acetylgalactosaminyltransferase 5 | GALNT5 | 2.24 | 1.52 | 0.0585 | 0.0135 |
glycosaminoglycan biosynthetic process,O-glycan pr... [More] |
polypeptide N-acetylgalactosaminyltransferase acti... [More] |
Golgi membrane,cellular_component,integral compone... [More] |
3 | 4 | 4 |
C[CAM]PVMAGGLFSIDK.2|VEVDLDQTQR.2|EILLVDDFSTK.2|EG... [More] |
||||||||||||||
| SEN / CTL | O00391 | Sulfhydryl oxidase 1 | QSOX1 | 2.23 | 1.07 | 4.34e-24 | 2.75e-23 |
platelet degranulation,negative regulation of macr... [More] |
protein disulfide isomerase activity,flavin-linked... [More] |
extracellular region,extracellular space,Golgi app... [More] |
60 | 23 | 29 |
KFGVTDFPSC[CAM]YLLFR.3|SFYTAYLQR.2|SALYSPSDPLTLLQA... [More] |
||||||||||||||
| SEN / CTL | P62310 | U6 snRNA-associated Sm-like protein LSm3 | LSM3 | 2.23 | 1.76 | 0.105 | 0.0229 |
mRNA splicing, via spliceosome,mRNA processing,cyt... [More] |
RNA binding,protein binding,poly(A) RNA binding |
cytoplasmic mRNA processing body,nucleus,nucleopla... [More] |
3 | 4 | 4 |
GDGVVLVAPPLRVG.2|NIPMLFVR.2|RNIPMLFVR.2|GDGVVLVAPP... [More] |
||||||||||||||
| SEN / CTL | P49721 | Proteasome subunit beta type-2 | PSMB2 | 2.22 | 0.49 | 0.0111 | 0.00305 |
MAPK cascade,protein polyubiquitination,stimulator... [More] |
threonine-type endopeptidase activity |
proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More] |
3 | 21 | 33 |
FILNLPTFSVR.2|AVELLRK.2|VAASNIVQMKDDHDK.4|VAASNIVQ... [More] |
||||||||||||||
| SEN / CTL | P17405 | Sphingomyelin phosphodiesterase | SMPD1 | 2.22 | 0.74 | 0.0225 | 0.00572 |
sphingomyelin metabolic process,sphingomyelin cata... [More] |
sphingomyelin phosphodiesterase activity,zinc ion ... [More] |
extracellular space,lysosome,endosome,plasma membr... [More] |
3 | 8 | 10 |
IGGFYALSPYPGLR.2|GHPPSEPC[CAM]GTPC[CAM]R.3|GHPPSEP... [More] |
||||||||||||||
| SEN / CTL | P17931 | Galectin-3 | LGALS3 | 2.2 | 0.84 | 0.00284 | 0.000897 |
monocyte chemotaxis,mRNA processing,RNA splicing,n... [More] |
protein binding,IgE binding,carbohydrate binding,c... [More] |
immunological synapse,extracellular space,nucleus,... [More] |
6 | 12 | 19 |
MLITILGTVKPNANR.3|M[Oxi]LITILGTVKPNANR.3|GNDVAFHFN... [More] |
||||||||||||||
| SEN / CTL | Q16363 | Laminin subunit alpha-4 | LAMA4 | 2.19 | 1.46 | 8.71e-21 | 3.48e-20 |
cell adhesion,regulation of cell adhesion,extracel... [More] |
receptor binding,extracellular matrix structural c... [More] |
extracellular region,basement membrane,basal lamin... [More] |
63 | 42 | 51 |
SLLSDVEELVEKENQASR.3|C[CAM]LDGYIGDSIR.2|ELVDEEADEA... [More] |
||||||||||||||
| SEN / CTL | O43399 | Tumor protein D54 | TPD52L2 | 2.18 | 0.53 | 0.0147 | 0.00391 | poly(A) RNA binding | 3 | 18 | 28 |
TPAVEGLTEAEEEELRAELTKVEEEIVTLR.4|TPAVEGLTEAEEEELRA... [More] |
||||||||||||||||
| SEN / CTL | Q13822 | Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 | ENPP2 | 2.17 | 0.96 | 0.0000784 | 0.0000368 |
phosphate-containing compound metabolic process,re... [More] |
nucleic acid binding,phosphodiesterase I activity,... [More] |
extracellular space,plasma membrane,integral compo... [More] |
9 | 5 | 5 |
WWGGQPLWITATK.2|AGTFFWSVVIPHER.3|TYLHTYESEI.2|YGPF... [More] |
||||||||||||||
| SEN / CTL | Q15582 | Transforming growth factor-beta-induced protein ig-h3 | TGFBI | 2.13 | 1.99 | 3.05e-27 | 2.58e-26 |
angiogenesis,chondrocyte differentiation,cell adhe... [More] |
integrin binding,protein binding,collagen binding,... [More] |
extracellular region,proteinaceous extracellular m... [More] |
105 | 38 | 60 |
EGVYTVFAPTNEAFR.2|GC[CAM]PAALPLSNLYETLGVVGSTTTQLYT... [More] |
||||||||||||||
| SEN / CTL | P61769 | Beta-2-microglobulin | B2M | 2.12 | 1.07 | 0.0000714 | 0.000034 |
retina homeostasis,positive regulation of T cell m... [More] |
glycoprotein binding,protein binding,identical pro... [More] |
Golgi membrane,extracellular region,extracellular ... [More] |
12 | 7 | 9 |
SNFLNC[CAM]YVSGFHPSDIEVDLLK.3|SNFLNC[CAM]YVSGFHPSD... [More] |
||||||||||||||
| SEN / CTL | P15121 | Aldose reductase | AKR1B1 | 2.11 | 0.83 | 0.00142 | 0.000491 |
tissue homeostasis,carbohydrate metabolic process,... [More] |
alditol:NADP+ 1-oxidoreductase activity,aldo-keto ... [More] |
extracellular space,nucleoplasm,cytoplasm,cytosol,... [More] |
6 | 26 | 42 |
VAIDVGYR.2|MPILGLGTWK.2|M[Oxi]PILGLGTWK.2|LLLNNGAK... [More] |
||||||||||||||
| SEN / CTL | P00736 | Complement C1r subcomponent | C1R | 2.1 | 1.41 | 5.1e-13 | 8.24e-13 |
proteolysis,immune response,complement activation,... [More] |
serine-type endopeptidase activity,calcium ion bin... [More] |
extracellular region,extracellular exosome,blood m... [More] |
48 | 25 | 35 |
TLDEFTIIQNLQPQYQFR.3|LVFQQFDLEPSEGC[CAM]FYDYVK.3|Q... [More] |
||||||||||||||
| SEN / CTL | P22692 | Insulin-like growth factor-binding protein 4 | IGFBP4 | 2.1 | 0.92 | 1.55e-7 | 1.04e-7 |
skeletal system development,regulation of cell gro... [More] |
receptor binding,insulin-like growth factor I bind... [More] |
extracellular region,extracellular space | 15 | 3 | 5 |
THEDLYIIPIPNC[CAM]DR.3|THEDLYIIPIPNC[CAM]DR.2|GELD... [More] |
||||||||||||||
| SEN / CTL | P80723 | Brain acid soluble protein 1 | BASP1 | 2.1 | 0.58 | 0.0202 | 0.00516 |
thorax and anterior abdomen determination,gonad de... [More] |
transcription corepressor activity,protein binding... [More] |
nucleus,cytoplasm,cytoskeleton,plasma membrane,nuc... [More] |
3 | 28 | 41 |
AQGPAASAEEPKPVEAPAANSDQTVTVKE.3|AQGPAASAEEPKPVEAPA... [More] |
||||||||||||||
| SEN / CTL | P07237 | Protein disulfide-isomerase | P4HB | 2.09 | 1.13 | 2.47e-17 | 5.88e-17 |
response to reactive oxygen species,peptidyl-proli... [More] |
protein disulfide isomerase activity,integrin bind... [More] |
extracellular region,endoplasmic reticulum,endopla... [More] |
54 | 62 | 113 |
EADDIVNWLK.2|ILEFFGLK.2|LITLEEEMTK.2|LITLEEEM[Oxi]... [More] |
||||||||||||||
| SEN / CTL | P05155 | Plasma protease C1 inhibitor | SERPING1 | 2.09 | 1.29 | 5.86e-11 | 6.95e-11 |
negative regulation of complement activation, lect... [More] |
serine-type endopeptidase inhibitor activity,prote... [More] |
extracellular region,extracellular space,platelet ... [More] |
33 | 19 | 34 |
FQPTLLTLPR.2|LVLLNAIYLSAK.2|IKVTTSQDMLSIMEK.3|LLDS... [More] |
||||||||||||||
| SEN / CTL | P07093 | Glia-derived nexin | SERPINE2 | 2.09 | 1.6 | 2.12e-10 | 2.27e-10 |
blood coagulation,negative regulation of cell prol... [More] |
serine-type endopeptidase inhibitor activity,recep... [More] |
extracellular region,extracellular space,cytosol,e... [More] |
27 | 11 | 14 |
ASAATTAILIAR.2|SYQVPMLAQLSVFR.2|DMIDNLLSPDLIDGVLTR... [More] |
||||||||||||||
| SEN / CTL | Q12907 | Vesicular integral-membrane protein VIP36 | LMAN2 | 2.09 | 2.22 | 0.147 | 0.0311 |
ER to Golgi vesicle-mediated transport,retrograde ... [More] |
glycoprotein binding,mannose binding,carbohydrate ... [More] |
Golgi membrane,extracellular space,endoplasmic ret... [More] |
3 | 21 | 31 |
NLHGDGIALWYTR.3|NLHGDGIALWYTR.2|DRLVPGPVFGSK.3|DRL... [More] |
||||||||||||||
| SEN / CTL | P80303 | Nucleobindin-2 | NUCB2 | 2.08 | 1.3 | 7.85e-8 | 5.63e-8 | DNA binding,calcium ion binding |
extracellular space,nuclear envelope,endoplasmic r... [More] |
21 | 26 | 37 |
LVTLEEFLK.2|LHDVNSDGFLDEQELEALFTK.3|VYDPKNEEDDMVEM... [More] |
|||||||||||||||
| SEN / CTL |
O75828 P16152 |
Carbonyl reductase [NADPH] 3;Carbonyl reductase [NADPH] 1 |
CBR3 CBR1 |
2.08 | 0.12 | 0.00123 | 0.000432 |
phylloquinone catabolic process,cognition,oxidatio... [More] |
3-keto sterol reductase activity,carbonyl reductas... [More] |
extracellular space,nucleoplasm,cytoplasm,cytosol;... [More] |
3 | 1 | 2 | FHQLDIDDLQSIR.3|FHQLDIDDLQSIR.2 | ||||||||||||||
| SEN / CTL | P61604 | 10 kDa heat shock protein, mitochondrial | HSPE1 | 2.07 | 1.21 | 0.00218 | 0.000706 |
osteoblast differentiation,protein folding,activat... [More] |
protein binding,ATP binding,poly(A) RNA binding,me... [More] |
mitochondrion,mitochondrial matrix,membrane,extrac... [More] |
6 | 19 | 27 |
FLPLFDR.2|VLQATVVAVGSGSK.2|VLQATVVAVGSGSK.3|GKGGEI... [More] |
||||||||||||||
| SEN / CTL | P12111 | Collagen alpha-3(VI) chain | COL6A3 | 2.06 | 1.38 | 7.15e-86 | 5.43e-84 |
cell adhesion,muscle organ development,negative re... [More] |
serine-type endopeptidase inhibitor activity |
extracellular region,proteinaceous extracellular m... [More] |
342 | 165 | 233 |
ALILVGLER.2|LSDAGITPLFLTR.2|LLPSFVSSENAFYLSPDIR.3|... [More] |
||||||||||||||
| SEN / CTL | P09871 | Complement C1s subcomponent | C1S | 2.06 | 1.32 | 7.03e-14 | 1.24e-13 |
proteolysis,complement activation,complement activ... [More] |
serine-type endopeptidase activity,calcium ion bin... [More] |
extracellular region,extracellular exosome,blood m... [More] |
48 | 26 | 38 |
TNFDNDIALVR.2|MGPTVSPIC[CAM]LPGTSSDYNLMDGDLGLISGWG... [More] |
||||||||||||||
| SEN / CTL | Q15084 | Protein disulfide-isomerase A6 | PDIA6 | 2.06 | 1.35 | 5.06e-11 | 6.31e-11 |
protein folding,response to endoplasmic reticulum ... [More] |
protein disulfide isomerase activity,protein bindi... [More] |
endoplasmic reticulum,endoplasmic reticulum lumen,... [More] |
27 | 32 | 56 |
TGEAIVDAALSALR.2|TGEAIVDAALSALR.3|ALDLFSDNAPPPELLE... [More] |
||||||||||||||
| SEN / CTL | Q9Y2E5 | Epididymis-specific alpha-mannosidase | MAN2B2 | 2.06 | 1.36 | 0.000916 | 0.000336 |
mannose metabolic process,protein deglycosylation,... [More] |
alpha-mannosidase activity,zinc ion binding,mannan... [More] |
lysosomal lumen,extracellular exosome | 9 | 15 | 22 |
FIAVEQEFFR.2|GHLDPTWALQQLQQLR.3|GHLDPTWALQQLQQLR.2... [More] |
||||||||||||||
| SEN / CTL | P15586 | N-acetylglucosamine-6-sulfatase | GNS | 2.06 | 0.12 | 0.00109 | 0.000387 |
glycosaminoglycan catabolic process,keratan sulfat... [More] |
N-acetylglucosamine-6-sulfatase activity,sulfuric ... [More] |
lysosomal lumen,extracellular exosome | 3 | 18 | 33 |
IQEPNTFPAILR.2|RQLYEFDIK.3|RQLYEFDIK.2|TIDPELLGK.2... [More] |
||||||||||||||
| SEN / CTL | P00558 | Phosphoglycerate kinase 1 | PGK1 | 2.05 | 1.11 | 4.83e-23 | 2.62e-22 |
gluconeogenesis,phosphorylation,epithelial cell di... [More] |
phosphoglycerate kinase activity,ATP binding |
cytosol,membrane,membrane raft,extracellular exoso... [More] |
66 | 59 | 126 |
AC[CAM]ANPAAGSVILLENLR.2|AC[CAM]ANPAAGSVILLENLR.3|... [More] |
||||||||||||||
| SEN / CTL | P14550 | Alcohol dehydrogenase [NADP(+)] | AKR1A1 | 2.05 | 0.9 | 0.00193 | 0.000633 |
glucose metabolic process,cellular aldehyde metabo... [More] |
alditol:NADP+ 1-oxidoreductase activity,aldo-keto ... [More] |
extracellular space,cytosol,apical plasma membrane... [More] |
6 | 26 | 45 |
MPLIGLGTWK.2|M[Oxi]PLIGLGTWK.2|GLEVTAYSPLGSSDR.2|G... [More] |
||||||||||||||
| SEN / CTL | Q16610 | Extracellular matrix protein 1 | ECM1 | 2.04 | 0.99 | 1.04e-16 | 2.32e-16 |
ossification,angiogenesis,positive regulation of e... [More] |
protease binding,signal transducer activity,interl... [More] |
extracellular region,proteinaceous extracellular m... [More] |
42 | 22 | 28 |
ELLALIQLER.2|RAPYPNYDRDILTIDIGR.4|LVWEEAMSR.2|AC[C... [More] |
||||||||||||||
| SEN / CTL | P30044 | Peroxiredoxin-5, mitochondrial | PRDX5 | 2.04 | 0.72 | 0.000685 | 0.000259 |
response to reactive oxygen species,apoptotic proc... [More] |
RNA polymerase III regulatory region DNA binding,p... [More] |
extracellular space,nucleus,cytoplasm,mitochondrio... [More] |
6 | 19 | 35 |
FSMVVQDGIVK.2|FSM[Oxi]VVQDGIVK.2|THLPGFVEQAEALK.3|... [More] |
||||||||||||||
| SEN / CTL | P06576 | ATP synthase subunit beta, mitochondrial | ATP5B | 2.03 | 1.3 | 9.19e-8 | 6.52e-8 |
angiogenesis,osteoblast differentiation,generation... [More] |
transporter activity,protein binding,ATP binding,t... [More] |
nucleus,mitochondrion,mitochondrial proton-transpo... [More] |
21 | 47 | 115 |
AHGGYSVFAGVGER.3|AHGGYSVFAGVGER.2|IGLFGGAGVGK.2|FT... [More] |
||||||||||||||
| SEN / CTL | P12109 | Collagen alpha-1(VI) chain | COL6A1 | 2.01 | 1.35 | 1.27e-16 | 2.77e-16 |
osteoblast differentiation,cell adhesion,extracell... [More] |
platelet-derived growth factor binding |
extracellular region,collagen type VI trimer,lysos... [More] |
63 | 49 | 69 |
LLLFSDGNSQGATPAAIEK.2|LLLFSDGNSQGATPAAIEK.3|IALVIT... [More] |
||||||||||||||
| SEN / CTL | P68104 | Elongation factor 1-alpha 1 | EEF1A1 | 2 | 1.49 | 9.16e-11 | 1.02e-10 |
transcription, DNA-templated,regulation of transcr... [More] |
tRNA binding,translation elongation factor activit... [More] |
extracellular space,nucleus,nucleolus,cytoplasm,cy... [More] |
42 | 52 | 144 |
EHALLAYTLGVK.3|EHALLAYTLGVK.2|IGGIGTVPVGR.2|YYVTII... [More] |
||||||||||||||
| SEN / CTL | P55058 | Phospholipid transfer protein | PLTP | 2 | 2.42 | 0.00251 | 0.0008 |
lipid metabolic process,lipid transport,vitamin E ... [More] |
lipid binding | extracellular region,extracellular space | 12 | 6 | 7 |
FLEQELETITIPDLR.2|FLEQELETITIPDLR.3|GVQIPLPEGINFVH... [More] |
||||||||||||||
| SEN / CTL | P11047 | Laminin subunit gamma-1 | LAMC1 | 1.99 | 0.9 | 1.51e-35 | 1.86e-34 |
protein complex assembly,cell adhesion,endoderm de... [More] |
extracellular matrix structural constituent |
extracellular region,basement membrane,laminin-1 c... [More] |
81 | 77 | 97 |
SQEC[CAM]YFDPELYR.2|TREDGPWIPYQYYSGSC[CAM]ENTYSK.3... [More] |
||||||||||||||
| SEN / CTL | P51884 | Lumican | LUM | 1.99 | 1.42 | 1.4e-23 | 8.21e-23 |
visual perception,response to organic cyclic compo... [More] |
extracellular matrix structural constituent,collag... [More] |
extracellular region,proteinaceous extracellular m... [More] |
69 | 21 | 29 |
SLEYLDLSFNQIAR.2|SLEYLDLSFNQIAR.3|FNALQYLR.2|LPSGL... [More] |
||||||||||||||
| SEN / CTL | P01034 | Cystatin-C | CST3 | 1.99 | 0.6 | 1.13e-10 | 1.24e-10 |
eye development,response to hypoxia,cell activatio... [More] |
beta-amyloid binding,protease binding,endopeptidas... [More] |
extracellular region,basement membrane,extracellul... [More] |
18 | 7 | 11 |
ALDFAVGEYNK.2|KQIVAGVNYFLDVELGR.3|AFC[CAM]SFQIYAVP... [More] |
||||||||||||||
| SEN / CTL | Q9NR99 | Matrix-remodeling-associated protein 5 | MXRA5 | 1.99 | 1 | 0.0468 | 0.0111 | biological_process | molecular_function | extracellular exosome | 3 | 3 | 3 |
C[CAM]VASNAAGADSLAIR.2|HSEKEPETNVAEGR.3|VLVQSPSTQP... [More] |
||||||||||||||
| SEN / CTL | O00151 | PDZ and LIM domain protein 1 | PDLIM1 | 1.97 | 1.39 | 0.0000155 | 0.00000789 |
response to hypoxia,regulation of transcription, D... [More] |
transcription coactivator activity,zinc ion bindin... [More] |
transcription factor complex,cytoplasm,cytoskeleto... [More] |
15 | 27 | 50 |
GHFFVEDQIYC[CAM]EK.3|GHFFVEDQIYC[CAM]EK.2|IKGC[CAM... [More] |
||||||||||||||
| SEN / CTL | P51888 | Prolargin | PRELP | 1.97 | 1.49 | 0.000313 | 0.000128 |
skeletal system development,cell aging,keratan sul... [More] |
extracellular matrix structural constituent,hepari... [More] |
extracellular region,proteinaceous extracellular m... [More] |
9 | 19 | 26 |
VLEKLPGLVFLYMEK.3|LDGNYLKPPIPLDLMMC[CAM]FR.3|LENLL... [More] |
||||||||||||||
| SEN / CTL | P49588 | Alanine--tRNA ligase, cytoplasmic | AARS | 1.97 | 0.52 | 0.0205 | 0.00522 |
hair follicle development,tRNA modification,tRNA a... [More] |
tRNA binding,aminoacyl-tRNA editing activity,alani... [More] |
cytoplasm,cytosol,membrane,extracellular exosome,m... [More] |
3 | 62 | 112 |
NVGC[CAM]LQEALQLATSFAQLR.3|NVGC[CAM]LQEALQLATSFAQL... [More] |
||||||||||||||
| SEN / CTL | Q9NWM8 | Peptidyl-prolyl cis-trans isomerase FKBP14 | FKBP14 | 1.97 | 0.92 | 0.0438 | 0.0104 |
protein peptidyl-prolyl isomerization,IRE1-mediate... [More] |
peptidyl-prolyl cis-trans isomerase activity,calci... [More] |
endoplasmic reticulum lumen,endoplasmic reticulum ... [More] |
3 | 8 | 10 |
GKIPPESTLIFNIDLLEIR.3|HNNGQPIWFTLGILEALK.4|HNNGQPI... [More] |
||||||||||||||
| SEN / CTL | Q9Y6C2 | EMILIN-1 | EMILIN1 | 1.96 | 1.22 | 8.1e-11 | 9.47e-11 | cell adhesion |
protein binding,extracellular matrix constituent c... [More] |
extracellular region,proteinaceous extracellular m... [More] |
27 | 36 | 48 |
VLLNDGGYYDPETGVFTAPLAGR.3|FRGLEEGQAQAGQC[CAM]PSLEG... [More] |
||||||||||||||
| SEN / CTL | P55268 | Laminin subunit beta-2 | LAMB2 | 1.96 | 1.08 | 3.63e-10 | 3.72e-10 |
cell adhesion,axon guidance,neuromuscular junction... [More] |
integrin binding,structural molecule activity |
extracellular region,basement membrane,basal lamin... [More] |
24 | 53 | 60 |
SLADVDAILAR.2|GAVADTRDTEQTLYQVQER.3|TGGSAQPETPYSGP... [More] |
||||||||||||||
| SEN / CTL | Q01995 | Transgelin | TAGLN | 1.96 | 1.46 | 2.07e-8 | 1.71e-8 |
muscle organ development,epithelial cell different... [More] |
actin binding | cytoplasm | 33 | 24 | 41 |
LGFQVWLK.2|QMEQVAQFLK.2|QM[Oxi]EQVAQFLK.2|TDMFQTVD... [More] |
||||||||||||||
| SEN / CTL | Q9NZN4 | EH domain-containing protein 2 | EHD2 | 1.96 | 0.86 | 0.0548 | 0.0128 |
endocytosis,blood coagulation,cortical actin cytos... [More] |
nucleic acid binding,calcium ion binding,protein b... [More] |
nucleus,cytosol,plasma membrane,caveola,endosome m... [More] |
3 | 30 | 46 |
SKYDEIFYNLAPADGK.3|SKYDEIFYNLAPADGK.2|DIQGLPR.2|VH... [More] |
||||||||||||||
| SEN / CTL | Q02818 | Nucleobindin-1 | NUCB1 | 1.95 | 1.24 | 8.51e-22 | 3.59e-21 |
response to cisplatin,regulation of protein target... [More] |
G-protein alpha-subunit binding,DNA binding,calciu... [More] |
extracellular space,nucleus,early endosome,rough e... [More] |
66 | 33 | 46 |
DLELLIQTATR.2|ELQQAVLHMEQR.3|ELQQAVLHMEQR.2|LLERLP... [More] |
||||||||||||||
| SEN / CTL | P98095 | Fibulin-2 | FBLN2 | 1.94 | 0.6 | 8.08e-10 | 7.87e-10 | positive regulation of cell-substrate adhesion |
extracellular matrix structural constituent,calciu... [More] |
extracellular region,proteinaceous extracellular m... [More] |
15 | 7 | 8 |
ITHYQLNFQTGLLVPAHIFR.4|RLNAYTGVVYLQR.3|IGPAPAFTGDT... [More] |
||||||||||||||
| SEN / CTL | P37837 | Transaldolase | TALDO1 | 1.94 | 0.43 | 0.0135 | 0.00367 |
carbohydrate metabolic process,xylulose biosynthet... [More] |
sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosp... [More] |
nucleus,cytoplasm,cytosol,extracellular exosome | 3 | 31 | 43 |
ALAGC[CAM]DFLTISPK.2|ALAGC[CAM]DFLTISPK.3|KLGGSQED... [More] |
||||||||||||||
| SEN / CTL | O75882 | Attractin | ATRN | 1.94 | 0.9 | 0.05 | 0.0118 |
inflammatory response,response to oxidative stress... [More] |
receptor activity,carbohydrate binding |
extracellular space,cytoplasm,plasma membrane,inte... [More] |
3 | 29 | 41 |
LTLTPWVGLR.2|EQYAVVGHSAHIVTLK.4|EQYAVVGHSAHIVTLK.3... [More] |
||||||||||||||
| SEN / CTL | P17900 | Ganglioside GM2 activator | GM2A | 1.93 | 1.85 | 0.00192 | 0.000632 |
glycosphingolipid metabolic process,ganglioside ca... [More] |
lipid transporter activity,phospholipase activator... [More] |
mitochondrion,hydrogen:potassium-exchanging ATPase... [More] |
9 | 10 | 12 |
SEFVVPDLELPSWLTTGNYR.3|SEFVVPDLELPSWLTTGNYR.2|IPC[... [More] |
||||||||||||||
| SEN / CTL | P08253 | 72 kDa type IV collagenase | MMP2 | 1.93 | 0.5 | 0.0194 | 0.00497 |
angiogenesis,response to hypoxia,blood vessel matu... [More] |
metalloendopeptidase activity,serine-type endopept... [More] |
extracellular region,proteinaceous extracellular m... [More] |
3 | 2 | 2 | IIGYTPDLDPETVDDAFAR.2|IDAVYEAPQEEK.2 | ||||||||||||||
| SEN / CTL | P16070 | CD44 antigen | CD44 | 1.92 | 0.48 | 0.00000262 | 0.00000151 |
cell-matrix adhesion,single organismal cell-cell a... [More] |
collagen binding,hyaluronic acid binding,cytokine ... [More] |
cytoplasm,Golgi apparatus,plasma membrane,integral... [More] |
9 | 12 | 18 |
YGFIEGHVVIPR.3|YGFIEGHVVIPR.2|ALSIGFETC[CAM]R.2|SQ... [More] |
||||||||||||||
| SEN / CTL | P04406 | Glyceraldehyde-3-phosphate dehydrogenase | GAPDH | 1.91 | 1.18 | 6.91e-20 | 2.5e-19 |
microtubule cytoskeleton organization,gluconeogene... [More] |
glyceraldehyde-3-phosphate dehydrogenase (NAD+) (p... [More] |
nucleus,cytoplasm,lipid particle,cytosol,plasma me... [More] |
72 | 51 | 166 |
VPTANVSVVDLTC[CAM]R.2|VPTANVSVVDLTC[CAM]R.3|IISNAS... [More] |
||||||||||||||
| SEN / CTL | P09382 | Galectin-1 | LGALS1 | 1.91 | 1.51 | 3.75e-13 | 6.33e-13 |
plasma cell differentiation,apoptotic process,sign... [More] |
glycoprotein binding,signal transducer activity,pr... [More] |
proteinaceous extracellular matrix,extracellular s... [More] |
48 | 17 | 33 |
SFVLNLGKDSNNLC[CAM]LHFNPR.4|SFVLNLGKDSNNLC[CAM]LHF... [More] |
||||||||||||||
| SEN / CTL | P23142 | Fibulin-1 | FBLN1 | 1.9 | 1.48 | 1.65e-17 | 4.18e-17 |
negative regulation of protein phosphorylation,neg... [More] |
fibronectin binding,extracellular matrix structura... [More] |
extracellular region,proteinaceous extracellular m... [More] |
66 | 25 | 36 |
EFTRPEEIIFLR.3|EFTRPEEIIFLR.2|RGYQLSDVDGVTC[CAM]ED... [More] |
||||||||||||||
| SEN / CTL | P31946 | 14-3-3 protein beta/alpha | YWHAB | 1.9 | 1.22 | 0.00000998 | 0.0000053 |
MAPK cascade,protein targeting,viral process,negat... [More] |
transcription corepressor activity,protein binding... [More] |
nucleus,cytoplasm,mitochondrion,cytosol,cell-cell ... [More] |
15 | 37 | 87 |
NLLSVAYK.2|NLLSVAYK.1|LAEQAERYDDMAAAMK.3|LAEQAERYD... [More] |
||||||||||||||
| SEN / CTL | O75347 | Tubulin-specific chaperone A | TBCA | 1.9 | 1.33 | 0.0000482 | 0.0000238 |
protein folding,tubulin complex assembly,post-chap... [More] |
poly(A) RNA binding,beta-tubulin binding,chaperone... [More] |
nucleolus,cytoplasm,microtubule,microtubule cytosk... [More] |
12 | 14 | 23 |
ILENEKDLEEAEEYKEAR.4|ILENEKDLEEAEEYKEAR.3|RLEAAYLD... [More] |
||||||||||||||
| SEN / CTL | P14174 | Macrophage migration inhibitory factor | MIF | 1.89 | 0.6 | 1.56e-11 | 2.08e-11 |
prostaglandin biosynthetic process,negative regula... [More] |
dopachrome isomerase activity,receptor binding,cyt... [More] |
extracellular region,extracellular space,nucleopla... [More] |
21 | 10 | 22 |
LLC[CAM]GLLAER.2|ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPD... [More] |
||||||||||||||
| SEN / CTL | P14314 | Glucosidase 2 subunit beta | PRKCSH | 1.89 | 0.54 | 7.82e-7 | 4.79e-7 |
protein folding,N-glycan processing,intracellular ... [More] |
protein kinase C binding,calcium ion binding,ion c... [More] |
intracellular,endoplasmic reticulum,endoplasmic re... [More] |
9 | 34 | 64 |
SLEDQVEMLR.2|SLEDQVEM[Oxi]LR.2|ESLQQMAEVTR.2|ESLQQ... [More] |
||||||||||||||
| SEN / CTL | Q02809 | Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 | PLOD1 | 1.88 | 1.03 | 3.06e-32 | 2.91e-31 |
response to hypoxia,cellular protein modification ... [More] |
iron ion binding,procollagen-lysine 5-dioxygenase ... [More] |
endoplasmic reticulum membrane,rough endoplasmic r... [More] |
99 | 37 | 56 |
SEDYVDIVQGR.2|FWTFETGC[CAM]TVC[CAM]DEGLR.2|FLLEYIA... [More] |
||||||||||||||
| SEN / CTL | P24592 | Insulin-like growth factor-binding protein 6 | IGFBP6 | 1.88 | 0.34 | 1.05e-7 | 7.37e-8 |
regulation of cell growth,signal transduction,nega... [More] |
receptor binding,insulin-like growth factor I bind... [More] |
extracellular region,extracellular space,Golgi app... [More] |
9 | 4 | 4 |
HLDSVLQQLQTEVYR.3|EGQEC[CAM]GVYTPNC[CAM]APGLQC[CAM... [More] |
||||||||||||||
| SEN / CTL | P31949 | Protein S100-A11 | S100A11 | 1.88 | 1.18 | 0.000301 | 0.000124 |
signal transduction,negative regulation of DNA rep... [More] |
calcium ion binding,protein homodimerization activ... [More] |
ruffle,extracellular space,nucleus,cytoplasm,cell-... [More] |
12 | 8 | 13 |
TEFLSFMNTELAAFTK.2|TEFLSFMNTELAAFTK.3|TEFLSFM[Oxi]... [More] |
||||||||||||||
| SEN / CTL | Q969H8 | Myeloid-derived growth factor | MYDGF | 1.88 | 2.3 | 0.179 | 0.0375 |
angiogenesis,positive regulation of protein phosph... [More] |
protein binding |
extracellular space,endoplasmic reticulum lumen,en... [More] |
3 | 8 | 13 |
SYLYFTQFK.2|PGGVVHSFSHNVGPGDK.4|PGGVVHSFSHNVGPGDK.... [More] |
||||||||||||||
| SEN / CTL | Q9UBX5 | Fibulin-5 | FBLN5 | 1.87 | 0.92 | 2.25e-7 | 1.48e-7 |
regulation of cell growth,cell-matrix adhesion,ext... [More] |
integrin binding,calcium ion binding,protein bindi... [More] |
extracellular region,proteinaceous extracellular m... [More] |
15 | 9 | 10 |
YPGAYYIFQIK.2|SVPADIFQMQATTR.2|DQPFTILYR.2|IYVSQYP... [More] |
||||||||||||||
| SEN / CTL | P26447 | Protein S100-A4 | S100A4 | 1.87 | 1.06 | 0.00638 | 0.00185 |
epithelial to mesenchymal transition,positive regu... [More] |
actin binding,calcium ion binding,protein binding,... [More] |
extracellular space,nucleus,neuron projection,peri... [More] |
6 | 6 | 10 |
ALDVMVSTFHK.3|ALDVMVSTFHK.2|ALDVM[Oxi]VSTFHK.3|ALD... [More] |
||||||||||||||
| SEN / CTL | Q08431 | Lactadherin | MFGE8 | 1.86 | 1.3 | 1.53e-8 | 1.29e-8 |
angiogenesis,phagocytosis, recognition,phagocytosi... [More] |
phosphatidylserine binding,integrin binding,phosph... [More] |
extracellular region,extracellular space,external ... [More] |
27 | 15 | 19 |
VTFLGLQHWVPELAR.3|VTFLGLQHWVPELAR.2|TWGLHLFSWNPSYA... [More] |
||||||||||||||
| SEN / CTL | P34096 | Ribonuclease 4 | RNASE4 | 1.86 | 0.24 | 0.00534 | 0.00159 |
mRNA cleavage,RNA phosphodiester bond hydrolysis, ... [More] |
nucleic acid binding,endonuclease activity,ribonuc... [More] |
extracellular region,extracellular exosome | 3 | 5 | 6 |
RVVIAC[CAM]EGNPQVPVHFDG.3|RFNTFIHEDIWNIR.4|RFNTFIH... [More] |
||||||||||||||
| SEN / CTL | P35579 | Myosin-9 | MYH9 | 1.85 | 1.2 | 1.89e-50 | 2.87e-49 |
meiotic spindle organization,cytokinesis,angiogene... [More] |
microfilament motor activity,motor activity,actin ... [More] |
stress fiber,ruffle,uropod,nucleus,cytoplasm,spind... [More] |
186 | 243 | 483 |
ALELDSNLYR.2|TRLQQELDDLLVDLDHQR.4|TRLQQELDDLLVDLDH... [More] |
||||||||||||||
| SEN / CTL | P07910 | Heterogeneous nuclear ribonucleoproteins C1/C2 | HNRNPC | 1.84 | 1.24 | 0.00319 | 0.000993 |
mRNA splicing, via spliceosome,osteoblast differen... [More] |
nucleotide binding,RNA polymerase II core promoter... [More] |
nuclear chromatin,nucleus,nucleoplasm,spliceosomal... [More] |
6 | 30 | 47 |
GFAFVQYVNER.2|GFAFVQYVNER.3|VFIGNLNTLVVK.2|VFIGNLN... [More] |
||||||||||||||
| SEN / CTL | P16949 | Stathmin | STMN1 | 1.84 | 1.45 | 0.112 | 0.0242 |
mitotic cytokinesis,microtubule depolymerization,m... [More] |
signal transducer activity,tubulin binding |
intracellular,cytoplasm,cytosol,microtubule,membra... [More] |
3 | 18 | 24 |
ASGQAFELILSPR.2|ASGQAFELILSPR.3|DLSLEEIQKK.3|DLSLE... [More] |
||||||||||||||
| SEN / CTL | Q99439 | Calponin-2 | CNN2 | 1.83 | 0.52 | 1.03e-9 | 9.91e-10 |
cytoskeleton organization,actomyosin structure org... [More] |
actin binding,calmodulin binding,cadherin binding ... [More] |
stress fiber,cytoskeleton,cell-cell junction,cell-... [More] |
15 | 17 | 33 |
TWIEGLTGLSIGPDFQK.2|TWIEGLTGLSIGPDFQK.3|GLKDGTILC[... [More] |
||||||||||||||
| SEN / CTL | Q9Y2B0 | Protein canopy homolog 2 | CNPY2 | 1.82 | 0.62 | 0.00013 | 0.000059 |
enzyme linked receptor protein signaling pathway,t... [More] |
protein binding |
endoplasmic reticulum,integral component of plasma... [More] |
6 | 15 | 27 |
SEAHLTELLEEIC[CAM]DR.3|SEAHLTELLEEIC[CAM]DR.2|INPD... [More] |
||||||||||||||
| SEN / CTL | P15291 | Beta-1,4-galactosyltransferase 1 | B4GALT1 | 1.82 | 1.06 | 0.00026 | 0.00011 |
epithelial cell development,acute inflammatory res... [More] |
beta-N-acetylglucosaminylglycopeptide beta-1,4-gal... [More] |
Golgi trans cisterna,Golgi membrane,extracellular ... [More] |
9 | 7 | 9 |
QQLDYGIYVINQAGDTIFNR.3|VAIIIPFR.2|ETMLSDGLNSLTYQVL... [More] |
||||||||||||||
| SEN / CTL | P28066 | Proteasome subunit alpha type-5 | PSMA5 | 1.82 | 0.42 | 0.0178 | 0.00465 |
MAPK cascade,protein polyubiquitination,stimulator... [More] |
threonine-type endopeptidase activity,protein bind... [More] |
proteasome complex,nucleus,nucleoplasm,cytoplasm,c... [More] |
3 | 17 | 34 |
LFQVEYAIEAIK.2|LFQVEYAIEAIK.3|PFGVALLFGGVDEK.3|PFG... [More] |
||||||||||||||
| SEN / CTL | Q8IUX7 | Adipocyte enhancer-binding protein 1 | AEBP1 | 1.8 | 1.03 | 1.34e-8 | 1.15e-8 |
negative regulation of transcription from RNA poly... [More] |
RNA polymerase II regulatory region sequence-speci... [More] |
extracellular space,nucleus,cytoplasm,extracellula... [More] |
18 | 9 | 11 |
YLSPDATVSTEVR.2|YTAGIHGNEVLGR.3|YTAGIHGNEVLGR.2|NP... [More] |
||||||||||||||
| SEN / CTL | Q08380 | Galectin-3-binding protein | LGALS3BP | 1.79 | 0.85 | 2.39e-17 | 5.86e-17 |
platelet degranulation,receptor-mediated endocytos... [More] |
scavenger receptor activity |
extracellular region,proteinaceous extracellular m... [More] |
42 | 23 | 30 |
SDLAVPSELALLK.2|IYTSPTWSAFVTDSSWSAR.3|IYTSPTWSAFVT... [More] |
||||||||||||||
| SEN / CTL | P30101 | Protein disulfide-isomerase A3 | PDIA3 | 1.79 | 1.19 | 6.1e-12 | 8.75e-12 |
antigen processing and presentation of peptide ant... [More] |
protein disulfide isomerase activity,cysteine-type... [More] |
nucleus,endoplasmic reticulum,endoplasmic reticulu... [More] |
33 | 62 | 120 |
ELSDFISYLQR.2|ELSDFISYLQR.3|FISDKDASIVGFFDDSFSEAHS... [More] |
||||||||||||||
| SEN / CTL | O15145 | Actin-related protein 2/3 complex subunit 3 | ARPC3 | 1.79 | 0.14 | 0.00192 | 0.000632 |
movement of cell or subcellular component,Arp2/3 c... [More] |
structural constituent of cytoskeleton,protein bin... [More] |
cytosol,Arp2/3 protein complex,focal adhesion,acti... [More] |
3 | 16 | 27 |
LIGNMALLPIR.2|LIGNMALLPIR.3|LIGNM[Oxi]ALLPIR.2|NYE... [More] |
||||||||||||||
| SEN / CTL | P11021 | 78 kDa glucose-regulated protein | HSPA5 | 1.78 | 1.21 | 2.13e-18 | 5.79e-18 |
ER overload response,activation of signaling prote... [More] |
glycoprotein binding,calcium ion binding,protein b... [More] |
nucleus,mitochondrion,endoplasmic reticulum,endopl... [More] |
54 | 68 | 133 |
IINEPTAAAIAYGLDKR.3|IINEPTAAAIAYGLDKR.2|TKPYIQVDIG... [More] |
||||||||||||||
| SEN / CTL | P06748 | Nucleophosmin | NPM1 | 1.77 | 0.78 | 1.12e-7 | 7.79e-8 |
DNA repair,nucleosome assembly,intracellular prote... [More] |
DNA binding,transcription coactivator activity,RNA... [More] |
nucleus,nucleoplasm,nucleolus,cytoplasm,centrosome... [More] |
15 | 26 | 61 |
MSVQPTVSLGGFEITPPVVLR.3|MSVQPTVSLGGFEITPPVVLR.2|M[... [More] |
||||||||||||||
| SEN / CTL | Q14393 | Growth arrest-specific protein 6 | GAS6 | 1.75 | 0.76 | 1.86e-8 | 1.56e-8 |
neuron migration,positive regulation of protein ph... [More] |
phosphatidylserine binding,receptor binding,voltag... [More] |
extracellular region,extracellular space,cytoplasm... [More] |
15 | 11 | 13 |
SPVLTFAGGLPDVPVTSAPVTAFYR.3|TC[CAM]QDIDEC[CAM]ADSE... [More] |
||||||||||||||
| SEN / CTL | P46940 | Ras GTPase-activating-like protein IQGAP1 | IQGAP1 | 1.75 | 0.96 | 0.000161 | 0.0000717 |
regulation of cytokine production,signal transduct... [More] |
GTPase inhibitor activity,GTPase activator activit... [More] |
ruffle,nucleus,cytoplasm,cytosol,microtubule,actin... [More] |
9 | 128 | 200 |
EQLWLANEGLITR.2|EQLWLANEGLITR.3|NKYQELINDIAR.3|NKY... [More] |
||||||||||||||
| SEN / CTL | P61916 | Epididymal secretory protein E1 | NPC2 | 1.75 | 1.04 | 0.000554 | 0.000214 |
cholesterol metabolic process,response to virus,ph... [More] |
protein binding,cholesterol binding,enzyme binding |
lysosome,endoplasmic reticulum,extracellular exoso... [More] |
9 | 12 | 19 |
DC[CAM]GSVDGVIKEVNVSPC[CAM]PTQPC[CAM]QLSK.3|AVVHGI... [More] |
||||||||||||||
| SEN / CTL | Q15262 | Receptor-type tyrosine-protein phosphatase kappa | PTPRK | 1.73 | 0.07 | 2.84e-8 | 2.26e-8 |
protein dephosphorylation,cell adhesion,signal tra... [More] |
protein tyrosine phosphatase activity,transmembran... [More] |
photoreceptor outer segment,integral component of ... [More] |
6 | 12 | 13 |
VLLTRPGEGGTGLPGPPLITR.3|GLNPGTLNILVR.2|YENHSATAESS... [More] |
||||||||||||||
| SEN / CTL | P60842 | Eukaryotic initiation factor 4A-I | EIF4A1 | 1.73 | 1.26 | 0.0000108 | 0.00000562 |
nuclear-transcribed mRNA poly(A) tail shortening,t... [More] |
RNA cap binding,double-stranded RNA binding,mRNA b... [More] |
cytoplasm,cytosol,membrane,eukaryotic translation ... [More] |
15 | 39 | 86 |
VLITTDLLAR.2|AEVQKLQMEAPHIIVGTPGR.4|LQMEAPHIIVGTPG... [More] |
||||||||||||||
| SEN / CTL | P07602 | Prosaposin | PSAP | 1.73 | 2.11 | 0.0000124 | 0.00000639 |
platelet degranulation,glycosphingolipid metabolic... [More] |
G-protein coupled receptor binding,protein binding... [More] |
extracellular region,extracellular space,cytoplasm... [More] |
21 | 30 | 59 |
EIVDSYLPVILDIIK.2|EIVDSYLPVILDIIK.3|GEMSRPGEVC[CAM... [More] |
||||||||||||||
| SEN / CTL | P55083 | Microfibril-associated glycoprotein 4 | MFAP4 | 1.72 | 0.86 | 0.00026 | 0.00011 |
cell adhesion,UV protection,regulation of collagen... [More] |
molecular_function,protein binding |
microfibril,extracellular region,extracellular mat... [More] |
9 | 4 | 9 |
ADGEYWLGLQNMHLLTLK.3|ADGEYWLGLQNMHLLTLK.2|ADGEYWLG... [More] |
||||||||||||||
| SEN / CTL | P21333 | Filamin-A | FLNA | 1.7 | 1.02 | 8.42e-77 | 2.13e-75 |
platelet degranulation,adenylate cyclase-inhibitin... [More] |
G-protein coupled receptor binding,glycoprotein bi... [More] |
extracellular region,nucleus,nucleolus,cytoplasm,c... [More] |
234 | 207 | 388 |
LYSVSYLLK.2|YGGDEIPFSPYR.2|AEAGVPAEFSIWTR.2|AEAGVP... [More] |
||||||||||||||
| SEN / CTL | P40926 | Malate dehydrogenase, mitochondrial | MDH2 | 1.69 | 1.83 | 3.18e-8 | 2.47e-8 |
gluconeogenesis,tricarboxylic acid cycle,oxaloacet... [More] |
L-malate dehydrogenase activity,protein self-assoc... [More] |
nucleus,nucleoplasm,mitochondrion,mitochondrial in... [More] |
27 | 31 | 62 |
ANTFVAELK.2|IFGVTTLDIVR.2|IFGVTTLDIVR.3|GYLGPEQLPD... [More] |
||||||||||||||
| SEN / CTL | Q12931 | Heat shock protein 75 kDa, mitochondrial | TRAP1 | 1.69 | 0.1 | 0.00121 | 0.000424 |
response to stress,translational attenuation,chape... [More] |
tumor necrosis factor receptor binding,protein bin... [More] |
nucleoplasm,mitochondrion,mitochondrial inner memb... [More] |
3 | 53 | 85 |
GVVDSEDIPLNLSR.2|GVVDSEDIPLNLSR.3|LNELLVK.2|HLAEHS... [More] |
||||||||||||||
| SEN / CTL | P22626 | Heterogeneous nuclear ribonucleoproteins A2/B1 | HNRNPA2B1 | 1.69 | 0.94 | 0.00287 | 0.000902 |
negative regulation of transcription from RNA poly... [More] |
nucleotide binding,RNA binding,mRNA 3'-UTR binding... [More] |
nucleus,nucleoplasm,spliceosomal complex,cytoplasm... [More] |
6 | 47 | 96 |
GFGFVTFDDHDPVDKIVLQK.4|GFGFVTFDDHDPVDKIVLQK.3|GFGF... [More] |
||||||||||||||
| SEN / CTL | P49747 | Cartilage oligomeric matrix protein | COMP | 1.69 | 0.17 | 0.00337 | 0.00105 |
skeletal system development,growth plate cartilage... [More] |
protease binding,extracellular matrix structural c... [More] |
extracellular region,proteinaceous extracellular m... [More] |
3 | 10 | 11 |
C[CAM]EAC[CAM]PPGYSGPTHQGVGLAFAK.3|AVAEPGIQLK.2|FC... [More] |
||||||||||||||
| SEN / CTL | Q9BTY2 | Plasma alpha-L-fucosidase | FUCA2 | 1.69 | 1.79 | 0.00653 | 0.00189 |
fucose metabolic process,response to bacterium,gly... [More] |
alpha-L-fucosidase activity | extracellular space,extracellular exosome | 9 | 12 | 14 |
FDPTWESLDAR.2|LVYAIFLK.2|FFNANQWADIFQASGAK.3|FFNAN... [More] |
||||||||||||||
| SEN / CTL | P21810 | Biglycan | BGN | 1.68 | 1.59 | 1.26e-15 | 2.52e-15 |
blood vessel remodeling,negative regulation of pro... [More] |
protein kinase inhibitor activity,extracellular ma... [More] |
extracellular region,proteinaceous extracellular m... [More] |
69 | 23 | 37 |
IQAIELEDLLR.2|DLPETLNELHLDHNKIQAIELEDLLR.5|DLPETLN... [More] |
||||||||||||||
| SEN / CTL | P06865 | Beta-hexosaminidase subunit alpha | HEXA | 1.68 | 1.26 | 4.71e-11 | 5.97e-11 |
carbohydrate metabolic process,glycosaminoglycan b... [More] |
beta-N-acetylhexosaminidase activity,acetylglucosa... [More] |
membrane,azurophil granule,lysosomal lumen,extrace... [More] |
30 | 21 | 32 |
ALLSAPWYLNR.2|GLETFSQLVWK.2|YRDLLFGSGSWPRPYLTGK.4|... [More] |
||||||||||||||
| SEN / CTL | P53634 | Dipeptidyl peptidase 1 | CTSC | 1.68 | 0.49 | 0.000215 | 0.0000929 |
T cell mediated cytotoxicity,proteolysis,ER to Gol... [More] |
cysteine-type endopeptidase activity,serine-type e... [More] |
Golgi membrane,extracellular space,lysosome,endopl... [More] |
6 | 16 | 31 |
ILHLPTSWDWR.3|ILHLPTSWDWR.2|NSWGTGWGENGYFR.2|VVVYL... [More] |
||||||||||||||
| SEN / CTL | Q9NZP8 | Complement C1r subcomponent-like protein | C1RL | 1.68 | 2.79 | 0.233 | 0.0474 |
proteolysis,complement activation, classical pathw... [More] |
serine-type endopeptidase activity | extracellular space,extracellular exosome | 3 | 9 | 11 |
WILTAAHTIYPK.3|WILTAAHTIYPK.2|VVVHPDYR.2|EAC[CAM]N... [More] |
||||||||||||||
| SEN / CTL | P35556 | Fibrillin-2 | FBN2 | 1.66 | 1.12 | 0.00655 | 0.00189 |
extracellular matrix disassembly,extracellular mat... [More] |
extracellular matrix structural constituent,calciu... [More] |
microfibril,extracellular region,extracellular mat... [More] |
6 | 5 | 5 |
C[CAM]WGIGTIPEAC[CAM]PVR.2|LSSTGLIC[CAM]IDSLK.2|RP... [More] |
||||||||||||||
| SEN / CTL | P08238 | Heat shock protein HSP 90-beta | HSP90AB1 | 1.65 | 1.13 | 1.05e-9 | 9.97e-10 |
placenta development,protein folding,response to u... [More] |
glycoprotein binding,UTP binding,CTP binding,doubl... [More] |
nucleoplasm,cytoplasm,mitochondrion,lysosomal memb... [More] |
33 | 84 | 175 |
ELISNASDALDKIR.3|ELISNASDALDKIR.2|GVVDSEDLPLNISR.2... [More] |
||||||||||||||
| SEN / CTL | P08865 | 40S ribosomal protein SA | RPSA | 1.65 | 0.17 | 0.00409 | 0.00125 |
ribosomal small subunit assembly,nuclear-transcrib... [More] |
virus receptor activity,structural constituent of ... [More] |
nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr... [More] |
3 | 21 | 46 |
AIVAIENPADVSVISSR.2|AIVAIENPADVSVISSR.3|FAAATGATPI... [More] |
||||||||||||||
| SEN / CTL | Q99536 | Synaptic vesicle membrane protein VAT-1 homolog | VAT1 | 1.65 | 0.89 | 0.00426 | 0.0013 |
negative regulation of mitochondrial fusion,oxidat... [More] |
zinc ion binding,oxidoreductase activity |
mitochondrial outer membrane,integral component of... [More] |
6 | 28 | 53 |
AC[CAM]GLNFADLMAR.2|AC[CAM]GLNFADLM[Oxi]AR.2|GVDIV... [More] |
||||||||||||||
| SEN / CTL | P48740 | Mannan-binding lectin serine protease 1 | MASP1 | 1.64 | 1.17 | 0.0000436 | 0.0000217 |
complement activation, lectin pathway,proteolysis,... [More] |
serine-type endopeptidase activity,calcium ion bin... [More] |
extracellular region,extracellular space | 15 | 18 | 21 |
TGVITSPDFPNPYPK.2|APGELEHGLITFSTR.3|APGELEHGLITFST... [More] |
||||||||||||||
| SEN / CTL | P13693 | Translationally-controlled tumor protein | TPT1 | 1.64 | 0.55 | 0.000454 | 0.000179 |
calcium ion transport,cellular calcium ion homeost... [More] |
calcium ion binding,protein binding,microtubule bi... [More] |
extracellular space,nucleus,cytoplasm,multivesicul... [More] |
6 | 14 | 26 |
DLISHDEMFSDIYK.3|DLISHDEM[Oxi]FSDIYK.3|DLISHDEM[Ox... [More] |
||||||||||||||
| SEN / CTL |
O14950 P19105 |
Myosin regulatory light chain 12B;Myosin regulatory light chain 12A |
MYL12B MYL12A |
1.63 | 0.44 | 0.000193 | 0.0000836 |
muscle contraction,regulation of cell shape;muscle... [More] |
calcium ion binding,myosin heavy chain binding;cal... [More] |
stress fiber,cytosol,brush border,myosin II comple... [More] |
6 | 18 | 38 |
GNFNYIEFTR.2|ELLTTMGDRFTDEEVDELYR.3|ELLTTM[Oxi]GDR... [More] |
||||||||||||||
| SEN / CTL | Q92743 | Serine protease HTRA1 | HTRA1 | 1.63 | 0.62 | 0.00104 | 0.000371 |
regulation of cell growth,placenta development,pro... [More] |
serine-type endopeptidase activity,insulin-like gr... [More] |
extracellular region,extracellular space,cytosol,p... [More] |
6 | 2 | 2 | IAPAVVHIELFR.3|SSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQR.3 | ||||||||||||||
| SEN / CTL | Q9BS26 | Endoplasmic reticulum resident protein 44 | ERP44 | 1.63 | 1.82 | 0.00464 | 0.0014 |
protein folding,response to unfolded protein,glyco... [More] |
protein disulfide isomerase activity |
endoplasmic reticulum lumen,endoplasmic reticulum ... [More] |
9 | 22 | 40 |
TPADC[CAM]PVIAIDSFR.2|TPADC[CAM]PVIAIDSFR.3|VANILH... [More] |
||||||||||||||
| SEN / CTL | O75369 | Filamin-B | FLNB | 1.62 | 1.07 | 8.26e-11 | 9.51e-11 |
keratinocyte development,epithelial cell morphogen... [More] |
actin binding,protein binding,poly(A) RNA binding,... [More] |
stress fiber,cytoplasm,cytosol,plasma membrane,bru... [More] |
27 | 208 | 346 |
VLFASQEIPASPFR.2|VLFASQEIPASPFR.3|SPFTVGVAAPLDLSK.... [More] |
||||||||||||||
| SEN / CTL | P06744 | Glucose-6-phosphate isomerase | GPI | 1.62 | 2 | 0.0017 | 0.000565 |
angiogenesis,in utero embryonic development,mesode... [More] |
glucose-6-phosphate isomerase activity,cytokine ac... [More] |
extracellular space,nucleoplasm,cytoplasm,cytosol,... [More] |
12 | 49 | 107 |
ILLANFLAQTEALMR.2|ILLANFLAQTEALMR.3|ILLANFLAQTEALM... [More] |
||||||||||||||
| SEN / CTL | P06733 | Alpha-enolase | ENO1 | 1.61 | 1.13 | 2.03e-18 | 5.73e-18 |
gluconeogenesis,transcription, DNA-templated,respo... [More] |
magnesium ion binding,DNA binding,phosphopyruvate ... [More] |
phosphopyruvate hydratase complex,extracellular sp... [More] |
66 | 54 | 117 |
SFIKDYPVVSIEDPFDQDDWGAWQK.3|SFIKDYPVVSIEDPFDQDDWGA... [More] |
||||||||||||||
| SEN / CTL | Q9UBG0 | C-type mannose receptor 2 | MRC2 | 1.6 | 0.87 | 0.000335 | 0.000136 |
osteoblast differentiation,endocytosis,signal tran... [More] |
transmembrane signaling receptor activity,protein ... [More] |
integral component of plasma membrane,focal adhesi... [More] |
9 | 30 | 39 |
TLGDQLSLLLGAR.2|DC[CAM]SIALPYVC[CAM]K.2|WSDGVGFSYH... [More] |
||||||||||||||
| SEN / CTL | O75368 | SH3 domain-binding glutamic acid-rich-like protein | SH3BGRL | 1.6 | 1.28 | 0.000758 | 0.000284 | positive regulation of signal transduction | SH3/SH2 adaptor activity,SH3 domain binding |
extracellular space,nucleus,cytoplasm,extracellula... [More] |
9 | 12 | 17 |
VYIASSSGSTAIK.2|ENNAVYAFLGLTAPPGSK.3|ENNAVYAFLGLTA... [More] |
||||||||||||||
| SEN / CTL | P24593 | Insulin-like growth factor-binding protein 5 | IGFBP5 | 1.6 | 1.46 | 0.0304 | 0.00755 |
regulation of cell growth,osteoblast differentiati... [More] |
fibronectin binding,protein binding,insulin-like g... [More] |
extracellular region,intracellular,insulin-like gr... [More] |
6 | 3 | 3 |
ALSMC[CAM]PPSPLGC[CAM]ELVK.2|HMEASLQELK.2|FVGGAENT... [More] |
||||||||||||||
| SEN / CTL | Q9UJJ9 | N-acetylglucosamine-1-phosphotransferase subunit gamma | GNPTG | 1.59 | 0.59 | 0.000536 | 0.000208 |
N-glycan processing to lysosome,carbohydrate phosp... [More] |
UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylg... [More] |
Golgi membrane,Golgi apparatus,extracellular exoso... [More] |
6 | 6 | 9 |
LAHVSEPSTC[CAM]VYALTFETPLVC[CAM]HPHALLVYPTLPEALQR.... [More] |
||||||||||||||
| SEN / CTL | Q15121 | Astrocytic phosphoprotein PEA-15 | PEA15 | 1.59 | 0.81 | 0.0776 | 0.0173 |
DNA damage checkpoint,MAPK cascade,activation of M... [More] |
protein binding | cytosol,microtubule associated complex | 3 | 11 | 16 |
RPDLLTMVVDYR.3|RPDLLTMVVDYR.2|SAC[CAM]KEDIPSEK.3|S... [More] |
||||||||||||||
| SEN / CTL | P04216 | Thy-1 membrane glycoprotein | THY1 | 1.59 | 1.96 | 0.189 | 0.0393 |
angiogenesis,negative regulation of protein kinase... [More] |
GTPase activator activity,integrin binding,protein... [More] |
endoplasmic reticulum,cytosol,plasma membrane,inte... [More] |
3 | 4 | 7 |
KHVLFGTVGVPEHTYR.4|HVLFGTVGVPEHTYR.4|HVLFGTVGVPEHT... [More] |
||||||||||||||
| SEN / CTL | P62937 | Peptidyl-prolyl cis-trans isomerase A | PPIA | 1.58 | 0.65 | 7.25e-19 | 2.4e-18 |
protein peptidyl-prolyl isomerization,RNA-dependen... [More] |
peptidyl-prolyl cis-trans isomerase activity,prote... [More] |
extracellular region,extracellular space,nucleus,c... [More] |
42 | 24 | 52 |
VSFELFADKVPK.3|VSFELFADKVPK.2|VNPTVFFDIAVDGEPLGR.3... [More] |
||||||||||||||
| SEN / CTL | P60174 | Triosephosphate isomerase | TPI1 | 1.58 | 1.46 | 1.1e-18 | 3.35e-18 |
gluconeogenesis,glycolytic process,pentose-phospha... [More] |
triose-phosphate isomerase activity,ubiquitin prot... [More] |
extracellular space,nucleus,cytosol,extracellular ... [More] |
78 | 37 | 70 |
VVLAYEPVWAIGTGK.2|VVLAYEPVWAIGTGK.3|KQSLGELIGTLNAA... [More] |
||||||||||||||
| SEN / CTL | Q13308 | Inactive tyrosine-protein kinase 7 | PTK7 | 1.58 | 1.3 | 1.35e-7 | 9.27e-8 |
establishment of planar polarity,ventricular septu... [More] |
protein kinase activity,protein binding,ATP bindin... [More] |
integral component of plasma membrane,cell-cell ju... [More] |
21 | 30 | 35 |
ADGSSLPEWVTDNAGTLHFAR.3|VVLAPQDVVVAR.2|WIEAGPVVLKH... [More] |
||||||||||||||
| SEN / CTL | P60660 | Myosin light polypeptide 6 | MYL6 | 1.58 | 0.72 | 1.63e-7 | 1.09e-7 |
muscle contraction,skeletal muscle tissue developm... [More] |
motor activity,calcium ion binding,structural cons... [More] |
cytosol,brush border,membrane,myosin complex,uncon... [More] |
15 | 13 | 27 |
NKDQGTYEDYVEGLR.3|NKDQGTYEDYVEGLR.2|NKDQGTYEDYVEGL... [More] |
||||||||||||||
| SEN / CTL | P50990 | T-complex protein 1 subunit theta | CCT8 | 1.58 | 1.11 | 0.000779 | 0.00029 |
protein folding,binding of sperm to zona pellucida... [More] |
protein binding,ATP binding,ATPase activity, coupl... [More] |
zona pellucida receptor complex,nucleoplasm,cytopl... [More] |
9 | 59 | 110 |
LFVTNDAATILR.2|LFVTNDAATILR.3|NLRDIDEVSSLLR.3|NLRD... [More] |
||||||||||||||
| SEN / CTL | P05067 | Amyloid beta A4 protein | APP | 1.57 | 0.96 | 1.72e-7 | 1.14e-7 |
response to yeast,suckling behavior,platelet degra... [More] |
DNA binding,serine-type endopeptidase inhibitor ac... [More] |
extracellular region,extracellular space,nuclear e... [More] |
18 | 21 | 26 |
WYFDVTEGK.2|ISYGNDALMPSLTETK.2|AVIQHFQEKVESLEQEAAN... [More] |
||||||||||||||
| SEN / CTL | P07942 | Laminin subunit beta-1 | LAMB1 | 1.55 | 1.35 | 3.47e-22 | 1.65e-21 |
cell adhesion,neuronal-glial interaction involved ... [More] |
structural molecule activity,extracellular matrix ... [More] |
extracellular region,basement membrane,laminin-1 c... [More] |
93 | 76 | 100 |
ISGVIGPYRETVDSVER.3|IPSWTGAGFVR.2|SC[CAM]YQDPVTLQL... [More] |
||||||||||||||
| SEN / CTL | P07355 | Annexin A2 | ANXA2 | 1.55 | 1.06 | 2.43e-18 | 6.38e-18 |
angiogenesis,membrane raft assembly,positive regul... [More] |
protease binding,calcium ion binding,protein bindi... [More] |
ruffle,basement membrane,extracellular space,nucle... [More] |
66 | 49 | 99 |
GLGTDEDSLIEIIC[CAM]SR.2|GLGTDEDSLIEIIC[CAM]SR.3|GV... [More] |
||||||||||||||
| SEN / CTL | P18669 | Phosphoglycerate mutase 1 | PGAM1 | 1.55 | 0.68 | 1.33e-13 | 2.3e-13 |
gluconeogenesis,glycolytic process,regulation of g... [More] |
bisphosphoglycerate mutase activity,phosphoglycera... [More] |
cytoplasm,cytosol,membrane,extracellular exosome | 30 | 38 | 83 |
ALPFWNEEIVPQIK.2|ALPFWNEEIVPQIK.3|YADLTEDQLPSC[CAM... [More] |
||||||||||||||
| SEN / CTL |
P0CG47 P0CG48 P62979 P62987 |
Polyubiquitin-B;Polyubiquitin-C;Ubiquitin-40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40 |
UBB UBC RPS27A UBA52 |
1.55 | 1.04 | 0.00304 | 0.000951 |
G2/M transition of mitotic cell cycle,negative reg... [More] |
protein binding;protease binding,protein binding,p... [More] |
extracellular space,nucleus,nucleoplasm,mitochondr... [More] |
6 | 1 | 2 | TITLEVEPSDTIENVK.2|TITLEVEPSDTIENVK.3 | ||||||||||||||
| SEN / CTL | P54802 | Alpha-N-acetylglucosaminidase | NAGLU | 1.54 | 1.24 | 0.00000848 | 0.00000457 |
glycosaminoglycan catabolic process,lysosome organ... [More] |
alpha-N-acetylglucosaminidase activity | lysosome,lysosomal lumen,extracellular exosome | 15 | 21 | 31 |
FLLGSWLEQAR.2|YDLLDLTR.2|AGGVLAYELLPALDEVLASDSR.3|... [More] |
||||||||||||||
| SEN / CTL | P40925 | Malate dehydrogenase, cytoplasmic | MDH1 | 1.54 | 0.48 | 0.000418 | 0.000165 |
gluconeogenesis,tricarboxylic acid cycle,oxaloacet... [More] |
malic enzyme activity,L-malate dehydrogenase activ... [More] |
extracellular space,cytoplasm,mitochondrion,centro... [More] |
6 | 23 | 39 |
FVEGLPINDFSR.2|NVIIWGNHSSTQYPDVNHAK.4|NVIIWGNHSSTQ... [More] |
||||||||||||||
| SEN / CTL | P62942 | Peptidyl-prolyl cis-trans isomerase FKBP1A | FKBP1A | 1.54 | 0.59 | 0.00098 | 0.000356 |
protein peptidyl-prolyl isomerization,heart morpho... [More] |
peptidyl-prolyl cis-trans isomerase activity,signa... [More] |
cytoplasm,endoplasmic reticulum membrane,cytosol,t... [More] |
6 | 8 | 23 |
GWEEGVAQMSVGQR.2|GWEEGVAQMSVGQR.3|GWEEGVAQM[Oxi]SV... [More] |
||||||||||||||
| SEN / CTL | P26641 | Elongation factor 1-gamma | EEF1G | 1.53 | 0.41 | 0.0236 | 0.00595 |
translational elongation,glutathione metabolic pro... [More] |
translation elongation factor activity,glutathione... [More] |
nucleus,cytoplasm,cytosol,cell-cell adherens junct... [More] |
3 | 36 | 59 |
ALIAAQYSGAQVR.2|ALIAAQYSGAQVR.3|FAETQPK.2|STFVLDEF... [More] |
||||||||||||||
| SEN / CTL | P30041 | Peroxiredoxin-6 | PRDX6 | 1.52 | 1.3 | 1.74e-12 | 2.59e-12 |
response to reactive oxygen species,lipid cataboli... [More] |
glutathione peroxidase activity,protein binding,hy... [More] |
extracellular space,cytoplasm,lysosome,cytosol,cel... [More] |
45 | 31 | 62 |
FHDFLGDSWGILFSHPR.4|FHDFLGDSWGILFSHPR.3|FHDFLGDSWG... [More] |
||||||||||||||
| SEN / CTL | O14786 | Neuropilin-1 | NRP1 | 1.52 | 0.8 | 6.85e-8 | 5e-8 |
angiogenesis,patterning of blood vessels,neuron mi... [More] |
vascular endothelial growth factor-activated recep... [More] |
semaphorin receptor complex,extracellular space,ea... [More] |
18 | 12 | 14 |
EGNKPVLFQGNTNPTDVVVAVFPKPLITR.4|FVTAVGTQGAISK.2|YD... [More] |
||||||||||||||
| SEN / CTL | P05387 | 60S acidic ribosomal protein P2 | RPLP2 | 1.52 | 1.47 | 0.0000838 | 0.0000388 |
nuclear-transcribed mRNA catabolic process, nonsen... [More] |
structural constituent of ribosome,large ribosomal... [More] |
cytosol,focal adhesion,membrane,cytosolic large ri... [More] |
15 | 13 | 30 |
NIEDVIAQGIGK.2|NIEDVIAQGIGK.3|YVASYLLAALGGNSSPSAK.... [More] |
||||||||||||||
| SEN / CTL | P09211 | Glutathione S-transferase P | GSTP1 | 1.51 | 0.57 | 2.29e-11 | 3e-11 |
response to reactive oxygen species,negative regul... [More] |
glutathione transferase activity,glutathione perox... [More] |
extracellular space,intracellular,nucleus,cytoplas... [More] |
21 | 20 | 44 |
PPYTVVYFPVR.2|PPYTVVYFPVR.3|FQDGDLTLYQSNTILR.2|FQD... [More] |
||||||||||||||
| SEN / CTL | P14618 | Pyruvate kinase PKM | PKM | 1.5 | 1.17 | 7.05e-25 | 5.36e-24 |
programmed cell death,canonical glycolysis,cell-ce... [More] |
magnesium ion binding,pyruvate kinase activity,pro... [More] |
nucleus,cytoplasm,mitochondrion,cytosol,plasma mem... [More] |
102 | 71 | 161 |
GDLGIEIPAEK.2|IYVDDGLISLQVK.2|IYVDDGLISLQVK.3|KGVN... [More] |
||||||||||||||
| SEN / CTL | Q9UBR2 | Cathepsin Z | CTSZ | 1.5 | 1.25 | 0.000367 | 0.000148 |
angiotensin maturation,proteolysis,ER to Golgi ves... [More] |
cysteine-type endopeptidase activity,protein bindi... [More] |
Golgi membrane,extracellular space,lysosome,endopl... [More] |
12 | 16 | 25 |
STYPRPHEYLSPADLPK.4|STYPRPHEYLSPADLPK.3|VGDYGSLSGR... [More] |
||||||||||||||
| SEN / CTL | Q16881 | Thioredoxin reductase 1, cytoplasmic | TXNRD1 | 1.5 | 1.03 | 0.000904 | 0.000334 |
response to reactive oxygen species,mesoderm forma... [More] |
thioredoxin-disulfide reductase activity,electron ... [More] |
nucleus,mitochondrion,cytosol,extracellular exosom... [More] |
9 | 36 | 59 |
QFVPIKVEQIEAGTPGR.3|VVGFHVLGPNAGEVTQGFAAALK.3|VVGF... [More] |
||||||||||||||
| SEN / CTL | P39060 | Collagen alpha-1(XVIII) chain | COL18A1 | 1.49 | 0.69 | 0.00000403 | 0.00000227 |
angiogenesis,endothelial cell morphogenesis,cell a... [More] |
structural molecule activity,metal ion binding |
extracellular region,collagen trimer,basement memb... [More] |
12 | 31 | 46 |
IFSFDGKDVLR.3|AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR.4|... [More] |
||||||||||||||
| SEN / CTL | P07737 | Profilin-1 | PFN1 | 1.48 | 1.25 | 1.05e-11 | 1.48e-11 |
neural tube closure,positive regulation of epithel... [More] |
adenyl-nucleotide exchange factor activity,actin b... [More] |
nucleus,cytoplasm,cytosol,cytoskeleton,cell-cell a... [More] |
36 | 19 | 37 |
TFVNITPAEVGVLVGKDR.3|TFVNITPAEVGVLVGKDR.2|STGGAPTF... [More] |
||||||||||||||
| SEN / CTL | Q16555 | Dihydropyrimidinase-related protein 2 | DPYSL2 | 1.48 | 1.7 | 0.000621 | 0.000237 |
response to amphetamine,nucleobase-containing comp... [More] |
dihydropyrimidinase activity,protein binding,micro... [More] |
mitochondrion,cytosol,dendrite,growth cone,neurona... [More] |
12 | 35 | 74 |
AITIANQTNC[CAM]PLYITK.2|AITIANQTNC[CAM]PLYITK.3|GS... [More] |
||||||||||||||
| SEN / CTL | P58546 | Myotrophin | MTPN | 1.47 | 1.04 | 0.0000354 | 0.0000177 |
regulation of translation,catecholamine metabolic ... [More] |
sequence-specific DNA binding |
nucleus,cytosol,F-actin capping protein complex,ax... [More] |
12 | 13 | 27 |
TLEGGRKPLHYAADC[CAM]GQLEILEFLLLK.5|TLEGGRKPLHYAADC... [More] |
||||||||||||||
| SEN / CTL | P11142 | Heat shock cognate 71 kDa protein | HSPA8 | 1.46 | 1.17 | 3.38e-8 | 2.59e-8 |
mRNA splicing, via spliceosome,transcription, DNA-... [More] |
G-protein coupled receptor binding,phosphatidylser... [More] |
Prp19 complex,extracellular space,intracellular,nu... [More] |
45 | 50 | 118 |
ARFEELNADLFR.3|ARFEELNADLFR.2|DAGTIAGLNVLR.2|DAGTI... [More] |
||||||||||||||
| SEN / CTL | O60888 | Protein CutA | CUTA | 1.46 | 0.88 | 4.12e-8 | 3.13e-8 | protein localization,response to metal ion | copper ion binding,enzyme binding | membrane,extracellular exosome | 18 | 7 | 14 |
TQSSLVPALTDFVR.2|TQSSLVPALTDFVR.3|SVHPYEVAEVIALPVE... [More] |
||||||||||||||
| SEN / CTL | P07686 | Beta-hexosaminidase subunit beta | HEXB | 1.46 | 1.87 | 0.000109 | 0.00005 |
skeletal system development,glycosphingolipid meta... [More] |
beta-N-acetylhexosaminidase activity,acetylglucosa... [More] |
acrosomal vesicle,extracellular space,membrane,azu... [More] |
21 | 27 | 38 |
VLDIIATINK.2|EISEVFPDQFIHLGGDEVEFK.3|LAPGTIVEVWKDS... [More] |
||||||||||||||
| SEN / CTL | Q96TA1 | Niban-like protein 1 | FAM129B | 1.46 | 0.53 | 0.000702 | 0.000264 |
negative regulation of apoptotic process,cell-cell... [More] |
cadherin binding involved in cell-cell adhesion |
nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pl... [More] |
6 | 38 | 58 |
FQELIFEDFAR.2|ILTSVDQYLELIGNSLPGTTAK.3|ILTSVDQYLEL... [More] |
||||||||||||||
| SEN / CTL | P11413 | Glucose-6-phosphate 1-dehydrogenase | G6PD | 1.46 | 0.16 | 0.00496 | 0.00149 |
glucose metabolic process,pentose-phosphate shunt,... [More] |
glucose-6-phosphate dehydrogenase activity,glucose... [More] |
nucleus,cytoplasm,centrosome,microtubule organizin... [More] |
3 | 50 | 86 |
LFYLALPPTVYEAVTK.2|LFYLALPPTVYEAVTK.3|NVKLPDAYER.3... [More] |
||||||||||||||
| SEN / CTL | Q96CN7 | Isochorismatase domain-containing protein 1 | ISOC1 | 1.46 | 1.1 | 0.11 | 0.0239 | biological_process,metabolic process | molecular_function,catalytic activity | cytoplasm,peroxisome,extracellular exosome | 3 | 16 | 25 |
FSM[Oxi]VLPEVEAALAEIPGVR.3|FSMVLPEVEAALAEIPGVR.3|F... [More] |
||||||||||||||
| SEN / CTL |
O14818 Q8TAA3 |
Proteasome subunit alpha type-7;Proteasome subunit alpha type-7-like |
PSMA7 PSMA8 |
1.46 | 1.34 | 0.156 | 0.0329 |
MAPK cascade,protein polyubiquitination,stimulator... [More] |
threonine-type endopeptidase activity,protein bind... [More] |
proteasome complex,nucleus,nucleoplasm,cytosol,pro... [More] |
3 | 1 | 2 | LTVEDPVTVEYITR.2|LTVEDPVTVEYITR.3 | ||||||||||||||
| SEN / CTL | Q12805 | EGF-containing fibulin-like extracellular matrix protein 1 | EFEMP1 | 1.45 | 1.25 | 1.48e-11 | 2.01e-11 |
regulation of transcription, DNA-templated,epiderm... [More] |
epidermal growth factor-activated receptor activit... [More] |
extracellular region,proteinaceous extracellular m... [More] |
33 | 16 | 18 |
SVPSDIFQIQATTIYANTINTFR.3|RGEQC[CAM]VDIDEC[CAM]TIP... [More] |
||||||||||||||
| SEN / CTL |
P0DMV8 P0DMV9 |
Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B |
HSPA1A HSPA1B |
1.45 | 1.55 | 0.000309 | 0.000127 |
positive regulation of gene expression,regulation ... [More] |
virus receptor activity,G-protein coupled receptor... [More] |
nucleoplasm,cytoplasm,mitochondrion,centriole,cyto... [More] |
21 | 60 | 132 |
ARFEELC[CAM]SDLFR.3|ARFEELC[CAM]SDLFR.2|TTPSYVAFTD... [More] |
||||||||||||||
| SEN / CTL | P47756 | F-actin-capping protein subunit beta | CAPZB | 1.45 | 0.52 | 0.00133 | 0.000462 |
movement of cell or subcellular component,cytoskel... [More] |
actin binding,actin filament binding,cadherin bind... [More] |
cytosol,cytoskeleton,actin filament,cell-cell adhe... [More] |
6 | 22 | 40 |
SGSGTMNLGGSLTR.2|SGSGTM[Oxi]NLGGSLTR.2|SPWSNKYDPPL... [More] |
||||||||||||||
| SEN / CTL | O43707 | Alpha-actinin-4 | ACTN4 | 1.44 | 1.48 | 2.77e-14 | 5.02e-14 |
response to hypoxia,platelet degranulation,protein... [More] |
RNA polymerase II regulatory region sequence-speci... [More] |
stress fiber,extracellular region,extracellular sp... [More] |
108 | 85 | 169 |
VGWEQLLTTIAR.2|VGWEQLLTTIAR.3|ETTDTDTADQVIASFK.2|E... [More] |
||||||||||||||
| SEN / CTL | P16035 | Metalloproteinase inhibitor 2 | TIMP2 | 1.43 | 0.92 | 2.26e-8 | 1.85e-8 |
central nervous system development,aging,negative ... [More] |
protease binding,integrin binding,metalloendopepti... [More] |
extracellular region,proteinaceous extracellular m... [More] |
27 | 8 | 11 |
MHITLC[CAM]DFIVPWDTLSTTQKK.4|MHITLC[CAM]DFIVPWDTLS... [More] |
||||||||||||||
| SEN / CTL | P13929 | Beta-enolase | ENO3 | 1.43 | 0.36 | 0.00000244 | 0.00000143 |
gluconeogenesis,aging,response to drug,skeletal mu... [More] |
magnesium ion binding,phosphopyruvate hydratase ac... [More] |
phosphopyruvate hydratase complex,extracellular sp... [More] |
9 | 16 | 23 |
YGKDATNVGDEGGFAPNILENNEALELLK.4|VNQIGSVTESIQAC[CAM... [More] |
||||||||||||||
| SEN / CTL | P10253 | Lysosomal alpha-glucosidase | GAA | 1.43 | 1.56 | 0.00148 | 0.000501 |
maltose metabolic process,regulation of the force ... [More] |
alpha-1,4-glucosidase activity,oligo-1,6-glucosida... [More] |
lysosome,lysosomal membrane,membrane,lysosomal lum... [More] |
12 | 34 | 49 |
GAYTQVIFLAR.2|WTQLGAFYPFMR.2|WTQLGAFYPFM[Oxi]R.2|A... [More] |
||||||||||||||
| SEN / CTL | P27348 | 14-3-3 protein theta | YWHAQ | 1.43 | 1.72 | 0.00886 | 0.00249 |
protein targeting,small GTPase mediated signal tra... [More] |
protein binding,protein C-terminus binding,protein... [More] |
cytoplasm,mitochondrion,cytosol,focal adhesion,mem... [More] |
9 | 23 | 46 |
SIC[CAM]TTVLELLDKYLIANATNPESK.3|SIC[CAM]TTVLELLDKY... [More] |
||||||||||||||
| SEN / CTL | Q06481 | Amyloid-like protein 2 | APLP2 | 1.43 | 0.76 | 0.0639 | 0.0145 |
platelet degranulation,G-protein coupled receptor ... [More] |
DNA binding,serine-type endopeptidase inhibitor ac... [More] |
nucleus,plasma membrane,membrane,integral componen... [More] |
3 | 16 | 20 |
VPYVAQEIQEEIDELLQEQR.3|HYQHVLAVDPEK.3|HYQHVLAVDPEK... [More] |
||||||||||||||
| SEN / CTL | P28072 | Proteasome subunit beta type-6 | PSMB6 | 1.43 | 1.25 | 0.206 | 0.0426 |
MAPK cascade,protein polyubiquitination,stimulator... [More] |
endopeptidase activity,threonine-type endopeptidas... [More] |
proteasome complex,nucleus,nucleoplasm,cytoplasm,G... [More] |
3 | 11 | 17 |
LAAIAESGVER.2|DGSSGGVIR.2|VTDKLTPIHDR.3|VTDKLTPIHD... [More] |
||||||||||||||
| SEN / CTL | Q09666 | Neuroblast differentiation-associated protein AHNAK | AHNAK | 1.41 | 1.42 | 7.35e-15 | 1.36e-14 |
regulation of RNA splicing,protein oligomerization... [More] |
protein binding,S100 protein binding,poly(A) RNA b... [More] |
nucleus,cytoplasm,lysosomal membrane,cytosol,plasm... [More] |
78 | 433 | 666 |
ISMPEVDLNLKGPK.3|ISIPDVDLDLKGPK.3|ISMPDLDLNLKGPK.3... [More] |
||||||||||||||
| SEN / CTL | Q6EMK4 | Vasorin | VASN | 1.41 | 1.32 | 0.0000188 | 0.00000954 |
negative regulation of epithelial to mesenchymal t... [More] |
transforming growth factor beta binding,cadherin b... [More] |
extracellular space,mitochondrion,lysosomal membra... [More] |
15 | 8 | 8 |
SLTLGIEPVSPTSLR.2|LAGLGLQQLDEGLFSR.2|LLLLDLSHNSLLA... [More] |
||||||||||||||
| SEN / CTL | Q12841 | Follistatin-related protein 1 | FSTL1 | 1.4 | 0.89 | 0.00000415 | 0.00000232 | BMP signaling pathway,response to starvation |
calcium ion binding,protein binding,heparin bindin... [More] |
extracellular region,extracellular space,extracell... [More] |
15 | 12 | 12 |
LSFQEFLK.2|IIQWLEAEIIPDGWFSK.3|IC[CAM]ANVFC[CAM]GA... [More] |
||||||||||||||
| SEN / CTL | P00441 | Superoxide dismutase [Cu-Zn] | SOD1 | 1.39 | 0.62 | 2.48e-10 | 2.59e-10 |
activation of MAPK activity,response to reactive o... [More] |
superoxide dismutase activity,copper ion binding,p... [More] |
extracellular region,extracellular space,nucleus,n... [More] |
21 | 20 | 39 |
GLTEGLHGFHVHEFGDNTAGC[CAM]TSAGPHFNPLSR.5|GLTEGLHGF... [More] |
||||||||||||||
| SEN / CTL | P02461 | Collagen alpha-1(III) chain | COL3A1 | 1.39 | 1.38 | 6.07e-8 | 4.53e-8 |
skeletal system development,cell-matrix adhesion,t... [More] |
integrin binding,extracellular matrix structural c... [More] |
extracellular region,collagen type III trimer,extr... [More] |
30 | 25 | 27 |
SVNGQIESLISPDGSR.2|VFC[CAM]NMETGETC[CAM]ISANPLNVPR... [More] |
||||||||||||||
| SEN / CTL | P62258 | 14-3-3 protein epsilon | YWHAE | 1.39 | 2.21 | 0.00947 | 0.00266 |
G2/M transition of mitotic cell cycle,neuron migra... [More] |
protein binding,potassium channel regulator activi... [More] |
mitochondrion,cytosol,kinesin complex,cell-cell ad... [More] |
18 | 36 | 102 |
LIC[CAM]C[CAM]DILDVLDKHLIPAANTGESK.4|LIC[CAM]C[CAM... [More] |
||||||||||||||
| SEN / CTL | Q13442 | 28 kDa heat- and acid-stable phosphoprotein | PDAP1 | 1.39 | 1.55 | 0.127 | 0.0271 | signal transduction,cell proliferation | poly(A) RNA binding | 3 | 15 | 23 |
KVTQLDLDGPK.2|KVTQLDLDGPK.3|KVTQLDLDGPKELSR.4|KVTQ... [More] |
|||||||||||||||
| SEN / CTL | Q9BYZ2 | L-lactate dehydrogenase A-like 6B | LDHAL6B | 1.38 | 0.41 | 0.000385 | 0.000154 |
carbohydrate metabolic process,pyruvate metabolic ... [More] |
L-lactate dehydrogenase activity | nucleus,mitochondrial matrix | 6 | 1 | 2 | LIIVSNPVDILTYVAWK.3|LIIVSNPVDILTYVAWK.2 | ||||||||||||||
| SEN / CTL | P12814 | Alpha-actinin-1 | ACTN1 | 1.37 | 1.42 | 6.06e-17 | 1.4e-16 |
platelet degranulation,actin filament organization... [More] |
double-stranded RNA binding,integrin binding,calci... [More] |
stress fiber,ruffle,extracellular region,extracell... [More] |
81 | 84 | 180 |
DGLGFC[CAM]ALIHR.2|DGLGFC[CAM]ALIHR.3|LLETIDQLYLEY... [More] |
||||||||||||||
| SEN / CTL | Q9Y240 | C-type lectin domain family 11 member A | CLEC11A | 1.37 | 1.15 | 0.00000323 | 0.00000183 | positive regulation of cell proliferation | growth factor activity,carbohydrate binding | extracellular region,extracellular space,cytoplasm | 24 | 12 | 16 |
DFEAQAAAQAR.2|VVELTQGLR.2|LAGLDAGLHQLHVR.3|LAGLDAG... [More] |
||||||||||||||
| SEN / CTL | P52565 | Rho GDP-dissociation inhibitor 1 | ARHGDIA | 1.37 | 1.05 | 0.000183 | 0.0000804 |
movement of cell or subcellular component,negative... [More] |
Rho GDP-dissociation inhibitor activity,GTPase act... [More] |
cytosol,cytoskeleton,extracellular exosome | 15 | 15 | 29 |
AEEYEFLTPVEEAPK.2|AEEYEFLTPVEEAPK.3|SIQEIQELDKDDES... [More] |
||||||||||||||
| SEN / CTL | P08670 | Vimentin | VIM | 1.36 | 1.35 | 3.75e-24 | 2.59e-23 |
movement of cell or subcellular component,positive... [More] |
glycoprotein binding,double-stranded RNA binding,s... [More] |
cytoplasm,peroxisome,cytosol,cytoskeleton,intermed... [More] |
138 | 93 | 188 |
ILLAELEQLKGQGK.3|ILLAELEQLKGQGK.2|KVESLQEEIAFLK.3|... [More] |
||||||||||||||
| SEN / CTL | Q6YHK3 | CD109 antigen | CD109 | 1.36 | 1.2 | 3.47e-9 | 3.11e-9 |
negative regulation of protein phosphorylation,hai... [More] |
serine-type endopeptidase inhibitor activity,trans... [More] |
extracellular space,plasma membrane,cell surface,a... [More] |
30 | 27 | 34 |
ISVTQPDSIVGIVAVDK.2|TLTLPSLPLNSADEIYELR.3|TLTLPSLP... [More] |
||||||||||||||
| SEN / CTL | Q9P2E9 | Ribosome-binding protein 1 | RRBP1 | 1.36 | 0.71 | 0.00247 | 0.000793 |
osteoblast differentiation,translation,protein tra... [More] |
receptor activity,poly(A) RNA binding |
endoplasmic reticulum,ribosome,membrane,integral c... [More] |
6 | 99 | 145 |
SIEALLEAGQAR.2|SIEALLEAGQAR.3|LREAEETQSTLQAEC[CAM]... [More] |
||||||||||||||
| SEN / CTL | O00410 | Importin-5 | IPO5 | 1.36 | 0.92 | 0.00587 | 0.00173 |
protein import into nucleus, docking,protein impor... [More] |
GTPase inhibitor activity,protein binding,nuclear ... [More] |
nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla... [More] |
6 | 60 | 117 |
AIGTEPDSDVLSEIMHSFAK.3|AIGTEPDSDVLSEIMHSFAK.2|ITFL... [More] |
||||||||||||||
| SEN / CTL | Q9UHB6 | LIM domain and actin-binding protein 1 | LIMA1 | 1.36 | 0.89 | 0.0951 | 0.0209 |
negative regulation of actin filament depolymeriza... [More] |
actin monomer binding,zinc ion binding,actin filam... [More] |
stress fiber,cytoplasm,plasma membrane,brush borde... [More] |
3 | 53 | 80 |
LLANQQVFHISC[CAM]FR.3|LLANQQVFHISC[CAM]FR.2|ADHPPA... [More] |
||||||||||||||
| SEN / CTL | P29401 | Transketolase | TKT | 1.35 | 1.13 | 6.44e-7 | 4.01e-7 |
xylulose biosynthetic process,pentose-phosphate sh... [More] |
transketolase activity,protein homodimerization ac... [More] |
nucleus,nucleoplasm,peroxisome,cytosol,vesicle,mye... [More] |
18 | 53 | 103 |
ILATPPQEDAPSVDIANIR.3|ILATPPQEDAPSVDIANIR.2|ILATPP... [More] |
||||||||||||||
| SEN / CTL | P10909 | Clusterin | CLU | 1.34 | 1.48 | 0.000011 | 0.00000569 |
cell morphogenesis,microglial cell activation,rele... [More] |
protein binding,ubiquitin protein ligase binding,c... [More] |
extracellular region,extracellular space,nucleus,c... [More] |
21 | 25 | 42 |
LFDSDPITVTVPVEVSR.2|LFDSDPITVTVPVEVSR.3|ELDESLQVAE... [More] |
||||||||||||||
| SEN / CTL | P07900 | Heat shock protein HSP 90-alpha | HSP90AA1 | 1.34 | 1.12 | 0.000136 | 0.0000612 |
G2/M transition of mitotic cell cycle,neuron migra... [More] |
nucleotide binding,glycoprotein binding,UTP bindin... [More] |
extracellular region,nucleus,nucleoplasm,cytoplasm... [More] |
15 | 69 | 151 |
LVTSPC[CAM]C[CAM]IVTSTYGWTANMER.3|LVTSPC[CAM]C[CAM... [More] |
||||||||||||||
| SEN / CTL | P27797 | Calreticulin | CALR | 1.32 | 0.83 | 0.00000233 | 0.00000137 |
negative regulation of transcription from RNA poly... [More] |
complement component C1q binding,glycoprotein bind... [More] |
acrosomal vesicle,extracellular region,proteinaceo... [More] |
15 | 52 | 95 |
EQFLDGDGWTSR.2|FYALSASFEPFSNK.2|FYALSASFEPFSNK.3|S... [More] |
||||||||||||||
| SEN / CTL | P42785 | Lysosomal Pro-X carboxypeptidase | PRCP | 1.32 | 1.32 | 0.001 | 0.000363 |
regulation of thyroid hormone mediated signaling p... [More] |
serine-type carboxypeptidase activity,dipeptidyl-p... [More] |
lysosome,plasma membrane,basal part of cell,extrac... [More] |
12 | 11 | 19 |
NALDPMSVLLAR.2|NALDPMSVLLAR.3|NALDPM[Oxi]SVLLAR.2|... [More] |
||||||||||||||
| SEN / CTL | Q8NBS9 | Thioredoxin domain-containing protein 5 | TXNDC5 | 1.32 | 1.59 | 0.00252 | 0.0008 |
protein folding,response to endoplasmic reticulum ... [More] |
protein disulfide isomerase activity |
endoplasmic reticulum,endoplasmic reticulum lumen,... [More] |
15 | 30 | 49 |
GYPTLLLFR.2|GYPTLLWFR.2|DLESLREYVESQLQR.3|DLESLREY... [More] |
||||||||||||||
| SEN / CTL | P35052 | Glypican-1 | GPC1 | 1.31 | 1.21 | 2.86e-8 | 2.26e-8 |
retinoid metabolic process,glycosaminoglycan biosy... [More] |
copper ion binding,fibroblast growth factor bindin... [More] |
proteinaceous extracellular matrix,extracellular s... [More] |
24 | 13 | 13 |
VLQAMLATQLR.2|GFSLSDVPQAEISGEHLR.3|SFVQGLGVASDVVR.... [More] |
||||||||||||||
| SEN / CTL | P12259 | Coagulation factor V | F5 | 1.3 | 2.19 | 0.036 | 0.00882 |
platelet degranulation,proteolysis,ER to Golgi ves... [More] |
serine-type endopeptidase activity,copper ion bind... [More] |
Golgi membrane,extracellular region,extracellular ... [More] |
6 | 40 | 46 |
AEVDDVIQVR.2|DIHSGLIGPLLIC[CAM]QK.3|FC[CAM]ENPDEVK... [More] |
||||||||||||||
| SEN / CTL | Q16851 | UTP--glucose-1-phosphate uridylyltransferase | UGP2 | 1.3 | 1.1 | 0.118 | 0.0254 |
glycogen biosynthetic process,UDP-glucose metaboli... [More] |
UTP:glucose-1-phosphate uridylyltransferase activi... [More] |
nucleus,cytosol,extracellular exosome | 3 | 37 | 59 |
SFENSLGINVPR.2|SFENSLGINVPR.3|ILTTASSHEFEHTK.4|ILT... [More] |
||||||||||||||
| SEN / CTL | P00338 | L-lactate dehydrogenase A chain | LDHA | 1.29 | 1.86 | 5.53e-11 | 6.67e-11 |
response to hypoxia,lactate metabolic process,pyru... [More] |
L-lactate dehydrogenase activity,protein binding,k... [More] |
nucleus,cytosol,cell-cell adherens junction,membra... [More] |
60 | 38 | 92 |
LVIITAGAR.2|VTLTSEEEAR.2|SADTLWGIQKELQF.2|LLIVSNPV... [More] |
||||||||||||||
| SEN / CTL | P07951 | Tropomyosin beta chain | TPM2 | 1.29 | 1.1 | 1.87e-9 | 1.73e-9 |
muscle contraction,muscle filament sliding,regulat... [More] |
actin binding,structural constituent of muscle | cytosol,muscle thin filament tropomyosin | 42 | 34 | 56 |
IQLVEEELDR.2|IQLVEEELDRAQER.3|IQLVEEELDRAQER.2|RIQ... [More] |
||||||||||||||
| SEN / CTL | A5A3E0 | POTE ankyrin domain family member F | POTEF | 1.29 | 1.17 | 0.0015 | 0.000504 | retina homeostasis |
extracellular space,cell cortex,extracellular exos... [More] |
9 | 3 | 4 |
VAPEEHPVLLTEATLNPK.3|LC[CAM]YVALDFEQEMATVASSSSLEK.... [More] |
|||||||||||||||
| SEN / CTL | Q14118 | Dystroglycan | DAG1 | 1.29 | 0.51 | 0.0411 | 0.00987 |
morphogenesis of an epithelial sheet,protein O-lin... [More] |
virus receptor activity,dystroglycan binding,actin... [More] |
extracellular region,basement membrane,extracellul... [More] |
3 | 17 | 21 |
VTIPTDLIASSGDIIK.2|GGLSAVDAFEIHVHR.4|GGLSAVDAFEIHV... [More] |
||||||||||||||
| SEN / CTL | Q99715 | Collagen alpha-1(XII) chain | COL12A1 | 1.28 | 1.12 | 1.72e-35 | 1.86e-34 |
skeletal system development,cell adhesion,collagen... [More] |
extracellular matrix structural constituent confer... [More] |
extracellular region,collagen type XII trimer,extr... [More] |
153 | 96 | 114 |
IVEVFDIGPK.2|LLPETPSDPFAIWQITDRDYKPQVGVIADPSSK.4|N... [More] |
||||||||||||||
| SEN / CTL | P62158 | Calmodulin | CALM1 | 1.28 | 1.1 | 0.00000281 | 0.0000016 |
G2/M transition of mitotic cell cycle,MAPK cascade... [More] |
Ras guanyl-nucleotide exchange factor activity,cal... [More] |
spindle pole,extracellular region,nucleus,nucleopl... [More] |
21 | 13 | 30 |
VFDKDGNGYISAAELR.3|VFDKDGNGYISAAELR.2|EAFSLFDKDGDG... [More] |
||||||||||||||
| SEN / CTL | P07195 | L-lactate dehydrogenase B chain | LDHB | 1.27 | 2.19 | 0.00026 | 0.00011 |
carbohydrate metabolic process,lactate metabolic p... [More] |
L-lactate dehydrogenase activity,protein binding,k... [More] |
cytoplasm,mitochondrion,cytosol,membrane,myelin sh... [More] |
24 | 35 | 73 |
IVVVTAGVR.2|MVVESAYEVIK.2|MVVESAYEVIK.3|M[Oxi]VVES... [More] |
||||||||||||||
| SEN / CTL | P00742 | Coagulation factor X | F10 | 1.27 | 0.72 | 0.00569 | 0.00169 |
signal peptide processing,ER to Golgi vesicle-medi... [More] |
serine-type endopeptidase activity,calcium ion bin... [More] |
extracellular region,endoplasmic reticulum lumen,G... [More] |
6 | 13 | 15 |
ETYDFDIAVLR.2|MLEVPYVDR.2|TGIVSGFGR.2|NTEQEEGGEAVH... [More] |
||||||||||||||
| SEN / CTL | P08603 | Complement factor H | CFH | 1.26 | 1.09 | 1.6e-12 | 2.43e-12 |
complement activation,complement activation, alter... [More] |
protein binding,heparin binding,heparan sulfate pr... [More] |
extracellular region,extracellular space,extracell... [More] |
42 | 65 | 114 |
C[CAM]FEGFGIDGPAIAK.2|EIMENYNIALR.2|EIMENYNIALR.3|... [More] |
||||||||||||||
| SEN / CTL | P55290 | Cadherin-13 | CDH13 | 1.26 | 0.92 | 0.00458 | 0.00139 |
mitotic cell cycle,positive regulation of endothel... [More] |
calcium ion binding,low-density lipoprotein partic... [More] |
extracellular space,cytoplasm,plasma membrane,cave... [More] |
9 | 7 | 9 |
SIVVSPILIPENQR.2|DIQGSLQDIFK.2|TLEGPVPLEVIVIDQNDNR... [More] |
||||||||||||||
| SEN / CTL | P63104 | 14-3-3 protein zeta/delta | YWHAZ | 1.25 | 1.21 | 3.06e-7 | 1.94e-7 |
protein targeting,signal transduction,platelet act... [More] |
protein binding,transcription factor binding,prote... [More] |
extracellular space,nucleus,nucleoplasm,cytoplasm,... [More] |
24 | 22 | 53 |
IETELRDIC[CAM]NDVLSLLEK.3|IETELRDIC[CAM]NDVLSLLEK.... [More] |
||||||||||||||
| SEN / CTL | O60568 | Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 | PLOD3 | 1.25 | 1.51 | 0.00664 | 0.0019 |
in utero embryonic development,endothelial cell mo... [More] |
iron ion binding,protein binding,procollagen-lysin... [More] |
endoplasmic reticulum membrane,rough endoplasmic r... [More] |
24 | 41 | 68 |
VFLAVFVEQPTPFLPR.3|VFLAVFVEQPTPFLPR.2|QVGYEDQWLQLL... [More] |
||||||||||||||
| SEN / CTL | Q99497 | Protein deglycase DJ-1 | PARK7 | 1.24 | 0.96 | 0.000476 | 0.000187 |
negative regulation of protein phosphorylation,neg... [More] |
transcription coactivator activity,mRNA binding,re... [More] |
chromatin,nucleus,cytoplasm,mitochondrion,mitochon... [More] |
12 | 27 | 55 |
GAEEMETVIPVDVMR.2|GAEEMETVIPVDVMR.3|GAEEMETVIPVDVM... [More] |
||||||||||||||
| SEN / CTL | P07711 | Cathepsin L1 | CTSL | 1.23 | 0.78 | 0.0184 | 0.00474 |
toll-like receptor signaling pathway,adaptive immu... [More] |
fibronectin binding,cysteine-type endopeptidase ac... [More] |
extracellular region,extracellular space,nucleus,l... [More] |
6 | 9 | 13 |
VFQEPLFYEAPR.2|VFQEPLFYEAPR.3|NSWGEEWGMGGYVK.2|NSW... [More] |
||||||||||||||
| SEN / CTL | P55072 | Transitional endoplasmic reticulum ATPase | VCP | 1.22 | 1.68 | 1.2e-10 | 1.31e-10 |
DNA repair,double-strand break repair,NADH metabol... [More] |
protein binding,ATP binding,lipid binding,ATPase a... [More] |
proteasome complex,nucleus,nucleoplasm,cytoplasm,e... [More] |
42 | 94 | 187 |
LGDVISIQPC[CAM]PDVK.2|LGDVISIQPC[CAM]PDVK.3|LIVDEA... [More] |
||||||||||||||
| SEN / CTL | P14543 | Nidogen-1 | NID1 | 1.22 | 1.68 | 2.56e-8 | 2.07e-8 |
cell-matrix adhesion,positive regulation of cell-s... [More] |
calcium ion binding,collagen binding,laminin bindi... [More] |
extracellular region,basement membrane,basal lamin... [More] |
51 | 38 | 50 |
VYYREDLSPSITQR.3|VLFETDLVNPR.2|ALEGLQYPFAVTSYGK.2|... [More] |
||||||||||||||
| SEN / CTL | P98160 | Basement membrane-specific heparan sulfate proteoglycan core protein | HSPG2 | 1.21 | 1.1 | 4.48e-66 | 8.5e-65 |
retinoid metabolic process,angiogenesis,glycosamin... [More] |
calcium ion binding,protein binding,protein C-term... [More] |
extracellular region,basement membrane,extracellul... [More] |
291 | 163 | 239 |
AGLSSGFIGC[CAM]VR.2|FSSGITGC[CAM]VK.2|C[CAM]LIHDGA... [More] |
||||||||||||||
| SEN / CTL | P21291 | Cysteine and glycine-rich protein 1 | CSRP1 | 1.21 | 0.92 | 0.000624 | 0.000237 | platelet aggregation | zinc ion binding,poly(A) RNA binding | nucleus,focal adhesion,extracellular exosome | 9 | 16 | 31 |
GLESTTLADKDGEIYC[CAM]K.3|GLESTTLADKDGEIYC[CAM]K.2|... [More] |
||||||||||||||
| SEN / CTL | Q16769 | Glutaminyl-peptide cyclotransferase | QPCT | 1.2 | 0.36 | 0.0368 | 0.00895 |
cellular protein modification process,peptidyl-pyr... [More] |
zinc ion binding,glutaminyl-peptide cyclotransfera... [More] |
extracellular exosome | 3 | 7 | 8 |
VFVGATDSAVPC[CAM]AMMLELAR.3|VFVGATDSAVPC[CAM]AMMLE... [More] |
||||||||||||||
| SEN / CTL | O75083 | WD repeat-containing protein 1 | WDR1 | 1.19 | 0.83 | 6.47e-8 | 4.77e-8 |
platelet degranulation,sensory perception of sound... [More] |
actin filament binding |
podosome,extracellular region,cytoplasm,cytosol,ac... [More] |
21 | 47 | 76 |
LYSILGTTLKDEGK.3|LYSILGTTLKDEGK.2|YAPSGFYIASGDVSGK... [More] |
||||||||||||||
| SEN / CTL | P18206 | Vinculin | VCL | 1.17 | 1.35 | 8.46e-11 | 9.59e-11 |
morphogenesis of an epithelium,platelet degranulat... [More] |
dystroglycan binding,actin binding,structural mole... [More] |
extracellular region,cytosol,cytoskeleton,plasma m... [More] |
72 | 102 | 192 |
AIPDLTAPVAAVQAAVSNLVR.3|AIPDLTAPVAAVQAAVSNLVR.2|WI... [More] |
||||||||||||||
| SEN / CTL | Q32P28 | Prolyl 3-hydroxylase 1 | LEPRE1 | 1.17 | 0.08 | 0.00151 | 0.000504 |
protein folding,negative regulation of cell prolif... [More] |
molecular_function,iron ion binding,procollagen-pr... [More] |
proteinaceous extracellular matrix,endoplasmic ret... [More] |
3 | 29 | 36 |
GDWPGVVLSMER.2|TAIEEVQAERK.3|LTNVAATSGDGYR.3|LTNVA... [More] |
||||||||||||||
| SEN / CTL | Q96CG8 | Collagen triple helix repeat-containing protein 1 | CTHRC1 | 1.16 | 2.63 | 0.056 | 0.013 |
cell migration,positive regulation of protein bind... [More] |
frizzled binding,Wnt-protein binding |
proteinaceous extracellular matrix,collagen trimer... [More] |
6 | 3 | 3 | IIIEELPK.2|QC[CAM]SWSSLNYGIDLGK.2|GDASTGWNSVSR.2 | ||||||||||||||
| SEN / CTL | Q07954 | Prolow-density lipoprotein receptor-related protein 1 | LRP1 | 1.14 | 1.7 | 0.000283 | 0.000118 |
retinoid metabolic process,receptor-mediated endoc... [More] |
protease binding,receptor activity,low-density lip... [More] |
nucleolus,cytoplasm,lysosomal membrane,endosome,pl... [More] |
18 | 65 | 72 |
AALSGANVLTLIEKDIR.3|LDGLC[CAM]IPLR.2|VFFTDYGQIPK.2... [More] |
||||||||||||||
| SEN / CTL | P08123 | Collagen alpha-2(I) chain | COL1A2 | 1.13 | 1.28 | 1.57e-20 | 5.97e-20 |
skeletal system development,blood vessel developme... [More] |
extracellular matrix structural constituent,protei... [More] |
extracellular region,collagen type I trimer,extrac... [More] |
96 | 44 | 57 |
SLNNQIETLLTPEGSR.2|SLNNQIETLLTPEGSR.3|DYEVDATLK.2|... [More] |
||||||||||||||
| SEN / CTL | P68363 | Tubulin alpha-1B chain | TUBA1B | 1.13 | 1.02 | 3.18e-12 | 4.64e-12 |
microtubule cytoskeleton organization,microtubule-... [More] |
double-stranded RNA binding,GTPase activity,struct... [More] |
microtubule,cytoplasmic microtubule,myelin sheath,... [More] |
48 | 11 | 28 |
AVFVDLEPTVIDEVR.2|AVFVDLEPTVIDEVR.3|LISQIVSSITASLR... [More] |
||||||||||||||
| SEN / CTL | P13639 | Elongation factor 2 | EEF2 | 1.13 | 1.27 | 3.78e-10 | 3.83e-10 |
hematopoietic progenitor cell differentiation,resp... [More] |
p53 binding,translation elongation factor activity... [More] |
nucleus,cytoplasm,cytosol,plasma membrane,cell-cel... [More] |
48 | 83 | 182 |
VFSGLVSTGLK.2|LMEPIYLVEIQC[CAM]PEQVVGGIYGVLNR.3|LM... [More] |
||||||||||||||
| SEN / CTL | Q16270 | Insulin-like growth factor-binding protein 7 | IGFBP7 | 1.11 | 1.27 | 7.7e-7 | 4.76e-7 |
regulation of cell growth,cell adhesion,embryo imp... [More] |
protein binding,insulin-like growth factor binding |
extracellular region,extracellular space,extracell... [More] |
33 | 12 | 15 |
TELLPGDRDNLAIQTR.3|TELLPGDRDNLAIQTR.2|SRYPVC[CAM]G... [More] |
||||||||||||||
| SEN / CTL | P04083 | Annexin A1 | ANXA1 | 1.11 | 1.49 | 8.66e-7 | 5.26e-7 |
DNA strand renaturation,neutrophil homeostasis,ada... [More] |
single-stranded DNA binding,single-stranded RNA bi... [More] |
cornified envelope,phagocytic cup,extracellular re... [More] |
42 | 38 | 69 |
GLGTDEDTLIEILASR.2|GLGTDEDTLIEILASR.3|DLAKDITSDTSG... [More] |
||||||||||||||
| SEN / CTL | Q13361 | Microfibrillar-associated protein 5 | MFAP5 | 1.11 | 1.87 | 0.218 | 0.045 |
extracellular matrix organization,extracellular fi... [More] |
extracellular matrix structural constituent | microfibril,extracellular region | 3 | 2 | 2 | QC[CAM]IHQLC[CAM]FTSLR.3|EHEAMKDELC[CAM]R.3 | ||||||||||||||
| SEN / CTL | P02751 | Fibronectin | FN1 | 1.1 | 1.31 | 8.76e-83 | 3.33e-81 |
angiogenesis,regulation of protein phosphorylation... [More] |
protease binding,integrin binding,protein binding,... [More] |
extracellular region,fibrinogen complex,basal lami... [More] |
402 | 126 | 209 |
FLATTPNSLLVSWQPPR.3|FLATTPNSLLVSWQPPR.2|VTWAPPPSID... [More] |
||||||||||||||
| SEN / CTL | Q15063 | Periostin | POSTN | 1.1 | 1.37 | 1.15e-15 | 2.36e-15 |
skeletal system development,response to hypoxia,ne... [More] |
protein binding,heparin binding,metal ion binding,... [More] |
proteinaceous extracellular matrix,extracellular s... [More] |
81 | 48 | 80 |
GC[CAM]PAVLPIDHVYGTLGIVGATTTQR.3|GC[CAM]PAVLPIDHVY... [More] |
||||||||||||||
| SEN / CTL | O00468 | Agrin | AGRN | 1.1 | 1.65 | 0.0000797 | 0.0000372 |
retinoid metabolic process,glycosaminoglycan biosy... [More] |
dystroglycan binding,structural constituent of cyt... [More] |
extracellular region,basal lamina,cytoplasm,Golgi ... [More] |
36 | 54 | 64 |
SIESTLDDLFR.2|SFLAFPTLR.2|GKDFLALALLDGR.3|TEATQGLV... [More] |
||||||||||||||
| SEN / CTL | P30086 | Phosphatidylethanolamine-binding protein 1 | PEBP1 | 1.1 | 1 | 0.000494 | 0.000193 |
MAPK cascade,negative regulation of endopeptidase ... [More] |
serine-type endopeptidase inhibitor activity,prote... [More] |
nucleus,cytosol,extracellular exosome | 15 | 25 | 48 |
WSGPLSLQEVDEQPQHPLHVTYAGAAVDELGK.4|WSGPLSLQEVDEQPQ... [More] |
||||||||||||||
| SEN / CTL | P23528 | Cofilin-1 | CFL1 | 1.09 | 1.01 | 5.36e-11 | 6.57e-11 |
cytoskeleton organization,Rho protein signal trans... [More] |
protein binding,actin filament binding |
extracellular space,nucleus,cytoplasm,focal adhesi... [More] |
42 | 24 | 46 |
ESKKEDLVFIFWAPESAPLK.4|ESKKEDLVFIFWAPESAPLK.3|ESKK... [More] |
||||||||||||||
| SEN / CTL | O00584 | Ribonuclease T2 | RNASET2 | 1.09 | 0.7 | 0.0008 | 0.000296 |
RNA catabolic process,RNA phosphodiester bond hydr... [More] |
RNA binding,ribonuclease activity,ribonuclease T2 ... [More] |
extracellular region,extracellular space,lysosome,... [More] |
9 | 17 | 29 |
ELDLNSVLLK.2|SWPFNLEEIKDLLPEMR.3|LGIKPSINYYQVADFKD... [More] |
||||||||||||||
| SEN / CTL | P50395 | Rab GDP dissociation inhibitor beta | GDI2 | 1.07 | 1.36 | 3.01e-7 | 1.92e-7 |
signal transduction,small GTPase mediated signal t... [More] |
Rab GDP-dissociation inhibitor activity,GTPase act... [More] |
cytoplasm,Golgi apparatus,cytosol,focal adhesion,m... [More] |
36 | 56 | 113 |
KFDLGQDVIDFTGHALALYR.3|KFDLGQDVIDFTGHALALYR.4|KFDL... [More] |
||||||||||||||
| SEN / CTL | O00299 | Chloride intracellular channel protein 1 | CLIC1 | 1.07 | 1.63 | 0.0000602 | 0.0000289 |
chloride transport,signal transduction,regulation ... [More] |
voltage-gated ion channel activity,chloride channe... [More] |
extracellular space,nucleus,nuclear envelope,cytop... [More] |
24 | 24 | 42 |
LAALNPESNTAGLDIFAK.2|LAALNPESNTAGLDIFAK.3|GFTIPEAF... [More] |
||||||||||||||
| SEN / CTL |
P60709 P63261 |
Actin, cytoplasmic 1;Actin, cytoplasmic 2 |
ACTB ACTG1 |
1.05 | 1.52 | 6.46e-16 | 1.36e-15 |
retina homeostasis,movement of cell or subcellular... [More] |
structural constituent of cytoskeleton,protein bin... [More] |
nuclear chromatin,extracellular space,nucleoplasm,... [More] |
174 | 28 | 111 |
SYELPDGQVITIGNER.2|SYELPDGQVITIGNER.3|GYSFTTTAEREI... [More] |
||||||||||||||
| SEN / CTL | P68032 | Actin, alpha cardiac muscle 1 | ACTC1 | 1.05 | 1.12 | 0.0000104 | 0.0000055 |
apoptotic process,positive regulation of gene expr... [More] |
ATP binding,ATPase activity,myosin binding |
extracellular space,cytoplasm,cytosol,actin filame... [More] |
48 | 8 | 32 |
EKLC[CAM]YVALDFENEM[Oxi]ATAASSSSLEK.3|VAPEEHPTLLTE... [More] |
||||||||||||||
| SEN / CTL | Q05682 | Caldesmon | CALD1 | 1.04 | 1.82 | 0.00258 | 0.000819 |
movement of cell or subcellular component,muscle c... [More] |
actin binding,calmodulin binding,tropomyosin bindi... [More] |
cytosol,cytoskeleton,plasma membrane,cell-cell adh... [More] |
15 | 61 | 87 |
QKEFDPTITDASLSLPSRR.4|YEIEETETVTK.2|QERYEIEETETVTK... [More] |
||||||||||||||
| SEN / CTL | Q9H173 | Nucleotide exchange factor SIL1 | SIL1 | 1.03 | 1.39 | 0.0151 | 0.00401 | protein folding,intracellular protein transport | unfolded protein binding |
extracellular space,endoplasmic reticulum,endoplas... [More] |
9 | 9 | 11 |
VVTLLYDLVTEK.2|VLQTLGVLLTTC[CAM]R.2|VLQTLGVLLTTC[C... [More] |
||||||||||||||
| SEN / CTL | P04350 | Tubulin beta-4A chain | TUBB4A | 1.02 | 0.83 | 0.00191 | 0.000632 |
G2/M transition of mitotic cell cycle,cytoskeleton... [More] |
GTPase activity,structural constituent of cytoskel... [More] |
nucleus,cytosol,microtubule,cilium,internode regio... [More] |
12 | 7 | 19 |
MREIVHLQAGQC[CAM]GNQIGAK.4|MREIVHLQAGQC[CAM]GNQIGA... [More] |
||||||||||||||
| SEN / CTL | Q9ULV4 | Coronin-1C | CORO1C | 1.01 | 0.53 | 0.00692 | 0.00197 |
neural crest cell migration,regulation of protein ... [More] |
protein binding,Rac GTPase binding,actin filament ... [More] |
cytoplasm,focal adhesion,actin cytoskeleton,latera... [More] |
6 | 36 | 54 |
VTWDSSFC[CAM]AVNPR.2|AIFLADGNVFTTGFSR.2|AIFLADGNVF... [More] |
||||||||||||||
| SEN / CTL | Q10588 | ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 | BST1 | 1 | 0.37 | 0.0015 | 0.000504 |
humoral immune response,multicellular organism dev... [More] |
NAD+ nucleosidase activity,transferase activity,ph... [More] |
plasma membrane,extrinsic component of membrane,an... [More] |
6 | 11 | 13 |
VADFLSWC[CAM]R.2|FMPLSDVLYGR.2|ALLSPEQR.2|GEGTSAHL... [More] |
||||||||||||||
| SEN / CTL | P00352 | Retinal dehydrogenase 1 | ALDH1A1 | 1 | 1.18 | 0.00225 | 0.000725 |
ethanol oxidation,cellular aldehyde metabolic proc... [More] |
retinal dehydrogenase activity,aldehyde dehydrogen... [More] |
cytoplasm,cytosol,extracellular exosome | 12 | 44 | 78 |
LYSNAYLNDLAGC[CAM]IK.2|LYSNAYLNDLAGC[CAM]IK.3|TIPI... [More] |
||||||||||||||
| SEN / CTL | Q92626 | Peroxidasin homolog | PXDN | 0.99 | 1.05 | 0.0000106 | 0.00000557 |
negative regulation of cytokine-mediated signaling... [More] |
peroxidase activity,interleukin-1 receptor antagon... [More] |
proteinaceous extracellular matrix,extracellular s... [More] |
24 | 30 | 36 |
SPNDLLALFR.2|LYGSTLNIDLFPALVVEDLVPGSR.3|ISGVALHDQG... [More] |
||||||||||||||
| SEN / CTL | Q14697 | Neutral alpha-glucosidase AB | GANAB | 0.99 | 1.71 | 0.000277 | 0.000116 | carbohydrate metabolic process,protein folding |
carbohydrate binding,glucan 1,3-alpha-glucosidase ... [More] |
endoplasmic reticulum lumen,Golgi apparatus,membra... [More] |
27 | 70 | 141 |
YFTWDPSRFPQPR.3|SLLLSVNAR.2|LSFQHDPETSVLVLR.3|LSFQ... [More] |
||||||||||||||
| SEN / CTL | Q9H299 | SH3 domain-binding glutamic acid-rich-like protein 3 | SH3BGRL3 | 0.99 | 0.89 | 0.0393 | 0.00952 |
regulation of actin filament depolymerization,regu... [More] |
GTPase activator activity,electron carrier activit... [More] |
nucleus,cytoplasm,lamellipodium,extracellular exos... [More] |
6 | 7 | 15 |
IQYQLVDISQDNALRDEMR.3|IQYQLVDISQDNALRDEMR.4|IQYQLV... [More] |
||||||||||||||
| SEN / CTL | Q562R1 | Beta-actin-like protein 2 | ACTBL2 | 0.98 | 0.37 | 4.41e-10 | 4.41e-10 | biological_process | molecular_function,ATP binding |
extracellular space,cytoplasm,cytoskeleton,extrace... [More] |
18 | 9 | 17 |
KDLYANTVLSGGSTM[Oxi]YPGIADR.3|VAPDEHPILLTEAPLNPK.3... [More] |
||||||||||||||
| SEN / CTL | P13611 | Versican core protein | VCAN | 0.98 | 1.3 | 0.0327 | 0.00808 |
skeletal system development,osteoblast differentia... [More] |
extracellular matrix structural constituent,calciu... [More] |
extracellular region,proteinaceous extracellular m... [More] |
6 | 17 | 23 |
YTLNFEAAQK.2|LATVGELQAAWR.2|YEINSLIR.2|VGHDYQWIGLN... [More] |
||||||||||||||
| SEN / CTL | P05090 | Apolipoprotein D | APOD | 0.98 | 2.96 | 0.0557 | 0.013 |
response to reactive oxygen species,angiogenesis,g... [More] |
lipid transporter activity,protein binding,cholest... [More] |
extracellular region,extracellular space,endoplasm... [More] |
6 | 11 | 13 |
C[CAM]PNPPVQENFDVNKYLGR.3|WYEIEKIPTTFENGR.3|VLNQEL... [More] |
||||||||||||||
| SEN / CTL | P02452 | Collagen alpha-1(I) chain | COL1A1 | 0.96 | 1.35 | 2.32e-10 | 2.44e-10 |
skeletal system development,blood vessel developme... [More] |
extracellular matrix structural constituent,protei... [More] |
extracellular region,collagen type I trimer,extrac... [More] |
66 | 47 | 55 |
DRDLEVDTTLK.3|DRDLEVDTTLK.2|SGEYWIDPNQGC[CAM]NLDAI... [More] |
||||||||||||||
| SEN / CTL | Q9Y696 | Chloride intracellular channel protein 4 | CLIC4 | 0.95 | 1.12 | 0.000295 | 0.000122 |
angiogenesis,endothelial cell morphogenesis,chlori... [More] |
voltage-gated ion channel activity,chloride channe... [More] |
intracellular,cytoplasm,mitochondrion,centrosome,c... [More] |
15 | 25 | 45 |
YLTNAYSRDEFTNTC[CAM]PSDKEVEIAYSDVAK.4|TDVNKIEEFLEE... [More] |
||||||||||||||
| SEN / CTL | Q3ZCM7 | Tubulin beta-8 chain | TUBB8 | 0.95 | 0.87 | 0.183 | 0.0383 |
oocyte maturation,spindle assembly involved in fem... [More] |
molecular_function,GTPase activity,structural cons... [More] |
cytoplasm,microtubule,extracellular exosome,meioti... [More] |
3 | 4 | 13 |
LPTPTYGDLNHLVSATMSGVTTC[CAM]LR.3|ALTVAELTQQM[Oxi]F... [More] |
||||||||||||||
| SEN / CTL | Q92734 | Protein TFG | TFG | 0.95 | 1 | 0.223 | 0.0458 |
signal transduction,positive regulation of I-kappa... [More] |
signal transducer activity,protein binding,identic... [More] |
Golgi membrane,cytoplasm,cytosol,extracellular exo... [More] |
3 | 17 | 33 |
RIPIHNEDITYDELVLMMQR.4|RIPIHNEDITYDELVLM[Oxi]MQR.4... [More] |
||||||||||||||
| SEN / CTL | P37802 | Transgelin-2 | TAGLN2 | 0.93 | 1.62 | 2.41e-7 | 1.56e-7 | epithelial cell differentiation,cell-cell adhesion | cadherin binding involved in cell-cell adhesion |
cell-cell adherens junction,vesicle,extracellular ... [More] |
39 | 26 | 53 |
QMEQISQFLQAAER.2|QMEQISQFLQAAER.3|QM[Oxi]EQISQFLQA... [More] |
||||||||||||||
| SEN / CTL | P60981 | Destrin | DSTN | 0.93 | 0.74 | 0.0169 | 0.00445 |
actin polymerization or depolymerization,actin fil... [More] |
protein binding,actin filament binding |
actin cytoskeleton,cortical actin cytoskeleton,ext... [More] |
6 | 22 | 34 |
YALYDASFETK.2|KEELMFFLWAPELAPLK.3|KEELM[Oxi]FFLWAP... [More] |
||||||||||||||
| SEN / CTL | Q71U36 | Tubulin alpha-1A chain | TUBA1A | 0.93 | 1.23 | 0.0183 | 0.00474 |
G2/M transition of mitotic cell cycle,cytoskeleton... [More] |
GTPase activity,structural molecule activity,struc... [More] |
nucleus,cytosol,microtubule,cytoplasmic microtubul... [More] |
6 | 36 | 88 |
TIQFVDWC[CAM]PTGFK.2|TIQFVDWC[CAM]PTGFK.3|RTIQFVDW... [More] |
||||||||||||||
| SEN / CTL | P50454 | Serpin H1 | SERPINH1 | 0.92 | 0.78 | 4.84e-15 | 9.43e-15 |
chondrocyte development involved in endochondral b... [More] |
serine-type endopeptidase inhibitor activity,colla... [More] |
endoplasmic reticulum,endoplasmic reticulum lumen,... [More] |
48 | 33 | 71 |
LYGPSSVSFADDFVR.2|LYGPSSVSFADDFVR.3|AVLSAEQLRDEEVH... [More] |
||||||||||||||
| SEN / CTL | Q9Y490 | Talin-1 | TLN1 | 0.91 | 0.87 | 1.34e-18 | 3.93e-18 |
platelet degranulation,movement of cell or subcell... [More] |
integrin binding,structural constituent of cytoske... [More] |
ruffle,extracellular region,cytoplasm,microtubule ... [More] |
69 | 186 | 355 |
GLAGAVSELLR.2|AVASAAAALVLK.2|TLAESALQLLYTAK.2|TLAE... [More] |
||||||||||||||
| SEN / CTL | P26038 | Moesin | MSN | 0.91 | 1.32 | 5.07e-8 | 3.81e-8 |
movement of cell or subcellular component,cytoskel... [More] |
double-stranded RNA binding,actin binding,receptor... [More] |
uropod,extracellular space,nucleus,cytoplasm,cytos... [More] |
39 | 60 | 110 |
IGFPWSEIR.2|ERQEAEEAKEALLQASR.3|ERQEAEEAKEALLQASR.... [More] |
||||||||||||||
| SEN / CTL | Q14847 | LIM and SH3 domain protein 1 | LASP1 | 0.91 | 1.06 | 0.00212 | 0.000692 |
ion transport,positive regulation of signal transd... [More] |
SH3/SH2 adaptor activity,protein binding,zinc ion ... [More] |
cytoplasm,cell-cell adherens junction,focal adhesi... [More] |
12 | 20 | 35 |
QSFTMVADTPENLR.2|QSFTMVADTPENLR.3|QSFTM[Oxi]VADTPE... [More] |
||||||||||||||
| SEN / CTL | P81605 | Dermcidin | DCD | 0.89 | 1.16 | 0.173 | 0.0363 |
proteolysis,killing of cells of other organism,def... [More] |
peptidase activity,poly(A) RNA binding |
extracellular region,extracellular matrix,extracel... [More] |
3 | 4 | 6 |
LGKDAVEDLESVGK.3|LGKDAVEDLESVGK.2|GAVHDVKDVLDSVL.3... [More] |
||||||||||||||
| SEN / CTL | P04075 | Fructose-bisphosphate aldolase A | ALDOA | 0.88 | 1.21 | 7.71e-19 | 2.44e-18 |
platelet degranulation,fructose metabolic process,... [More] |
actin binding,fructose-bisphosphate aldolase activ... [More] |
extracellular region,extracellular space,nucleus,c... [More] |
87 | 51 | 110 |
VDKGVVPLAGTNGETTTQGLDGLSER.3|VDKGVVPLAGTNGETTTQGLD... [More] |
||||||||||||||
| SEN / CTL | P25788 | Proteasome subunit alpha type-3 | PSMA3 | 0.88 | 0.97 | 0.0362 | 0.00885 |
MAPK cascade,protein polyubiquitination,stimulator... [More] |
threonine-type endopeptidase activity,protein bind... [More] |
proteasome complex,nucleus,nucleoplasm,cytoplasm,c... [More] |
6 | 15 | 25 |
AVENSSTAIGIR.2|VFQVEYAMK.2|VFQVEYAM[Oxi]K.2|C[CAM]... [More] |
||||||||||||||
| SEN / CTL | P52907 | F-actin-capping protein subunit alpha-1 | CAPZA1 | 0.86 | 1.15 | 0.0254 | 0.00636 |
protein complex assembly,movement of cell or subce... [More] |
actin binding,cadherin binding involved in cell-ce... [More] |
extracellular region,cytosol,cytoskeleton,cell-cel... [More] |
9 | 20 | 42 |
FTITPPTAQVVGVLK.2|FTITPPTAQVVGVLK.3|LLLNNDNLLR.2|L... [More] |
||||||||||||||
| SEN / CTL | Q96D15 | Reticulocalbin-3 | RCN3 | 0.85 | 1.41 | 0.000255 | 0.000109 | calcium ion binding | endoplasmic reticulum lumen | 15 | 13 | 20 |
AGDGDGWVSLAELR.2|EVAKEFDQLTPEESQAR.3|EVAKEFDQLTPEE... [More] |
|||||||||||||||
| SEN / CTL | Q6UVK1 | Chondroitin sulfate proteoglycan 4 | CSPG4 | 0.85 | 0.75 | 0.00339 | 0.00105 |
activation of MAPK activity,angiogenesis,transmemb... [More] |
signal transducer activity,protein kinase binding |
extracellular region,Golgi lumen,integral componen... [More] |
9 | 46 | 56 |
GSLLLGGLDAEASR.2|ALLHVWAGGPWPQGATLR.3|ALLHVWAGGPWP... [More] |
||||||||||||||
| SEN / CTL | P01344 | Insulin-like growth factor II | IGF2 | 0.84 | 0.54 | 0.0067 | 0.00191 |
skeletal system development,ossification,positive ... [More] |
insulin receptor binding,insulin-like growth facto... [More] |
extracellular region,extracellular space,plasma me... [More] |
6 | 2 | 3 |
GIVEEC[CAM]C[CAM]FR.2|SC[CAM]DLALLETYC[CAM]ATPAK.2... [More] |
||||||||||||||
| SEN / CTL | P35555 | Fibrillin-1 | FBN1 | 0.83 | 0.84 | 1.34e-11 | 1.85e-11 |
skeletal system development,metanephros developmen... [More] |
integrin binding,hormone activity,extracellular ma... [More] |
microfibril,extracellular region,proteinaceous ext... [More] |
48 | 32 | 32 |
ILELLPALTTLTNHNR.3|TLPGGNQC[CAM]IVPIC[CAM]R.2|TC[C... [More] |
||||||||||||||
| SEN / CTL | Q15293 | Reticulocalbin-1 | RCN1 | 0.83 | 3.59 | 0.123 | 0.0265 |
in utero embryonic development,camera-type eye dev... [More] |
calcium ion binding | endoplasmic reticulum,endoplasmic reticulum lumen | 15 | 29 | 48 |
AADLNGDLTATR.2|HWILPQDYDHAQAEAR.4|HWILPQDYDHAQAEAR... [More] |
||||||||||||||
| SEN / CTL | Q14112 | Nidogen-2 | NID2 | 0.82 | 1.57 | 0.0979 | 0.0215 |
cell adhesion,cell-matrix adhesion,extracellular m... [More] |
calcium ion binding,protein binding,collagen bindi... [More] |
extracellular region,basement membrane,extracellul... [More] |
27 | 46 | 60 |
VLYREDTSPAVLGLAAR.3|AIAVDPIRGNLYWTDWNR.3|AGLELGAEP... [More] |
||||||||||||||
| SEN / CTL | P15144 | Aminopeptidase N | ANPEP | 0.8 | 1.38 | 0.000186 | 0.0000812 |
angiogenesis,proteolysis,cell differentiation,pept... [More] |
virus receptor activity,aminopeptidase activity,re... [More] |
extracellular space,lysosomal membrane,endoplasmic... [More] |
15 | 60 | 99 |
YLSYTLNPDLIR.2|YLSYTLNPDLIR.3|ENKEVVLQWFTENSK.3|EN... [More] |
||||||||||||||
| SEN / CTL | P28300 | Protein-lysine 6-oxidase | LOX | 0.8 | 0.7 | 0.0346 | 0.0085 |
cellular protein modification process,heart develo... [More] |
protein-lysine 6-oxidase activity,copper ion bindi... [More] |
extracellular region,proteinaceous extracellular m... [More] |
6 | 2 | 3 |
YTGHHAYASGC[CAM]TISPY.3|YTGHHAYASGC[CAM]TISPY.2|NQ... [More] |
||||||||||||||
| SEN / CTL | P35442 | Thrombospondin-2 | THBS2 | 0.79 | 0.41 | 0.00000467 | 0.00000259 |
cell adhesion,negative regulation of angiogenesis,... [More] |
calcium ion binding,heparin binding |
extracellular region,basement membrane,platelet al... [More] |
15 | 8 | 9 |
GTLLALEGPGLSQR.2|SC[CAM]DVTSNTC[CAM]LGPSIQTR.2|GLL... [More] |
||||||||||||||
| SEN / CTL | P08294 | Extracellular superoxide dismutase [Cu-Zn] | SOD3 | 0.79 | 1.28 | 0.00144 | 0.000493 |
response to reactive oxygen species,response to hy... [More] |
superoxide dismutase activity,copper ion binding,p... [More] |
extracellular region,extracellular space,nucleus,c... [More] |
21 | 10 | 14 |
VTEIWQEVMQR.2|VTEIWQEVM[Oxi]QR.2|VTGVVLFR.2|LAC[CA... [More] |
||||||||||||||
| SEN / CTL | Q14315 | Filamin-C | FLNC | 0.77 | 1.22 | 6.29e-9 | 5.49e-9 | cell junction assembly,muscle fiber development |
protein binding,cytoskeletal protein binding,ankyr... [More] |
cytoplasm,cytosol,cytoskeleton,plasma membrane,foc... [More] |
51 | 146 | 209 |
LIALLEVLSQK.2|VAVGQEQAFSVNTR.2|YGGDEIPYSPFR.2|YWPT... [More] |
||||||||||||||
| SEN / CTL | P05452 | Tetranectin | CLEC3B | 0.77 | 1.93 | 0.0022 | 0.00071 |
ossification,platelet degranulation,positive regul... [More] |
calcium ion binding,heparin binding,carbohydrate b... [More] |
granular component,extracellular region,extracellu... [More] |
21 | 11 | 14 |
LDTLAQEVALLK.2|GGTLGTPQTGSENDALYEYLR.3|GGTLGTPQTGS... [More] |
||||||||||||||
| SEN / CTL | P10321 | HLA class I histocompatibility antigen, Cw-7 alpha chain | HLA-C | 0.75 | 2.06 | 0.00000156 | 9.25e-7 | 27 | 12 | 15 |
AYLEGTC[CAM]VEWLR.2|SWTAADTAAQITQR.2|SWTAADTAAQITQ... [More] |
|||||||||||||||||
| SEN / CTL | P63241 | Eukaryotic translation initiation factor 5A-1 | EIF5A | 0.75 | 1.6 | 0.00103 | 0.000369 |
mRNA export from nucleus,translational frameshifti... [More] |
RNA binding,translation elongation factor activity... [More] |
nucleus,annulate lamellae,nuclear pore,cytoplasm,e... [More] |
15 | 19 | 41 |
VHLVGIDIFTGK.3|VHLVGIDIFTGK.2|RNDFQLIGIQDGYLSLLQDS... [More] |
||||||||||||||
| SEN / CTL | Q01518 | Adenylyl cyclase-associated protein 1 | CAP1 | 0.75 | 0.37 | 0.00376 | 0.00116 |
cell morphogenesis,ameboidal-type cell migration,r... [More] |
actin binding,adenylate cyclase binding |
plasma membrane,focal adhesion,cortical actin cyto... [More] |
6 | 51 | 99 |
SSEMNVLIPTEGGDFNEFPVPEQFK.3|SSEMNVLIPTEGGDFNEFPVPE... [More] |
||||||||||||||
| SEN / CTL | Q92520 | Protein FAM3C | FAM3C | 0.73 | 1.03 | 0.0397 | 0.00958 |
platelet degranulation,multicellular organism deve... [More] |
cytokine activity |
extracellular region,Golgi apparatus,platelet dens... [More] |
9 | 12 | 17 |
MDASLGNLFAR.2|IC[CAM]LEDNVLMSGVK.2|IC[CAM]LEDNVLM[... [More] |
||||||||||||||
| SEN / CTL | P06396 | Gelsolin | GSN | 0.72 | 1.08 | 2.42e-7 | 1.56e-7 |
phagocytosis, engulfment,positive regulation of ge... [More] |
actin binding,calcium ion binding,protein binding,... [More] |
podosome,extracellular region,extracellular space,... [More] |
45 | 53 | 102 |
QTQVSVLPEGGETPLFK.2|QTQVSVLPEGGETPLFK.3|AGALNSNDAF... [More] |
||||||||||||||
| SEN / CTL | Q06830 | Peroxiredoxin-1 | PRDX1 | 0.72 | 1.38 | 0.00000873 | 0.00000467 |
response to reactive oxygen species,skeletal syste... [More] |
peroxidase activity,protein binding,thioredoxin pe... [More] |
extracellular space,nucleus,cytoplasm,mitochondrio... [More] |
30 | 29 | 60 |
GLFIIDDKGILR.3|GLFIIDDKGILR.2|LVQAFQFTDKHGEVC[CAM]... [More] |
||||||||||||||
| SEN / CTL | O95967 | EGF-containing fibulin-like extracellular matrix protein 2 | EFEMP2 | 0.72 | 0.53 | 0.000137 | 0.0000612 |
extracellular matrix structural constituent,calciu... [More] |
extracellular region,basement membrane,extracellul... [More] |
12 | 6 | 6 |
SC[CAM]VDVNEC[CAM]DMGAPC[CAM]EQR.2|C[CAM]INHYGGYLC... [More] |
|||||||||||||||
| SEN / CTL | P10599 | Thioredoxin | TXN | 0.72 | 1.58 | 0.0606 | 0.0138 |
sulfate assimilation,negative regulation of transc... [More] |
protein binding,protein disulfide oxidoreductase a... [More] |
nucleus,nucleoplasm,cytoplasm,mitochondrion,cytoso... [More] |
12 | 12 | 20 |
C[CAM]MPTFQFFK.2|C[CAM]M[Oxi]PTFQFFK.2|VGEFSGANKEK... [More] |
||||||||||||||
| SEN / CTL | P12110 | Collagen alpha-2(VI) chain | COL6A2 | 0.7 | 1.66 | 1.38e-12 | 2.14e-12 |
cell adhesion,response to glucose,extracellular ma... [More] |
extracellular region,proteinaceous extracellular m... [More] |
60 | 42 | 57 |
AAVFHEKDYDSLAQPGFFDR.4|AAVFHEKDYDSLAQPGFFDR.3|VFAV... [More] |
|||||||||||||||
| SEN / CTL | Q6NZI2 | Polymerase I and transcript release factor | PTRF | 0.7 | 0.94 | 0.000958 | 0.00035 |
regulation of transcription, DNA-templated,transcr... [More] |
protein binding,rRNA primary transcript binding,po... [More] |
nucleus,nucleoplasm,cytoplasm,mitochondrion,endopl... [More] |
15 | 15 | 23 |
QAEMEGAVQSIQGELSK.3|QAEMEGAVQSIQGELSK.2|QAEM[Oxi]E... [More] |
||||||||||||||
| SEN / CTL | P00747 | Plasminogen | PLG | 0.7 | 1.32 | 0.013 | 0.00353 |
platelet degranulation,proteolysis,blood coagulati... [More] |
serine-type endopeptidase activity,receptor bindin... [More] |
extracellular region,extracellular space,plasma me... [More] |
12 | 58 | 96 |
TPENYPNAGLTMNYC[CAM]R.3|TPENYPNAGLTMNYC[CAM]R.2|TP... [More] |
||||||||||||||
| SEN / CTL | P26599 | Polypyrimidine tract-binding protein 1 | PTBP1 | 0.69 | 1.81 | 0.0418 | 0.01 |
alternative mRNA splicing, via spliceosome,regulat... [More] |
nucleotide binding,RNA binding,protein binding,pol... [More] |
nucleoplasm,nucleolus,membrane,extracellular exoso... [More] |
6 | 35 | 87 |
KLPIDVTEGEVISLGLPFGK.3|KLPIDVTEGEVISLGLPFGK.4|KLPI... [More] |
||||||||||||||
| SEN / CTL | P08133 | Annexin A6 | ANXA6 | 0.68 | 0.81 | 0.00963 | 0.00268 |
calcium ion transport,regulation of muscle contrac... [More] |
calcium ion binding,protein binding,GTP binding,ca... [More] |
mitochondrion,lysosomal membrane,focal adhesion,me... [More] |
15 | 72 | 121 |
GLGTDEDTIIDIITHR.3|GLGTDEDTIIDIITHR.2|GFGSDKEAILDI... [More] |
||||||||||||||
| SEN / CTL | O95084 | Serine protease 23 | PRSS23 | 0.67 | 0.74 | 0.0109 | 0.003 | proteolysis | serine-type endopeptidase activity | nucleus,extracellular exosome | 6 | 5 | 6 |
YAQIC[CAM]YWIK.2|LSTGC[CAM]TGTLVAEK.2|LEVSSSC[CAM]... [More] |
||||||||||||||
| SEN / CTL | P14625 | Endoplasmin | HSP90B1 | 0.66 | 2.09 | 0.000124 | 0.0000565 |
response to hypoxia,toll-like receptor signaling p... [More] |
RNA binding,calcium ion binding,protein binding,AT... [More] |
extracellular region,nucleus,endoplasmic reticulum... [More] |
24 | 85 | 166 |
GVVDSDDLPLNVSR.2|GVVDSDDLPLNVSR.3|FAFQAEVNR.2|FQSS... [More] |
||||||||||||||
| SEN / CTL | Q15019 | Septin-2 | 2-Sep | 0.66 | 0.75 | 0.00635 | 0.00185 |
regulation of L-glutamate transport,mitotic nuclea... [More] |
protein binding,GTP binding,enzyme regulator activ... [More] |
exocyst,condensed chromosome kinetochore,nucleus,n... [More] |
9 | 30 | 53 |
TIISYIDEQFER.2|ASIPFSVVGSNQLIEAK.2|ASIPFSVVGSNQLIE... [More] |
||||||||||||||
| SEN / CTL | P20908 | Collagen alpha-1(V) chain | COL5A1 | 0.65 | 0.68 | 5.98e-7 | 3.75e-7 |
blood vessel development,heart morphogenesis,cell ... [More] |
integrin binding,extracellular matrix structural c... [More] |
extracellular region,collagen type V trimer,baseme... [More] |
33 | 15 | 18 |
SPVFLYEDHTGKPGPEDYPLFR.4|QLYPASAFPEDFSILTTVK.2|FLG... [More] |
||||||||||||||
| SEN / CTL | P13797 | Plastin-3 | PLS3 | 0.65 | 0.87 | 0.0142 | 0.00382 |
actin filament bundle assembly,actin filament netw... [More] |
calcium ion binding,actin filament binding | cytoplasm,actin filament,actin filament bundle | 15 | 45 | 74 |
VYALPEDLVEVKPK.3|VYALPEDLVEVKPK.2|MVMTVFAC[CAM]LMG... [More] |
||||||||||||||
| SEN / CTL | O43852 | Calumenin | CALU | 0.64 | 0.8 | 0.0000754 | 0.0000356 | biological_process | calcium ion binding,protein binding |
extracellular region,endoplasmic reticulum,endopla... [More] |
21 | 34 | 62 |
WIYEDVER.2|IDGDKDGFVTVDELKDWIK.4|IDGDKDGFVTVDELKDW... [More] |
||||||||||||||
| SEN / CTL | P15311 | Ezrin | EZR | 0.64 | 1.25 | 0.0237 | 0.00595 |
negative regulation of transcription from RNA poly... [More] |
actin binding,protein binding,microtubule binding,... [More] |
ruffle,immunological synapse,uropod,extracellular ... [More] |
12 | 50 | 90 |
QRIDEFEAL.2|SQEQLAAELAEYTAK.2|SQEQLAAELAEYTAK.3|GM... [More] |
||||||||||||||
| SEN / CTL | Q13740 | CD166 antigen | ALCAM | 0.64 | 1.11 | 0.0729 | 0.0163 |
adaptive immune response,cell adhesion,heterophili... [More] |
receptor binding,protein binding |
immunological synapse,integral component of plasma... [More] |
9 | 30 | 45 |
EMDPVTQLYTMTSTLEYK.3|EMDPVTQLYTMTSTLEYK.2|VLHPLEGA... [More] |
||||||||||||||
| SEN / CTL |
O60565 Q9H772 |
Gremlin-1;Gremlin-2 |
GREM1 GREM2 |
0.63 | 0.47 | 0.145 | 0.0309 |
cell morphogenesis,branching involved in ureteric ... [More] |
cytokine activity,protein binding,morphogen activi... [More] |
extracellular space,cell surface;extracellular reg... [More] |
3 | 1 | 1 | FC[CAM]YGQC[CAM]NSFYIPR.2 | ||||||||||||||
| SEN / CTL | Q9Y4K0 | Lysyl oxidase homolog 2 | LOXL2 | 0.62 | 0.85 | 0.00000769 | 0.0000042 |
response to hypoxia,epithelial to mesenchymal tran... [More] |
chromatin binding,transcription corepressor activi... [More] |
basement membrane,extracellular space,nucleus,nucl... [More] |
27 | 16 | 19 |
VVC[CAM]GMFGFPGER.2|LGQGIGPIHLNEIQC[CAM]TGNEK.3|NG... [More] |
||||||||||||||
| SEN / CTL | Q14019 | Coactosin-like protein | COTL1 | 0.62 | 0.66 | 0.00497 | 0.00149 | biological_process,defense response to fungus | actin binding,enzyme binding |
nucleus,cytoplasm,cytoskeleton,extracellular exoso... [More] |
12 | 20 | 26 |
SKFALITWIGENVSGLQR.3|SKFALITWIGENVSGLQR.2|FALITWIG... [More] |
||||||||||||||
| SEN / CTL | P08758 | Annexin A5 | ANXA5 | 0.59 | 1.5 | 7.82e-9 | 6.75e-9 |
signal transduction,blood coagulation,response to ... [More] |
phospholipase inhibitor activity,calcium ion bindi... [More] |
intracellular,cytoplasm,focal adhesion,external si... [More] |
36 | 45 | 70 |
GLGTDEESILTLLTSR.3|GLGTDEESILTLLTSR.2|SEIDLFNIR.2|... [More] |
||||||||||||||
| SEN / CTL | P09972 | Fructose-bisphosphate aldolase C | ALDOC | 0.59 | 1.11 | 0.00131 | 0.000458 |
fructose metabolic process,gluconeogenesis,fructos... [More] |
fructose-bisphosphate aldolase activity,protein bi... [More] |
mitochondrion,cytosol,cytoskeleton,extracellular e... [More] |
12 | 27 | 42 |
VDKGVVPLAGTDGETTTQGLDGLSER.3|VDKGVVPLAGTDGETTTQGLD... [More] |
||||||||||||||
| SEN / CTL | Q04760 | Lactoylglutathione lyase | GLO1 | 0.59 | 1.42 | 0.0798 | 0.0177 |
carbohydrate metabolic process,pyruvate metabolic ... [More] |
lactoylglutathione lyase activity,zinc ion binding | cytoplasm,cytosol,extracellular exosome | 6 | 16 | 31 |
GLAFIQDPDGYWIEILNPNK.3|GLAFIQDPDGYWIEILNPNK.2|GFGH... [More] |
||||||||||||||
| SEN / CTL | P09486 | SPARC | SPARC | 0.56 | 0.98 | 6.64e-10 | 6.56e-10 |
ossification,negative regulation of endothelial ce... [More] |
calcium ion binding,protein binding,collagen bindi... [More] |
extracellular region,basement membrane,extracellul... [More] |
48 | 14 | 22 |
YIPPC[CAM]LDSELTEFPLR.3|YIPPC[CAM]LDSELTEFPLR.2|FF... [More] |
||||||||||||||
| SEN / CTL | P02787 | Serotransferrin | TF | 0.54 | 0.66 | 0.0596 | 0.0136 |
retina homeostasis,platelet degranulation,cellular... [More] |
protein binding,ferrous iron binding,ferric iron b... [More] |
extracellular region,extracellular space,early end... [More] |
6 | 86 | 160 |
C[CAM]LVEKGDVAFVK.3|C[CAM]LVEKGDVAFVK.2|NPDPWAK.2|... [More] |
||||||||||||||
| SEN / CTL |
P61224 P62834 |
Ras-related protein Rap-1b;Ras-related protein Rap-1A |
RAP1B RAP1A |
0.54 | 1.54 | 0.173 | 0.0363 |
cell proliferation,response to carbohydrate,Rap pr... [More] |
GTPase activity,protein binding,GTP binding,GDP bi... [More] |
intracellular,lipid particle,cytosol,plasma membra... [More] |
6 | 2 | 3 | SKINVNEIFYDLVR.3|SKINVNEIFYDLVR.2|LVVLGSGGVGK.2 | ||||||||||||||
| SEN / CTL | P17936 | Insulin-like growth factor-binding protein 3 | IGFBP3 | 0.53 | 1.15 | 0.0000597 | 0.0000289 |
regulation of cell growth,osteoblast differentiati... [More] |
fibronectin binding,protein binding,insulin-like g... [More] |
extracellular region,extracellular space,nucleus,i... [More] |
24 | 10 | 13 |
C[CAM]QPSPDEARPLQALLDGR.3|FLNVLSPR.2|EPGC[CAM]GC[C... [More] |
||||||||||||||
| SEN / CTL | P05121 | Plasminogen activator inhibitor 1 | SERPINE1 | 0.53 | 1.12 | 0.00103 | 0.000369 |
chronological cell aging,angiogenesis,platelet deg... [More] |
protease binding,serine-type endopeptidase inhibit... [More] |
extracellular region,extracellular space,plasma me... [More] |
18 | 9 | 10 |
MAPEEIIMDRPFLFVVR.3|HNPTGTVLFMGQVMEP.2|QFQADFTSLSD... [More] |
||||||||||||||
| SEN / CTL | P32119 | Peroxiredoxin-2 | PRDX2 | 0.51 | 1.14 | 0.00705 | 0.002 |
response to reactive oxygen species,response to ox... [More] |
thioredoxin peroxidase activity,antioxidant activi... [More] |
cytoplasm,cytosol,extracellular exosome | 9 | 24 | 40 |
KEGGLGPLNIPLLADVTR.3|KEGGLGPLNIPLLADVTR.2|ATAVVDGA... [More] |
||||||||||||||
| SEN / CTL | P01023 | Alpha-2-macroglobulin | A2M | 0.5 | 1.34 | 0.00143 | 0.000491 |
negative regulation of complement activation, lect... [More] |
protease binding,serine-type endopeptidase inhibit... [More] |
extracellular region,cytosol,platelet alpha granul... [More] |
33 | 89 | 144 |
QTVSWAVTPK.2|ATVLNYLPK.2|IAQWQSFQLEGGLKQFSFPLSSEPF... [More] |
||||||||||||||
| SEN / CTL | P61158 | Actin-related protein 3 | ACTR3 | 0.49 | 1.48 | 0.00101 | 0.000363 |
movement of cell or subcellular component,establis... [More] |
structural constituent of cytoskeleton,ATP binding... [More] |
cytosol,Arp2/3 protein complex,brush border,cell-c... [More] |
18 | 34 | 61 |
DITYFIQQLLR.2|DITYFIQQLLR.3|HGIVEDWDLMER.3|HGIVEDW... [More] |
||||||||||||||
| SEN / CTL | P01008 | Antithrombin-III | SERPINC1 | 0.49 | 0.9 | 0.0829 | 0.0184 |
acute inflammatory response to antigenic stimulus,... [More] |
protease binding,serine-type endopeptidase inhibit... [More] |
extracellular region,extracellular space,plasma me... [More] |
6 | 31 | 70 |
TSDQIHFFFAK.3|TSDQIHFFFAK.2|FRIEDGFSLK.3|FRIEDGFSL... [More] |
||||||||||||||
| SEN / CTL | P00734 | Prothrombin | F2 | 0.48 | 0.63 | 0.0729 | 0.0163 |
positive regulation of protein phosphorylation,sig... [More] |
serine-type endopeptidase activity,receptor bindin... [More] |
extracellular region,extracellular space,endoplasm... [More] |
6 | 42 | 86 |
SPQELLC[CAM]GASLISDR.2|SPQELLC[CAM]GASLISDR.3|KSPQ... [More] |
||||||||||||||
| SEN / CTL | O00622 | Protein CYR61 | CYR61 | 0.45 | 0.77 | 0.0188 | 0.00483 |
regulation of cell growth,osteoblast differentiati... [More] |
integrin binding,insulin-like growth factor bindin... [More] |
proteinaceous extracellular matrix,extracellular m... [More] |
9 | 17 | 20 |
GLEC[CAM]NFGASSTALK.2|HQC[CAM]TC[CAM]IDGAVGC[CAM]I... [More] |
||||||||||||||
| SEN / CTL | Q9BRK5 | 45 kDa calcium-binding protein | SDF4 | 0.43 | 1.86 | 0.0444 | 0.0105 |
UV protection,calcium ion regulated exocytosis,cer... [More] |
calcium ion binding,identical protein binding |
cytoplasm,late endosome,Golgi apparatus,Golgi lume... [More] |
9 | 20 | 30 |
WYQADSPPADLLLTEEEFLSFLHPEHSR.4|DLGGFDEDAEPR.2|AVDP... [More] |
||||||||||||||
| SEN / CTL | P20742 | Pregnancy zone protein | PZP | 0.43 | 0.84 | 0.127 | 0.0271 |
female pregnancy,negative regulation of endopeptid... [More] |
endopeptidase inhibitor activity,serine-type endop... [More] |
extracellular region,extracellular exosome,blood m... [More] |
6 | 23 | 26 |
DLFHC[CAM]VSFTLPR.3|DLFHC[CAM]VSFTLPR.2|SGTHTLPVES... [More] |
||||||||||||||
| SEN / CTL | P18065 | Insulin-like growth factor-binding protein 2 | IGFBP2 | 0.42 | 1.23 | 0.0172 | 0.0045 |
regulation of cell growth,signal transduction,fema... [More] |
receptor binding,insulin-like growth factor I bind... [More] |
extracellular region,extracellular space,apical pl... [More] |
15 | 11 | 14 |
TPC[CAM]QQELDQVLER.2|LEGEAC[CAM]GVYTPR.2|MPC[CAM]A... [More] |
||||||||||||||
| SEN / CTL | P35908 | Keratin, type II cytoskeletal 2 epidermal | KRT2 | 0.4 | 1.24 | 1.5e-7 | 1.02e-7 |
keratinocyte development,epidermis development,ker... [More] |
structural constituent of cytoskeleton,protein bin... [More] |
extracellular space,nucleus,cytoplasm,Golgi appara... [More] |
75 | 54 | 102 |
YEELQVTVGR.2|FLEQQNQVLQTK.2|FLEQQNQVLQTK.3|VDLLNQE... [More] |
||||||||||||||
| SEN / CTL | P13645 | Keratin, type I cytoskeletal 10 | KRT10 | 0.37 | 1.44 | 0.0000545 | 0.0000267 | keratinocyte differentiation | structural constituent of epidermis |
extracellular space,nucleus,cytoplasm,intermediate... [More] |
120 | 51 | 100 |
TIDDLKNQILNLTTDNANILLQIDNAR.4|TIDDLKNQILNLTTDNANIL... [More] |
||||||||||||||
| SEN / CTL | P54727 | UV excision repair protein RAD23 homolog B | RAD23B | 0.36 | 1.82 | 0.068 | 0.0154 |
nucleotide-excision repair, DNA damage recognition... [More] |
damaged DNA binding,single-stranded DNA binding,pr... [More] |
proteasome complex,nucleus,nucleoplasm,cytoplasm,X... [More] |
6 | 20 | 33 |
QIIQQNPSLLPALLQQIGR.3|QIIQQNPSLLPALLQQIGR.4|QIIQQN... [More] |
||||||||||||||
| SEN / CTL | P07437 | Tubulin beta chain | TUBB | 0.34 | 1.12 | 3.86e-13 | 6.38e-13 |
G2/M transition of mitotic cell cycle,movement of ... [More] |
GTPase activity,structural molecule activity,struc... [More] |
extracellular region,nucleus,nuclear envelope lume... [More] |
57 | 20 | 59 |
YLTVAAVFR.2|NSSYFVEWIPNNVK.2|NSSYFVEWIPNNVK.3|AILV... [More] |
||||||||||||||
| SEN / CTL | P09936 | Ubiquitin carboxyl-terminal hydrolase isozyme L1 | UCHL1 | 0.33 | 2.19 | 0.0147 | 0.00391 |
response to ischemia,axon target recognition,adult... [More] |
cysteine-type endopeptidase activity,thiol-depende... [More] |
nucleoplasm,cytoplasm,endoplasmic reticulum membra... [More] |
30 | 20 | 39 |
C[CAM]FEKNEAIQAAHDAVAQEGQC[CAM]R.4|C[CAM]FEKNEAIQA... [More] |
||||||||||||||
| SEN / CTL | P01024 | Complement C3 | C3 | 0.31 | 1.57 | 0.0000059 | 0.00000325 |
positive regulation of type IIa hypersensitivity,p... [More] |
serine-type endopeptidase activity,endopeptidase i... [More] |
extracellular region,extracellular space,plasma me... [More] |
39 | 130 | 202 |
YYGGGYGSTQATFMVFQALAQYQK.3|GYTQQLAFR.2|SGIPIVTSPYQ... [More] |
||||||||||||||
| SEN / CTL | O00469 | Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 | PLOD2 | 0.31 | 1.64 | 0.24 | 0.0486 |
response to hypoxia,cellular protein modification ... [More] |
iron ion binding,procollagen-lysine 5-dioxygenase ... [More] |
endoplasmic reticulum,endoplasmic reticulum membra... [More] |
9 | 33 | 47 |
YLNSGGFIGYAPYVNR.2|AC[CAM]DELVEEMEHYGK.3|GFALLNFVV... [More] |
||||||||||||||
| SEN / CTL | P12107 | Collagen alpha-1(XI) chain | COL11A1 | 0.31 | 0.36 | 0.247 | 0.0499 |
cartilage condensation,ossification,chondrocyte de... [More] |
extracellular matrix structural constituent,protei... [More] |
extracellular region,collagen type XI trimer,endop... [More] |
3 | 8 | 8 |
SPVFLFEDHTGKPAPEDYPLFR.4|ALDFHNSPEGISK.3|DGLPGHPGQ... [More] |
||||||||||||||
| SEN / CTL | P08572 | Collagen alpha-2(IV) chain | COL4A2 | 0.3 | 1.08 | 0.0423 | 0.0101 |
angiogenesis,transcription, DNA-templated,negative... [More] |
extracellular matrix structural constituent |
extracellular region,collagen type IV trimer,endop... [More] |
15 | 15 | 19 |
SVSIGYLLVK.2|FSTMPFLYC[CAM]NPGDVC[CAM]YYASR.3|RGPP... [More] |
||||||||||||||
| SEN / CTL | Q00610 | Clathrin heavy chain 1 | CLTC | 0.29 | 1.95 | 0.0000337 | 0.000017 |
osteoblast differentiation,intracellular protein t... [More] |
double-stranded RNA binding,structural molecule ac... [More] |
spindle,cytosol,plasma membrane,focal adhesion,mem... [More] |
30 | 154 | 302 |
LLLPWLEAR.2|SVDPTLALSVYLR.2|VANVELYYR.2|SVNESLNNLF... [More] |
||||||||||||||
| SEN / CTL | P04114 | Apolipoprotein B-100 | APOB | 0.29 | 0.77 | 0.0798 | 0.0177 |
retinoid metabolic process,in utero embryonic deve... [More] |
protein binding,phospholipid binding,heparin bindi... [More] |
extracellular region,extracellular space,cytoplasm... [More] |
15 | 186 | 272 |
IEGNLIFDPNNYLPK.2|GFEPTLEALFGK.2|ENFAGEATLQR.2|TEV... [More] |
||||||||||||||
| SEN / CTL | P07996 | Thrombospondin-1 | THBS1 | 0.27 | 1.45 | 1.92e-9 | 1.75e-9 |
activation of MAPK activity,response to hypoxia,ne... [More] |
phosphatidylserine binding,glycoprotein binding,fi... [More] |
extracellular region,fibrinogen complex,extracellu... [More] |
126 | 63 | 89 |
FVFGTTPEDILR.2|GFLLLASLR.2|TIVTTLQDSIR.2|GGVNDNFQG... [More] |
||||||||||||||
| SEN / CTL | P05997 | Collagen alpha-2(V) chain | COL5A2 | 0.27 | 0.88 | 0.168 | 0.0355 |
skeletal system development,ossification,extracell... [More] |
molecular_function,extracellular matrix structural... [More] |
extracellular region,collagen type V trimer,endopl... [More] |
12 | 14 | 15 |
GSQFAYGDHQSPNTAITQMTFLR.3|SPDNKPVWYGLDMNR.3|QSGEYW... [More] |
||||||||||||||
| SEN / CTL | P02545 | Prelamin-A/C | LMNA | 0.11 | 2.08 | 3.04e-11 | 3.92e-11 |
mitotic nuclear envelope disassembly,mitotic nucle... [More] |
structural molecule activity,protein binding |
nucleus,nuclear envelope,lamin filament,nucleoplas... [More] |
57 | 85 | 142 |
VAVEEVDEEGKFVR.3|VAVEEVDEEGKFVR.2|LQLELSK.2|IRIDSL... [More] |
||||||||||||||
| SEN / CTL | P36955 | Pigment epithelium-derived factor | SERPINF1 | 0.04 | 1.8 | 0.0000962 | 0.0000443 |
kidney development,multicellular organism developm... [More] |
serine-type endopeptidase inhibitor activity,prote... [More] |
extracellular region,basement membrane,extracellul... [More] |
39 | 20 | 26 |
DTDTGALLFIGK.2|LAAAVSNFGYDLYR.2|LAAAVSNFGYDLYR.3|S... [More] |
||||||||||||||
| SEN / CTL | P04259 | Keratin, type II cytoskeletal 6B | KRT6B | 0.03 | 1.52 | 0.095 | 0.0209 | cytoskeleton organization,ectoderm development |
structural constituent of cytoskeleton,protein bin... [More] |
keratin filament,extracellular exosome | 21 | 9 | 14 |
YEELQITAGR.2|YEELQITAGR.1|SGFSSISVSR.2|VLDTKWTLLQE... [More] |
||||||||||||||
| SEN / CTL | Q9NR12 | PDZ and LIM domain protein 7 | PDLIM7 | -0.01 | 2.36 | 0.201 | 0.0417 |
ossification,receptor-mediated endocytosis,multice... [More] |
protein binding,zinc ion binding |
stress fiber,ruffle,nucleus,cytoplasm,cell-cell ju... [More] |
9 | 23 | 36 |
VVLEGPAPWGFR.2|VVLEGPAPWGFR.3|VLEEGGFFEEK.2|LQGGKD... [More] |
||||||||||||||
| SEN / CTL | P08729 | Keratin, type II cytoskeletal 7 | KRT7 | -0.09 | 0.77 | 0.195 | 0.0406 | viral process | structural molecule activity,protein binding |
nucleus,cytoplasm,intermediate filament,keratin fi... [More] |
12 | 52 | 77 |
LALDIEIATYR.2|VDALNDEINFLR.2|SSRLPDIFEAQIAGLR.3|SS... [More] |
||||||||||||||
| SEN / CTL |
P02042 P02100 P68871 P69891 P69892 |
Hemoglobin subunit delta;Hemoglobin subunit epsilon;Hemoglobin subunit beta;Hemoglobin subunit gamma-1;Hemoglobin subunit gamma-2 |
HBD HBE1 HBB HBG1 HBG2 |
-0.28 | 0.53 | 0.112 | 0.0242 |
blood coagulation,oxygen transport;blood coagulati... [More] |
oxygen transporter activity,iron ion binding,prote... [More] |
cytosol,hemoglobin complex,blood microparticle;cyt... [More] |
6 | 1 | 2 | LLVVYPWTQR.2|LLVVYPWTQR.3 | ||||||||||||||
| SEN / CTL | Q02413 | Desmoglein-1 | DSG1 | -0.41 | 1.23 | 0.226 | 0.0464 |
cell-cell junction assembly,homophilic cell adhesi... [More] |
calcium ion binding,protein binding,toxic substanc... [More] |
cytosol,plasma membrane,cytoplasmic side of plasma... [More] |
15 | 21 | 32 |
IIRQEPSDSPMFIINR.3|VIAPSSSLPTSLTIHHPR.4|VIAPSSSLPT... [More] |
||||||||||||||
| SEN / CTL | P50995 | Annexin A11 | ANXA11 | -0.47 | 1.14 | 0.0568 | 0.0132 |
phagocytosis,cell cycle,cell division,response to ... [More] |
calcium ion binding,protein binding,calcium-depend... [More] |
nuclear envelope,nucleoplasm,cytoplasm,spindle,mem... [More] |
6 | 29 | 45 |
NTPAFFAER.2|GVGTDEAC[CAM]LIEILASR.3|GVGTDEAC[CAM]L... [More] |
||||||||||||||
| SEN / CTL | P29279 | Connective tissue growth factor | CTGF | -0.55 | 0.85 | 0.0269 | 0.00673 |
cartilage condensation,ossification,angiogenesis,r... [More] |
fibronectin binding,integrin binding,protein bindi... [More] |
extracellular region,proteinaceous extracellular m... [More] |
9 | 8 | 8 |
DGAPC[CAM]IFGGTVYR.2|C[CAM]PAGVSLVLDGC[CAM]GC[CAM]... [More] |
||||||||||||||
| SEN / CTL | P67936 | Tropomyosin alpha-4 chain | TPM4 | -0.85 | 2.41 | 0.102 | 0.0222 |
osteoblast differentiation,movement of cell or sub... [More] |
actin binding,calcium ion binding,protein binding,... [More] |
stress fiber,podosome,cytosol,cytoskeleton,muscle ... [More] |
18 | 25 | 42 |
KIQALQQQADEAEDRAQGLQR.4|KIQALQQQADEAEDRAQGLQR.3|KI... [More] |
||||||||||||||
| SEN / CTL | P02533 | Keratin, type I cytoskeletal 14 | KRT14 | -1.14 | 1.68 | 0.0139 | 0.00374 |
aging,epidermis development,response to zinc ion,r... [More] |
structural constituent of cytoskeleton,protein bin... [More] |
nucleus,cytoplasm,cytosol,intermediate filament,ke... [More] |
135 | 50 | 89 |
VLDELTLAR.2|ILTATVDNANVLLQIDNAR.3|ILTATVDNANVLLQID... [More] |
||||||||||||||
| SEN / CTL | Q93084 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 | ATP2A3 | -1.23 | 1.98 | 0.101 | 0.0221 |
transport,calcium ion transport,cellular calcium i... [More] |
calcium-transporting ATPase activity,ATP binding,m... [More] |
endoplasmic reticulum,endoplasmic reticulum membra... [More] |
9 | 26 | 35 |
SLPSVETLGC[CAM]TSVIC[CAM]SDK.2|SLPSVETLGC[CAM]TSVI... [More] |
||||||||||||||
| SEN / CTL | P02538 | Keratin, type II cytoskeletal 6A | KRT6A | -1.35 | 1.41 | 1.22e-7 | 8.4e-8 |
morphogenesis of an epithelium,cytoskeleton organi... [More] |
structural constituent of cytoskeleton,protein bin... [More] |
nucleus,membrane,keratin filament,extracellular ex... [More] |
126 | 61 | 85 |
YEELQVTAGR.2|ADTLTDEINFLR.2|ADTLTDEINFLR.3|QNLEPLF... [More] |
||||||||||||||
| SEN / CTL | P08779 | Keratin, type I cytoskeletal 16 | KRT16 | -1.57 | 1.4 | 2.14e-9 | 1.94e-9 |
morphogenesis of an epithelium,inflammatory respon... [More] |
structural constituent of cytoskeleton,protein bin... [More] |
nucleus,cytoskeleton,intermediate filament,extrace... [More] |
96 | 25 | 45 |
APSTYGGGLSVSSR.2|DAETWFLSK.2|LLEGEDAHLSSQQASGQSYSS... [More] |
||||||||||||||
| SEN / CTL |
P11055 P12882 Q9UKX2 |
Myosin-3;Myosin-1;Myosin-2 |
MYH3 MYH1 MYH2 |
-1.63 | 2.06 | 0.0103 | 0.00285 |
skeletal muscle contraction,protein dephosphorylat... [More] |
microfilament motor activity,calmodulin binding,AT... [More] |
cytosol,muscle myosin complex,sarcomere,myosin fil... [More] |
9 | 3 | 3 | HADSVAELGEQIDNLQR.3|GSSFQTVSALFR.2|LASADIETYLLEK.2 | ||||||||||||||
| SEN / CTL |
P12883 P13533 |
Myosin-7;Myosin-6 |
MYH7 MYH6 |
-1.68 | 1.58 | 0.231 | 0.0472 |
regulation of the force of heart contraction,regul... [More] |
microfilament motor activity,actin binding,protein... [More] |
stress fiber,muscle myosin complex,myosin complex,... [More] |
3 | 1 | 1 | IEELEEELEAER.2 | ||||||||||||||
| SEN / CTL | Q04695 | Keratin, type I cytoskeletal 17 | KRT17 | -1.75 | 1.86 | 0.00619 | 0.00181 |
signal transduction,epidermis development,positive... [More] |
structural constituent of cytoskeleton,MHC class I... [More] |
cytoplasm,intermediate filament,extracellular exos... [More] |
30 | 28 | 43 |
ALEEANTELEVK.2|LSVEADINGLRR.3|LSVEADINGLRR.2|ILTAT... [More] |
||||||||||||||
| Reference: SenQuest | ||||||||||||||||||||||||||||