Post-radiation SASP in human fibroblasts (day 10)

Comparison

UniProtIds

Protein Description

Genes

Log2 Ratio

Std. Dev.

PValue

QValue

GO Biological Process

GO Molecular Process

GO Cellular Process

Ratios

Unique Peptides

Elution Groups

Elution Group

SEN / CTL

O76094

Signal recognition particle subunit SRP72

SRP72

12.07

0.8

0.00145

0.00172

SRP-dependent cotranslational protein targeting to...

signal recognition particle binding,protein bindin...

nucleolus,cytoplasm,endoplasmic reticulum,signal r...

56

39

56

_ISQGNISK_.2|_HLPSSDSMSLK_.3|_HLPSSDSM[+16]SLK_.2|...

SEN / CTL

P22087

rRNA 2'-O-methyltransferase fibrillarin

FBL

10.4

2.39

0.0172

0.0102

box C/D snoRNA 3'-end processing,osteoblast differ...

TFIID-class transcription factor binding,RNA bindi...

dense fibrillar component,granular component,nucle...

47

26

47

_VSISEGDDKIEYR_.2|_VSISEGDDKIEYR_.3|_IVALNAHTFLR_....

SEN / CTL

Q7Z460

CLIP-associating protein 1

CLASP1

10.36

1.43

0.00629

0.00492

G2/M transition of mitotic cell cycle,microtubule ...

dystroglycan binding,protein binding,microtubule b...

kinetochore,condensed chromosome kinetochore,Golgi...

147

102

147

_GVTEAIEK_.2|_KGIHDADSEAR_.3|_TLEAHKDSHKEVVR_.4|_T...

SEN / CTL

P52294

Importin subunit alpha-5

KPNA1

9.93

3.54

0.0399

0.0164

regulation of DNA recombination,apoptotic DNA frag...

protein binding,nuclear localization sequence bind...

nucleus,nuclear pore,nucleoplasm,cytoplasm,cytosol...

17

13

17

_RREEEGLQLR_.2|_RREEEGLQLR_.3|_REEEGLQLR_.2|_IQAVI...

SEN / CTL

Q86SZ2

Trafficking protein particle complex subunit 6B

TRAPPC6B

9.78

0.54

0.000996

0.00125

ER to Golgi vesicle-mediated transport,COPII vesic...

protein binding

Golgi membrane,endoplasmic reticulum,cis-Golgi net...

7

6

7

_TNHQGIYVLQDNK_.3|_TNHQGIYVLQDNK_.2|_GGLSNLGIK_.2|...

SEN / CTL

P43490

Nicotinamide phosphoribosyltransferase

NAMPT

9.6

0.99

0.00355

0.00323

nicotinamide metabolic process,signal transduction...

nicotinate-nucleotide diphosphorylase (carboxylati...

extracellular space,nucleoplasm,cytosol,cell junct...

65

37

65

_AVPEGFVIPR_.2|_DPVADPNK_.2|_GTDTVAGLALIKK_.3|_GTD...

SEN / CTL

Q13554

Q13555

Q13557

Calcium/calmodulin-dependent protein kinase type II subunit beta;Calcium/calmodulin-dependent protein kinase type II subunit gamma;Calcium/calmodulin-dependent protein kinase type II subunit delta

CAMK2B

CAMK2G

CAMK2D

8.98

1.14

0.00529

0.00435

MAPK cascade,protein phosphorylation,signal transd...

actin binding,protein serine/threonine kinase acti...

nucleoplasm,cytoplasm,microtubule organizing cente...

1

1

1

_STVASMMHR_.2

SEN / CTL

A0FGR8

Extended synaptotagmin-2

ESYT2

8.76

0.88

0.00338

0.00318

lipid transport,endocytosis,cell-cell adhesion

calcium ion binding,protein binding,calcium-depend...

integral component of plasma membrane,cell-cell ad...

40

31

40

_RQDLEVEVR_.2|_RERPPDHQHSAQVK_.4|_SDPYGIIR_.2|_GAN...

SEN / CTL

P00749

Urokinase-type plasminogen activator

PLAU

8.74

1.12

0.00541

0.00442

response to hypoxia,proteolysis,chemotaxis,signal ...

serine-type endopeptidase activity,protein binding

extracellular region,extracellular space,plasma me...

7

6

7

_VSHFLPWIR_.2|_DYSADTLAHHNDIALLK_.4|_DYSADTLAHHNDI...

SEN / CTL

P09341

P19875

P19876

Growth-regulated alpha protein;C-X-C motif chemokine 2;C-X-C motif chemokine 3

CXCL1

CXCL2

CXCL3

8.65

1.06

0.00493

0.00417

chemotaxis,inflammatory response,immune response,s...

receptor binding,chemokine activity,enzyme activat...

extracellular region,extracellular space,intracell...

2

1

2

_SPGPHC[+57]AQTEVIATLK_.3|_SPGPHC[+57]AQTEVIATLK_....

SEN / CTL

P10145

Interleukin-8

CXCL8

8.58

2.22

0.000221

0.000353

angiogenesis,response to molecule of bacterial ori...

interleukin-8 receptor binding,protein binding,che...

extracellular region,extracellular space,intracell...

2

1

2

_VIESGPHC[+57]ANTEIIVK_.3|_VIESGPHC[+57]ANTEIIVK_....

SEN / CTL

P20618

Proteasome subunit beta type-1

PSMB1

8.24

5.64

0.0159

0.00963

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

37

17

37

_AAGPLQLR_.2|_EGIREETVSLR_.2|_DVFISAAER_.2|_DVYTGD...

SEN / CTL

P49411

Elongation factor Tu, mitochondrial

TUFM

8.18

2.3

0.0253

0.0128

translational elongation,response to ethanol,mitoc...

translation elongation factor activity,GTPase acti...

mitochondrion,mitochondrial inner membrane,membran...

87

46

87

_ELLTEFGYK_.2|_GLVMVKPGSIKPHQK_.4|_GLVMVKPGSIKPHQK...

SEN / CTL

Q96T23

Remodeling and spacing factor 1

RSF1

8.11

1.23

0.00762

0.0057

nucleosome assembly,chromatin remodeling,DNA-templ...

protein binding,zinc ion binding,histone binding,A...

nucleus,nucleoplasm,RSF complex

41

35

41

_STANVLEETTVKK_.3|_STANVLEETTVKK_.2|_AIENLIGKPTEK_...

SEN / CTL

O76031

ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial

CLPX

7.9

1.58

0.0131

0.00843

protein folding,positive regulation of peptidase a...

protein binding,ATP binding,peptidase activator ac...

nucleoplasm,cytoplasm,mitochondrion,mitochondrial ...

35

28

35

_RGGEVLDSSHDDIK_.3|_SGESNTHQDIEEKDR_.4|_SGESNTHQDI...

SEN / CTL

P27487

Dipeptidyl peptidase 4

DPP4

7.83

2.04

0.0219

0.0119

behavioral fear response,response to hypoxia,prote...

virus receptor activity,protease binding,serine-ty...

lysosomal membrane,plasma membrane,focal adhesion,...

42

34

42

_WEYYDSVYTER_.2|_AGAVNPTVK_.2|_WISDHEYLYK_.3|_WISD...

SEN / CTL

P50281

Matrix metalloproteinase-14

MMP14

7.75

3.16

0.0511

0.0189

angiogenesis,ovarian follicle development,response...

metalloendopeptidase activity,serine-type endopept...

Golgi lumen,plasma membrane,integral component of ...

18

15

18

_SPQSLSAAIAAMQK_.2|_AVDSEYPK_.2|_VGEYATYEAIRK_.3|_...

SEN / CTL

Q96P47

Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3

AGAP3

7.56

1.03

0.00608

0.00481

small GTPase mediated signal transduction,positive...

GTPase activator activity,GTP binding,metal ion bi...

cytoplasm,membrane

12

11

12

_VGIVGNLSSGK_.2|_IETIAASSTPTPIRK_.3|_ATPATAPGTSPR_...

SEN / CTL

P06748

Nucleophosmin

NPM1

7.51

2

0.000257

0.000402

DNA repair,nucleosome assembly,intracellular prote...

transcription coactivator activity,RNA binding,pro...

nucleus,nucleoplasm,nucleolus,cytoplasm,centrosome...

61

26

61

_FINYVKNC[+57]FR_.3|_MTDQEAIQDLWQWRK_.3|_M[+16]TDQ...

SEN / CTL

P52823

Stanniocalcin-1

STC1

7.5

1.75

0.00000127

0.00000365

ossification,endothelial cell morphogenesis,growth...

hormone activity

extracellular space,nucleus,cytoplasm,apical plasm...

3

2

3

_IGPNMASLFHILQTDHC[+57]AQTHPR_.5|_IGPNMASLFHILQTDH...

SEN / CTL

P00738

Haptoglobin

HP

7.47

4.06

0.0859

0.0258

immune system process,receptor-mediated endocytosi...

protein binding,antioxidant activity,hemoglobin bi...

extracellular region,extracellular space,haptoglob...

65

38

65

_DYAEVGR_.2|_LKQKVSVNER_.3|_HYEGSTVPEKK_.3|_HYEGST...

SEN / CTL

Q9UIQ6

Leucyl-cystinyl aminopeptidase

LNPEP

7.46

0.9

0.00484

0.00415

protein polyubiquitination,antigen processing and ...

aminopeptidase activity,protein binding,metallopep...

extracellular region,intracellular,lysosomal membr...

37

32

37

_IIRDEQYTALSNMPK_.3|_IIRDEQYTALSNMPK_.2|_ILEALASSE...

SEN / CTL

Q96RP9

Elongation factor G, mitochondrial

GFM1

7.17

0.46

0.00138

0.00166

mitochondrial translational elongation

translation elongation factor activity,GTPase acti...

mitochondrion,mitochondrial matrix

60

43

60

_VYFDTENK_.2|_NIGISAHIDSGK_.3|_NIGISAHIDSGK_.2|_ET...

SEN / CTL

P68104

Q5VTE0

Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3

EEF1A1

EEF1A1P5

7.05

1.65

1.32e-8

5.01e-8

transcription, DNA-templated,regulation of transcr...

tRNA binding,translation elongation factor activit...

extracellular space,nucleus,nucleolus,cytoplasm,cy...

4

3

4

_SGDAAIVDMVPGKPMC[+57]VESFSDYPPLGR_.4|_SGDAAIVDMVP...

SEN / CTL

P36551

Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial

CPOX

7.04

0.28

0.000524

0.000725

protoporphyrinogen IX biosynthetic process,heme bi...

coproporphyrinogen oxidase activity,structural con...

cytoplasm,mitochondrion,mitochondrial inner membra...

42

29

42

_AGVSISVVHGNLSEEAAK_.3|_AGVSISVVHGNLSEEAAK_.2|_KWC...

SEN / CTL

Q9NWT8

Aurora kinase A-interacting protein

AURKAIP1

6.99

1.55

0.0159

0.00963

mRNA processing,negative regulation of mitotic nuc...

protein binding

nucleus,nucleoplasm,mitochondrion,mitochondrial in...

3

2

3

_AGLKEAPEGWQTPK_.2|_AGLKEAPEGWQTPK_.3|_EAPEGWQTPK_...

SEN / CTL

P03956

Interstitial collagenase

MMP1

6.87

1.88

0.00000431

0.0000107

proteolysis,viral process,extracellular matrix dis...

endopeptidase activity,metalloendopeptidase activi...

extracellular region,proteinaceous extracellular m...

6

6

6

_SQNPVQPIGPQTPK_.2|_AFQLWSNVTPLTFTK_.2|_DGFFYFFHGT...

SEN / CTL

Q9H0L4

Cleavage stimulation factor subunit 2 tau variant

CSTF2T

6.86

4.02

0.0982

0.0283

pre-mRNA cleavage required for polyadenylation

nucleotide binding,mRNA binding,protein binding,po...

intracellular,mRNA cleavage and polyadenylation sp...

18

11

18

_AMETEVLETR_.2|_KIHVTPLIPGK_.3|_GYLGPPHQGPPMHHASGH...

SEN / CTL

O75396

Vesicle-trafficking protein SEC22b

SEC22B

6.84

1.49

0.0154

0.00951

ER to Golgi vesicle-mediated transport,retrograde ...

SNARE binding,SNAP receptor activity,protein bindi...

Golgi membrane,endoplasmic reticulum membrane,endo...

21

15

21

_VLLTMIAR_.2|_VLLTM[+16]IAR_.2|_ANNLSSLSK_.2|_IMVA...

SEN / CTL

P53609

Geranylgeranyl transferase type-1 subunit beta

PGGT1B

6.8

0.53

0.00201

0.00209

positive regulation of cell proliferation,protein ...

protein geranylgeranyltransferase activity,CAAX-pr...

CAAX-protein geranylgeranyltransferase complex

8

8

8

_EAC[+57]LAGLR_.2|_C[+57]LQVLPER_.2|_NYILSTQDR_.2|...

SEN / CTL

P04406

Glyceraldehyde-3-phosphate dehydrogenase

GAPDH

6.78

1.75

1.48e-15

1.94e-14

microtubule cytoskeleton organization,gluconeogene...

glyceraldehyde-3-phosphate dehydrogenase (NAD+) (p...

nucleus,cytoplasm,lipid particle,cytosol,plasma me...

166

51

166

_GALQNIIPASTGAAK_.2|_GALQNIIPASTGAAK_.3|_DGRGALQNI...

SEN / CTL

O60814

P06899

P23527

P33778

P57053

P58876

P62807

Q16778

Q5QNW6

Q93079

Q99877

Q99879

Q99880

Histone H2B type 1-K;Histone H2B type 1-J;Histone H2B type 1-O;Histone H2B type 1-B;Histone H2B type F-S;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 2-E;Histone H2B type 2-F;Histone H2B type 1-H;Histone H2B type 1-N;Histone H2B type 1-M;Histone H2B type 1-L

HIST1H2BK

HIST1H2BJ

HIST1H2BO

HIST1H2BB

H2BFS

HIST1H2BD

HIST1H2BC

HIST2H2BE

HIST2H2BF

HIST1H2BH

HIST1H2BN

HIST1H2BM

HIST1H2BL

6.67

2.59

0.00147

0.00172

innate immune response in mucosa,nucleosome assemb...

molecular_function,DNA binding,protein heterodimer...

nuclear nucleosome,extracellular space,nucleus,nuc...

2

2

2

_LLLPGELAK_.2|_STITSREIQTAVR_.3

SEN / CTL

P61604

10 kDa heat shock protein, mitochondrial

HSPE1

6.65

2.52

0.00133

0.00161

osteoblast differentiation,protein folding,activat...

protein binding,ATP binding,poly(A) RNA binding,me...

mitochondrion,mitochondrial matrix,membrane,extrac...

27

19

27

_FLPLFDR_.2|_FLPLFDRVLVER_.3|_GKGGEIQPVSVK_.3|_GKG...

SEN / CTL

Q9Y4C2

TRPM8 channel-associated factor 1

TCAF1

6.52

1.29

0.0127

0.0083

transport,negative regulation of cell migration,po...

protein binding,ion channel binding

plasma membrane

19

17

19

_LGETTLEEWK_.2|_GLWGPVHELGR_.3|_GLWGPVHELGR_.2|_IL...

SEN / CTL

P14174

Macrophage migration inhibitory factor

MIF

6.19

2.83

6.6e-14

6.79e-13

prostaglandin biosynthetic process,negative regula...

dopachrome isomerase activity,receptor binding,cyt...

extracellular region,extracellular space,nucleopla...

22

10

22

_LLC[+57]GLLAER_.2|_LLC[+57]GLLAERLR_.3|_SYSKLLC[+...

SEN / CTL

P36980

Complement factor H-related protein 2

CFHR2

6.04

2.2

0.0414

0.0167

extracellular region

5

4

5

_TGDIVEFVC[+57]K_.2|_LVYPSC[+57]EEK_.2|_ITC[+57]AE...

SEN / CTL

Q03001

Dystonin

DST

6.03

1.84

0.0296

0.0141

cytoskeleton organization,cell adhesion,integrin-m...

actin binding,integrin binding,calcium ion binding...

basement membrane,nucleus,nuclear envelope,cytopla...

113

99

113

_SEAYQQQIEMER_.2|_DGGKVDTSATHR_.3|_TPLERDDLHESVFR_...

SEN / CTL

P04150

Glucocorticoid receptor

NR3C1

6.02

0.62

0.00355

0.00323

transcription, DNA-templated,regulation of transcr...

RNA polymerase II core promoter proximal region se...

nucleus,nucleoplasm,cytoplasm,mitochondrial matrix...

21

18

21

_IMTTLNMLGGR_.2|_HMLYVSSELHR_.3|_AVEGQHNYLC[+57]AG...

SEN / CTL

Q16555

Dihydropyrimidinase-related protein 2

DPYSL2

6

1.85

0.000506

0.00071

response to amphetamine,nucleobase-containing comp...

dihydropyrimidinase activity,protein binding,micro...

mitochondrion,cytosol,dendrite,growth cone,neurona...

74

35

74

_SSAEVIAQAR_.2|_MVIPGGIDVHTR_.3|_M[+16]VIPGGIDVHTR...

SEN / CTL

P02795

P04732

P13640

P80297

Q8N339

Metallothionein-2;Metallothionein-1E;Metallothionein-1G;Metallothionein-1X;Metallothionein-1M

MT2A

MT1E

MT1G

MT1X

MT1M

5.94

3.39

0.00773

0.00574

cellular copper ion homeostasis,response to metal ...

protein binding,drug binding,zinc ion binding;zinc...

nucleus,cytoplasm,cytosol,perinuclear region of cy...

2

1

2

_SC[+57]C[+57]SC[+57]C[+57]PVGC[+57]AK_.2|_SC[+57]...

SEN / CTL

Q9UKD2

mRNA turnover protein 4 homolog

MRTO4

5.88

4.32

0.143

0.038

ribosomal large subunit assembly,nuclear-transcrib...

protein binding,poly(A) RNA binding,large ribosoma...

nucleus,nucleoplasm,nucleolus,preribosome, large s...

26

19

26

_EEVNEWFTK_.2|_VMMVALGR_.2|_LRGEVGLLFTNR_.3|_LRGEV...

SEN / CTL

O43399

Tumor protein D54

TPD52L2

5.86

1.3

0.016

0.00964

poly(A) RNA binding

28

18

28

_LGLSTLGELKQNLSR_.3|_KTQETLSQAGQK_.3|_KTQETLSQAGQK...

SEN / CTL

P18065

Insulin-like growth factor-binding protein 2

IGFBP2

5.82

0.93

6.79e-8

2.39e-7

regulation of cell growth,signal transduction,fema...

receptor binding,protein binding,insulin-like grow...

extracellular region,extracellular space,apical pl...

14

11

14

_LEGEAC[+57]GVYTPR_.2|_MPC[+57]AELVREPGC[+57]GC[+5...

SEN / CTL

Q5T4S7

E3 ubiquitin-protein ligase UBR4

UBR4

5.82

3.79

0.117

0.0321

viral process,protein ubiquitination involved in u...

ubiquitin-protein transferase activity,protein bin...

nucleoplasm,cytoplasm,centrosome,membrane,integral...

225

177

225

_EDYLAVC[+57]GLK_.2|_ISESLVR_.2|_MAAETDPHKSSEITK_....

SEN / CTL

P14618

Pyruvate kinase PKM

PKM

5.73

2.13

2.36e-23

1.13e-21

response to hypoxia,liver development,ATP biosynth...

magnesium ion binding,pyruvate kinase activity,pro...

nucleus,cytoplasm,mitochondrion,cytosol,plasma mem...

160

71

160

_NTGIIC[+57]TIGPASR_.2|_NTGIIC[+57]TIGPASR_.3|_LNF...

SEN / CTL

P83111

Serine beta-lactamase-like protein LACTB, mitochondrial

LACTB

5.71

2.35

0.00193

0.00204

hydrolase activity

cytoplasm,mitochondrion

29

21

29

_FENSIESLR_.2|_KNDFEQGELYLR_.2|_KNDFEQGELYLR_.3|_F...

SEN / CTL

O60343

TBC1 domain family member 4

TBC1D4

5.68

4.84

0.179

0.0455

intracellular protein transport,vesicle-mediated t...

GTPase activator activity,Rab GTPase binding

intracellular,cytoplasm,endomembrane system,cytopl...

176

90

176

_FRLWYVGGSC[+57]LDHR_.3|_AYSLLDK_.2|_RAHTFSHPPSSTK...

SEN / CTL

Q06323

Proteasome activator complex subunit 1

PSME1

5.63

0.95

0.00935

0.00663

MAPK cascade,protein polyubiquitination,stimulator...

protein binding,endopeptidase activator activity

proteasome complex,nucleoplasm,cytoplasm,cytosol,p...

39

26

39

_IVVLLQR_.2|_VFELMTSLHTK_.3|_VFELM[+16]TSLHTK_.3|_...

SEN / CTL

P24534

Elongation factor 1-beta

EEF1B2

5.63

1.99

0.0392

0.0164

translational elongation,response to ethanol

translation elongation factor activity,protein bin...

cytoplasm,cytosol,eukaryotic translation elongatio...

25

13

25

_LVPVGYGIK_.2|_LAQYESK_.2|_SIQADGLVWGSSK_.3|_SIQAD...

SEN / CTL

Q7L775

EPM2A-interacting protein 1

EPM2AIP1

5.45

1.94

0.0397

0.0164

regulation of transcription from RNA polymerase II...

RNA polymerase II transcription factor activity, s...

nucleoplasm,cytoplasm,endoplasmic reticulum

11

10

11

_VASLFDSNQIC[+57]EK_.2|_HYEAEHEYYER_.3|_NLTDFPALR_...

SEN / CTL

P24593

Insulin-like growth factor-binding protein 5

IGFBP5

5.36

4

0.00381

0.00336

regulation of cell growth,osteoblast differentiati...

fibronectin binding,protein binding,insulin-like g...

extracellular region,intracellular,insulin-like gr...

3

3

3

_FVGGAENTAHPR_.3|_HMEASLQELK_.2|_ALSMC[+57]PPSPLGC...

SEN / CTL

P80108

Phosphatidylinositol-glycan-specific phospholipase D

GPLD1

5.36

3.76

0.132

0.0356

ossification,cell migration involved in sprouting ...

glycosylphosphatidylinositol phospholipase D activ...

proteinaceous extracellular matrix,extracellular s...

18

17

18

_TLLLVGSPTWK_.2|_ALEFLQLHNGR_.3|_FGSSLITVR_.2|_ETT...

SEN / CTL

Q9UHV9

Prefoldin subunit 2

PFDN2

5.34

0.93

0.01

0.00697

protein folding,positive regulation of cytoskeleto...

protein binding,protein binding involved in protei...

nucleus,nucleoplasm,nucleolus,cytoplasm,mitochondr...

15

9

15

_MVGGVLVER_.2|_M[+16]VGGVLVER_.2|_LM[+16]GEDEKPAAK...

SEN / CTL

O43847

Nardilysin

NRD1

5.32

4.52

0.178

0.0453

proteolysis,neuromuscular junction development,cel...

metalloendopeptidase activity,protein binding,zinc...

cytosol,cell surface

62

48

62

_PLEQEMPVQFQVVELPSGHHLC[+57]K_.4|_GSILSFLR_.2|_LGA...

SEN / CTL

P43251

Biotinidase

BTD

5.31

3.23

0.00997

0.00697

biotin metabolic process,central nervous system de...

hydrolase activity, acting on carbon-nitrogen (but...

extracellular region,extracellular space,mitochond...

16

11

16

_ILSGDPYC[+57]EK_.2|_LSSGLVTAALYGR_.2|_LSSGLVTAALY...

SEN / CTL

P31948

Stress-induced-phosphoprotein 1

STIP1

5.3

0.44

0.00232

0.00235

response to stress

protein binding,protein C-terminus binding,Hsp70 p...

nucleus,Golgi apparatus,myelin sheath,protein comp...

131

71

131

_ALDLDSSC[+57]KEAADGYQR_.3|_ALDLDSSC[+57]KEAADGYQR...

SEN / CTL

Q13885

Q9BVA1

Tubulin beta-2A chain;Tubulin beta-2B chain

TUBB2A

TUBB2B

5.27

1.68

0.000588

0.000798

cytoskeleton organization,microtubule-based proces...

GTPase activity,structural constituent of cytoskel...

nucleus,cytoplasm,microtubule,extracellular exosom...

2

1

2

_AILVDLEPGTMDSVR_.2|_AILVDLEPGTMDSVR_.3

SEN / CTL

P54819

Adenylate kinase 2, mitochondrial

AK2

5.25

2.58

0.0722

0.0231

ADP biosynthetic process,nucleobase-containing sma...

adenylate kinase activity,ATP binding

mitochondrial inner membrane,mitochondrial interme...

55

28

55

_AVLLGPPGAGKGTQAPR_.3|_APSVPAAEPEYPKGIR_.4|_APSVPA...

SEN / CTL

Q8NE71

ATP-binding cassette sub-family F member 1

ABCF1

5.22

2.88

0.0883

0.0263

translation,inflammatory response,transmembrane tr...

protein binding,ATP binding,translation factor act...

nuclear envelope,nucleoplasm,cytoplasm,cytosol,rib...

41

32

41

_GFNLPYQDAR_.2|_FGLESHAHTIQIC[+57]K_.4|_FGLESHAHTI...

SEN / CTL

O43795

Unconventional myosin-Ib

MYO1B

5.19

1.46

0.0255

0.0128

post-Golgi vesicle-mediated transport,actin filame...

microfilament motor activity,calmodulin binding,AT...

cytoplasm,early endosome,actin filament,plasma mem...

56

40

56

_SQIVIAAWYR_.2|_ASVATLMK_.2|_LGNIEFKPESR_.3|_LGNIE...

SEN / CTL

P35754

Glutaredoxin-1

GLRX

5.19

1.62

0.0308

0.0143

nucleobase-containing small molecule interconversi...

electron carrier activity,glutathione disulfide ox...

nucleus,mitochondrion,cytosol,extracellular exosom...

11

7

11

_LKQIGALQ_.2|_RAQEILSQLPIK_.3|_RAQEILSQLPIK_.2|_VV...

SEN / CTL

P49368

T-complex protein 1 subunit gamma

CCT3

5.19

4.05

0.157

0.0412

protein folding,'de novo' protein folding,binding ...

protein binding,ATP binding,protein binding involv...

zona pellucida receptor complex,cytoplasm,cytosol,...

102

49

102

_WSSLAC[+57]NIALDAVK_.2|_WSSLAC[+57]NIALDAVK_.3|_T...

SEN / CTL

P04792

Heat shock protein beta-1

HSPB1

5.17

2.55

0.0000219

0.0000464

retina homeostasis,regulation of protein phosphory...

protein kinase C binding,protein binding,protein k...

proteasome complex,extracellular space,nucleus,cyt...

44

23

44

_AQLGGPEAAKSDETAAK_.3|_AQLGGPEAAKSDETAAK_.2|_LATQS...

SEN / CTL

O75155

Cullin-associated NEDD8-dissociated protein 2

CAND2

5.14

4.53

0.188

0.0466

transcription, DNA-templated,SCF complex assembly,...

protein binding,TBP-class protein binding

intracellular,nucleus

7

7

7

_SNPELAALFESIQK_.2|_ATDLDQEVK_.2|_AVAALLTIPEVGK_.2...

SEN / CTL

Q9Y490

Talin-1

TLN1

5.13

1.85

0.00104

0.00129

platelet degranulation,movement of cell or subcell...

integrin binding,structural constituent of cytoske...

ruffle,extracellular region,cytoplasm,microtubule ...

355

186

355

_GLAGAVSELLR_.2|_ALSTDPAAPNLKSQLAAAAR_.3|_ALSTDPAA...

SEN / CTL

O14980

Exportin-1

XPO1

5.13

1.12

0.0154

0.00951

ribosomal subunit export from nucleus,ribosomal la...

RNA binding,nuclear export signal receptor activit...

kinetochore,nucleus,nuclear envelope,annulate lame...

96

55

96

_LISGWVSR_.2|_DFEEYPEHR_.3|_DFEEYPEHR_.2|_FLVTVIK_...

SEN / CTL

P01024

Complement C3

C3

5.1

2.66

0.0000357

0.0000715

positive regulation of type IIa hypersensitivity,p...

serine-type endopeptidase activity,endopeptidase i...

extracellular region,extracellular space,plasma me...

202

130

202

_TKKQELSEAEQATR_.3|_TFISPIK_.2|_ISLPESLK_.2|_KQELS...

SEN / CTL

Q9HAU5

Regulator of nonsense transcripts 2

UPF2

5.1

0.73

0.00672

0.00514

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,protein binding,telomeric DNA binding

nucleus,cytoplasm,cytosol,polysome,exon-exon junct...

25

18

25

_ALFIVPR_.2|_HC[+57]GDDIAGLVPR_.3|_HC[+57]GDDIAGLV...

SEN / CTL

P29692

Elongation factor 1-delta

EEF1D

5.02

0.92

0.011

0.00749

transcription, DNA-templated,regulation of transcr...

DNA binding,translation elongation factor activity...

nucleus,nucleolus,cytoplasm,cytosol,eukaryotic tra...

46

24

46

_LVPVGYGIR_.2|_FKYDDAERR_.3|_GVVQELQQAISK_.3|_GVVQ...

SEN / CTL

P08238

Heat shock protein HSP 90-beta

HSP90AB1

5.01

1.84

0.00000133

0.00000375

placenta development,protein folding,response to u...

glycoprotein binding,UTP binding,CTP binding,doubl...

nucleus,nucleoplasm,cytoplasm,mitochondrion,lysoso...

175

84

175

_ALLFIPR_.2|_FYEAFSK_.2|_FYEAFSK_.1|_ELISNASDALDKI...

SEN / CTL

O95819

Q8N4C8

Q9UKE5

Mitogen-activated protein kinase kinase kinase kinase 4;Misshapen-like kinase 1;TRAF2 and NCK-interacting protein kinase

MAP4K4

MINK1

TNIK

4.97

0.74

0.00726

0.0055

protein phosphorylation,signal transduction by pro...

creatine kinase activity,protein serine/threonine ...

cytoplasm;cytoplasm,Golgi apparatus,cytosol,postsy...

1

1

1

_ALFLIPR_.2

SEN / CTL

P07900

Heat shock protein HSP 90-alpha

HSP90AA1

4.94

0.6

0.00495

0.00417

G2/M transition of mitotic cell cycle,mitochondria...

nucleotide binding,protein tyrosine kinase activit...

extracellular region,nucleus,nucleoplasm,cytoplasm...

151

69

151

_ALLFVPR_.2|_APFDLFENRK_.3|_APFDLFENRK_.2|_DQVANSA...

SEN / CTL

P11908

Ribose-phosphate pyrophosphokinase 2

PRPS2

4.94

1.1

0.0163

0.00976

5-phosphoribose 1-diphosphate biosynthetic process...

magnesium ion binding,ribose phosphate diphosphoki...

ribose phosphate diphosphokinase complex,protein c...

17

12

17

_ENIAEWK_.2|_PNIVLFSGSSHQDLSQR_.4|_PNIVLFSGSSHQDLS...

SEN / CTL

O14950

P19105

Myosin regulatory light chain 12B;Myosin regulatory light chain 12A

MYL12B

MYL12A

4.93

1.76

0.0398

0.0164

muscle contraction,regulation of cell shape;muscle...

calcium ion binding,protein binding,myosin heavy c...

stress fiber,cytosol,brush border,myosin II comple...

38

18

38

_GNFNYIEFTR_.2|_EDLHDMLASLGK_.3|_EDLHDMLASLGK_.2|_...

SEN / CTL

Q9NQH7

Probable Xaa-Pro aminopeptidase 3

XPNPEP3

4.92

0.63

0.00544

0.00443

glomerular filtration,protein processing

aminopeptidase activity,metallopeptidase activity,...

mitochondrion,extracellular exosome

14

10

14

_AILFVPR_.2|_GVQQLIQR_.2|_YC[+57]PHHVGHYLGMDVHDTPD...

SEN / CTL

Q92878

DNA repair protein RAD50

RAD50

4.92

1.05

0.0148

0.00932

regulation of mitotic recombination,telomere maint...

DNA binding,double-stranded telomeric DNA binding,...

nuclear chromosome, telomeric region,nuclear chrom...

89

75

89

_C[+57]SVSSLGFNVH_.2|_TTELVNK_.2|_LEENIDNIKR_.3|_G...

SEN / CTL

Q15185

Prostaglandin E synthase 3

PTGES3

4.91

0.71

0.00683

0.0052

telomere maintenance,prostaglandin biosynthetic pr...

telomerase activity,protein binding,prostaglandin-...

chromosome, telomeric region,nucleus,nucleoplasm,t...

20

13

20

_SILC[+57]C[+57]LR_.2|_TDRSILC[+57]C[+57]LR_.3|_DV...

SEN / CTL

P05121

Plasminogen activator inhibitor 1

SERPINE1

4.89

0.82

0.0092

0.00659

chronological cell aging,angiogenesis,platelet deg...

protease binding,serine-type endopeptidase inhibit...

extracellular region,extracellular space,plasma me...

10

9

10

_MAPEEIIMDRPFLFVVR_.3|_LVQGFMPHFFR_.3|_VFQQVAQASK_...

SEN / CTL

O00515

Ladinin-1

LAD1

4.89

3.39

0.13

0.035

cell-cell adhesion

structural molecule activity,cadherin binding invo...

basement membrane,cell-cell adherens junction,extr...

27

25

27

_RQVVEAAQAPIQER_.3|_RQVVEAAQAPIQER_.2|_LPPVTLQVK_....

SEN / CTL

Q9ULV4

Coronin-1C

CORO1C

4.88

1.52

0.0000111

0.0000246

neural crest cell migration,regulation of protein ...

protein binding,Rac GTPase binding,actin filament ...

cytoplasm,focal adhesion,actin cytoskeleton,latera...

54

36

54

_RGLDVNKC[+57]EIAR_.3|_KC[+57]EPIIMTVPR_.3|_KC[+57...

SEN / CTL

P46939

Utrophin

UTRN

4.82

3.56

0.144

0.0382

positive regulation of cell-matrix adhesion,muscle...

actin binding,integrin binding,protein binding,zin...

nucleoplasm,cytoplasm,cytoskeleton,plasma membrane...

151

126

151

_NVSQHLEDLER_.2|_RQIHVDIEAK_.3|_ELTNLLGLHPK_.3|_LG...

SEN / CTL

Q14CX7

N-alpha-acetyltransferase 25, NatB auxiliary subunit

NAA25

4.79

2.23

0.0653

0.0218

N-terminal peptidyl-methionine acetylation

peptide alpha-N-acetyltransferase activity

nucleoplasm,cytoplasm,Golgi apparatus,NatB complex

38

31

38

_TMFLPLAER_.2|_LALPADIR_.2|_LNNSLHFAQVR_.3|_LNNSLH...

SEN / CTL

P11498

Pyruvate carboxylase, mitochondrial

PC

4.78

3.4

0.135

0.0361

pyruvate metabolic process,gluconeogenesis,lipid m...

DNA binding,biotin carboxylase activity,pyruvate c...

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

148

76

148

_VVHSYEELEENYTR_.3|_VVHSYEELEENYTR_.2|_LFLQGPK_.2|...

SEN / CTL

Q9Y5Q8

General transcription factor 3C polypeptide 5

GTF3C5

4.76

0.82

0.00981

0.00689

transcription, DNA-templated,transcription from RN...

protein binding,DNA binding

transcription factor TFIIIC complex,nucleoplasm

20

16

20

_TSSQLVTMHDLK_.2|_TSSQLVTMHDLK_.3|_IIHRNDGAENSC[+5...

SEN / CTL

P19367

Q2TB90

Hexokinase-1;Putative hexokinase HKDC1

HK1

HKDC1

4.76

1.37

0.0264

0.013

cellular glucose homeostasis,glycolytic process,gl...

glucokinase activity,hexokinase activity,protein b...

mitochondrion,mitochondrial outer membrane,cytosol...

1

1

1

_LALLQVR_.2

SEN / CTL

Q9Y2Z9

Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial

COQ6

4.73

1.52

0.0326

0.0145

ubiquinone biosynthetic process,secondary metaboli...

monooxygenase activity,oxidoreductase activity, ac...

mitochondrion,mitochondrial inner membrane,Golgi a...

21

15

21

_ILLLEAGPK_.2|_LLIGADGHNSGVR_.3|_HNTALLAATDLLK_.3|...

SEN / CTL

P61978

Heterogeneous nuclear ribonucleoprotein K

HNRNPK

4.66

2.13

0.00302

0.00292

mRNA splicing, via spliceosome,transcription from ...

RNA polymerase II core promoter proximal region se...

nuclear chromatin,podosome,nucleus,nucleoplasm,cyt...

76

41

76

_SRNTDEMVELR_.3|_SRNTDEM[+16]VELR_.3|_SRNTDEMVELR_...

SEN / CTL

P43243

Matrin-3

MATR3

4.58

2.82

0.107

0.0302

posttranscriptional regulation of gene expression

nucleotide binding,structural molecule activity,pr...

nuclear inner membrane,nucleoplasm,membrane,nuclea...

104

54

104

_MDYEDDRLR_.3|_C[+57]RDDSFFGETSHNYHK_.5|_C[+57]RDD...

SEN / CTL

P00540

Proto-oncogene serine/threonine-protein kinase mos

MOS

4.57

1.26

0.0243

0.0126

MAPK cascade,activation of MAPKK activity,activati...

protein serine/threonine kinase activity,MAP kinas...

cytoplasm,intracellular

8

8

8

_LLLGATLPR_.2|_TGGQLSLGK_.2|_LGAGGFGSVYK_.2|_LLLVD...

SEN / CTL

O75954

Tetraspanin-9

TSPAN9

4.55

1.06

0.0177

0.0103

cell surface receptor signaling pathway,biological...

molecular_function

plasma membrane,integral component of plasma membr...

3

3

3

_NAWNIIQAEMR_.2|_EGLLLYHTENNVGLK_.3|_C[+57]C[+57]M...

SEN / CTL

P04908

P0C0S5

P0C0S8

P16104

P20671

Q16777

Q6FI13

Q71UI9

Q7L7L0

Q8IUE6

Q93077

Q96KK5

Q96QV6

Q99878

Q9BTM1

Histone H2A type 1-B/E;Histone H2A.Z;Histone H2A type 1;Histone H2AX;Histone H2A type 1-D;Histone H2A type 2-C;Histone H2A type 2-A;Histone H2A.V;Histone H2A type 3;Histone H2A type 2-B;Histone H2A type 1-C;Histone H2A type 1-H;Histone H2A type 1-A;Histone H2A type 1-J;Histone H2A.J

HIST1H2AB

H2AFZ

HIST1H2AG

H2AFX

HIST1H2AD

HIST2H2AC

HIST2H2AA3

H2AFV

HIST3H2A

HIST2H2AB

HIST1H2AC

HIST1H2AH

HIST1H2AA

HIST1H2AJ

H2AFJ

4.54

2.05

0.0619

0.021

chromatin silencing,negative regulation of cell pr...

DNA binding,protein heterodimerization activity;RN...

nucleosome,nuclear chromatin,nucleus,extracellular...

1

1

1

_AGLQFPVGR_.2

SEN / CTL

Q9Y4K0

Lysyl oxidase homolog 2

LOXL2

4.51

1.21

0.00000373

0.00000958

response to hypoxia,epithelial to mesenchymal tran...

chromatin binding,transcription corepressor activi...

basement membrane,extracellular space,nucleus,nucl...

19

16

19

_VVC[+57]GMFGFPGER_.2|_AYKPEQPLVR_.3|_LGQGIGPIHLNE...

SEN / CTL

O60568

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3

PLOD3

4.51

0.72

0.00828

0.00609

in utero embryonic development,endothelial cell mo...

iron ion binding,protein binding,procollagen-lysin...

endoplasmic reticulum membrane,rough endoplasmic r...

68

41

68

_AVMNFVVR_.2|_AVM[+16]NFVVR_.2|_GIFLHLSNQHEFGR_.4|...

SEN / CTL

O14773

Tripeptidyl-peptidase 1

TPP1

4.46

0.97

0.0155

0.00951

proteolysis,lipid metabolic process,lysosome organ...

endopeptidase activity,serine-type endopeptidase a...

mitochondrion,lysosome,melanosome,lysosomal lumen,...

26

16

26

_LFGGNFAHQASVAR_.3|_LFGGNFAHQASVAR_.2|_VNTELMK_.2|...

SEN / CTL

Q03111

Protein ENL

MLLT1

4.37

2

0.0633

0.0213

regulation of transcription, DNA-templated,transcr...

DNA binding,protein binding

nucleus,nucleoplasm,nucleolus,cytoplasm,transcript...

8

7

8

_LTFNNPTTEFR_.2|_VVFWLHDSFPKPR_.4|_VVFWLHDSFPKPR_....

SEN / CTL

Q14697

Neutral alpha-glucosidase AB

GANAB

4.36

0.97

0.000107

0.000186

carbohydrate metabolic process,protein folding

carbohydrate binding,glucan 1,3-alpha-glucosidase ...

endoplasmic reticulum lumen,Golgi apparatus,membra...

141

70

141

_YRVPDVLVADPPIAR_.3|_YRVPDVLVADPPIAR_.4|_YRVPDVLVA...

SEN / CTL

P69905

Hemoglobin subunit alpha

HBA1

4.34

1.42

0.000667

0.000881

receptor-mediated endocytosis,positive regulation ...

oxygen transporter activity,iron ion binding,prote...

extracellular region,cytosol,hemoglobin complex,me...

78

23

78

_VGAHAGEYGAEALER_.3|_VGAHAGEYGAEALER_.2|_MFLSFPTTK...

SEN / CTL

Q9H5N1

Rab GTPase-binding effector protein 2

RABEP2

4.34

2.15

0.0733

0.0233

endocytosis,protein transport,positive regulation ...

GTPase activator activity,growth factor activity

cytoplasm,early endosome,intracellular membrane-bo...

18

17

18

_RLNEENQGLR_.2|_AEAVAAVQR_.2|_LSQALQVR_.2|_VQLQMAE...

SEN / CTL

P68371

Tubulin beta-4B chain

TUBB4B

4.3

1.82

1.64e-18

2.96e-17

G2/M transition of mitotic cell cycle,movement of ...

double-stranded RNA binding,GTPase activity,struct...

nucleus,cytosol,cytoskeleton,microtubule,extracell...

123

42

123

_YLTVAAVFR_.2|_LAVNMVPFPR_.2|_LAVNM[+16]VPFPR_.2|_...

SEN / CTL

O00151

PDZ and LIM domain protein 1

PDLIM1

4.27

1.83

0.000113

0.000193

response to hypoxia,regulation of transcription, D...

transcription coactivator activity,zinc ion bindin...

transcription factor complex,cytoplasm,cytoskeleto...

50

27

50

_LVGGKDFEQPLAISR_.3|_LVGGKDFEQPLAISR_.2|_SAMPFTASP...

SEN / CTL

Q14117

Q14194

Q14195

Dihydropyrimidinase;Dihydropyrimidinase-related protein 1;Dihydropyrimidinase-related protein 3

DPYS

CRMP1

DPYSL3

4.27

1.4

0.0342

0.0149

pyrimidine nucleobase catabolic process,thymine ca...

uracil binding,thymine binding,dihydropyrimidinase...

cytosol,extracellular exosome;cytoplasm,microtubul...

1

1

1

_IFNLYPR_.2

SEN / CTL

Q9BRA2

Thioredoxin domain-containing protein 17

TXNDC17

4.27

1.91

0.0608

0.0207

tumor necrosis factor-mediated signaling pathway,o...

peroxidase activity,protein binding,protein-disulf...

cytosol,extracellular exosome

18

11

18

_SWC[+57]PDC[+57]VQAEPVVR_.2|_SWC[+57]PDC[+57]VQAE...

SEN / CTL

Q9H7C9

Mth938 domain-containing protein

AAMDC

4.26

1.19

0.0249

0.0127

negative regulation of apoptotic process,positive ...

protein binding

cytoplasm

6

5

6

_VPSSTVEYLK_.2|_GVQTLVIGR_.2|_VLQTEQAVK_.2|_ETGTEH...

SEN / CTL

O43396

Thioredoxin-like protein 1

TXNL1

4.21

1.84

0.0582

0.0204

glycerol ether metabolic process,cellular response...

thioredoxin-disulfide reductase activity,protein d...

proteasome complex,nucleus,cytoplasm,extracellular...

33

21

33

_IFINLPR_.2|_EDGIVPLR_.2|_IKQHLENDPGSNEDTDIPK_.4|_...

SEN / CTL

P50454

Serpin H1

SERPINH1

4.2

1.32

2.67e-7

8.74e-7

chondrocyte development involved in endochondral b...

serine-type endopeptidase inhibitor activity,colla...

endoplasmic reticulum,endoplasmic reticulum lumen,...

71

33

71

_DTQSGSLLFIGR_.2|_LYGPSSVSFADDFVR_.2|_LYGPSSVSFADD...

SEN / CTL

Q16891

MICOS complex subunit MIC60

IMMT

4.19

1.94

0.0644

0.0216

biological_process,cristae formation,mitochondrial...

protein binding,poly(A) RNA binding

mitochondrion,mitochondrial inner membrane,membran...

130

79

130

_VAQDWLK_.2|_AFDSAVAK_.2|_QAAAHTDHLRDVLR_.4|_QAAAH...

SEN / CTL

Q9Y646

Carboxypeptidase Q

CPQ

4.15

2.07

0.0741

0.0235

proteolysis,thyroid hormone generation,tissue rege...

carboxypeptidase activity,protein homodimerization...

extracellular space,cytoplasm,lysosome,endoplasmic...

10

10

10

_LALLVDTVGPR_.2|_VHLEPVRIPHWER_.4|_VGALASLIR_.2|_A...

SEN / CTL

P63165

Small ubiquitin-related modifier 1

SUMO1

4.13

1.73

0.054

0.0195

DNA repair,double-strand break repair via nonhomol...

protein binding,transcription factor binding,potas...

heterochromatin,fibrillar center,XY body,nucleus,n...

8

6

8

_FLFEGQR_.2|_IADNHTPK_.2|_VIGQDSSEIHFK_.3|_VIGQDSS...

SEN / CTL

O60333

Q12756

Kinesin-like protein KIF1B;Kinesin-like protein KIF1A

KIF1B

KIF1A

4.13

2.46

0.101

0.0289

apoptotic process,microtubule-based movement,neuro...

microtubule motor activity,protein binding,ATP bin...

mitochondrion,kinesin complex,microtubule,microtub...

1

1

1

_SYTMMGK_.2

SEN / CTL

P60709

P63261

Actin, cytoplasmic 1;Actin, cytoplasmic 2

ACTB

ACTG1

4.11

2.93

1.85e-46

2.67e-44

retina homeostasis,movement of cell or subcellular...

structural constituent of cytoskeleton,protein bin...

nuclear chromatin,extracellular space,nucleoplasm,...

63

37

63

_AGFAGDDAPR_.2|_EITALAPSTMK_.2|_AVFPSIVGRPR_.3|_AV...

SEN / CTL

P25786

Proteasome subunit alpha type-1

PSMA1

4.09

0.55

0.006

0.00478

MAPK cascade,protein polyubiquitination,stimulator...

RNA binding,threonine-type endopeptidase activity,...

proteasome complex,nucleus,nucleoplasm,centrosome,...

45

25

45

_FVFDRPLPVSR_.3|_LVSLIGSK_.2|_RAQSELAAHQK_.3|_RAQS...

SEN / CTL

P48556

26S proteasome non-ATPase regulatory subunit 8

PSMD8

4.08

1.55

0.0449

0.0174

MAPK cascade,protein polyubiquitination,stimulator...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

24

15

24

_DIQTNVYIK_.2|_VAEFHTELER_.3|_VAEFHTELER_.2|_ILFTE...

SEN / CTL

P55060

Exportin-2

CSE1L

4.07

1.35

0.000718

0.000939

protein import into nucleus,protein export from nu...

nuclear export signal receptor activity,protein bi...

nucleus,nuclear envelope,nucleoplasm,cytoplasm,cyt...

93

60

93

_IIIPEIQK_.2|_LLQAFLER_.2|_AAC[+57]DLVR_.2|_TAHSLF...

SEN / CTL

P42785

Lysosomal Pro-X carboxypeptidase

PRCP

4.06

2.68

0.12

0.0326

regulation of thyroid hormone mediated signaling p...

serine-type carboxypeptidase activity,protein bind...

lysosome,plasma membrane,basal part of cell,extrac...

19

11

19

_NALDPMSVLLAR_.2|_NALDPMSVLLAR_.3|_NALDPM[+16]SVLL...

SEN / CTL

Q8N1F7

Nuclear pore complex protein Nup93

NUP93

4.05

1.52

0.0437

0.0172

mRNA export from nucleus,tRNA export from nucleus,...

protein binding,structural constituent of nuclear ...

nuclear envelope,nuclear pore,membrane,nuclear mem...

56

45

56

_GLFEEAAK_.2|_ASVLLGSR_.2|_TFGMAEEYHR_.3|_TFGMAEEY...

SEN / CTL

P60842

Eukaryotic initiation factor 4A-I

EIF4A1

4.04

2.51

0.0109

0.00744

nuclear-transcribed mRNA poly(A) tail shortening,t...

RNA cap binding,double-stranded RNA binding,mRNA b...

cytoplasm,cytosol,membrane,eukaryotic translation ...

86

39

86

_VLITTDLLAR_.2|_AILPC[+57]IK_.2|_KGVAINM[+16]VTEED...

SEN / CTL

P53621

Coatomer subunit alpha

COPA

4.04

0.83

0.0139

0.00879

intracellular protein transport,ER to Golgi vesicl...

hormone activity,structural molecule activity

Golgi membrane,extracellular space,cytoplasm,endop...

167

92

167

_KYDEVLHMVR_.2|_KYDEVLHMVR_.3|_KYDEVLHM[+16]VR_.2|...

SEN / CTL

P07203

Glutathione peroxidase 1

GPX1

4.04

0.94

0.0176

0.0103

response to reactive oxygen species,temperature ho...

glutathione peroxidase activity,SH3 domain binding

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

27

17

27

_NDVAWNFEK_.2|_FLVGPDGVPLRR_.3|_PLAGGEPVSLGSLR_.3|...

SEN / CTL

Q9NVU7

Protein SDA1 homolog

SDAD1

4.04

1.32

0.0338

0.0148

ribosomal large subunit export from nucleus,protei...

molecular_function

nucleus,nucleolus

16

12

16

_TVNVITTAC[+57]FSK_.2|_TLYTHIVTDIK_.3|_TLYTHIVTDIK...

SEN / CTL

O95336

6-phosphogluconolactonase

PGLS

4.01

1.3

0.0335

0.0148

carbohydrate metabolic process,pentose-phosphate s...

protein binding,6-phosphogluconolactonase activity

cytosol,extracellular exosome

31

19

31

_TVIFVATGEGK_.2|_VTLTLPVLNAAR_.3|_VTLTLPVLNAAR_.2|...

SEN / CTL

Q9Y580

RNA-binding protein 7

RBM7

4

1.28

0.0325

0.0145

regulation of alternative mRNA splicing, via splic...

nucleotide binding,single-stranded RNA binding,pol...

nucleus,nucleoplasm

12

9

12

_TLFVGNLETK_.2|_YTDHGSDHHYR_.3|_YTDHGSDHHYR_.2|_VT...

SEN / CTL

Q9Y613

FH1/FH2 domain-containing protein 1

FHOD1

4

1.33

0.0352

0.0152

nuclear migration,positive regulation of transcrip...

actin binding,protein binding,identical protein bi...

nucleus,cytoplasm,intercalated disc,membrane,bleb,...

44

34

44

_TPQSPAPC[+57]VLLR_.2|_HLGTAGTDVDLR_.3|_HLGTAGTDVD...

SEN / CTL

O95905

Protein ecdysoneless homolog

ECD

3.98

1.3

0.0338

0.0148

regulation of glycolytic process,transcription fro...

transcription coactivator activity,protein binding...

nucleus,nucleoplasm,cytoplasm,R2TP complex

20

14

20

_GLIEGSAQYR_.2|_LAHGFEILC[+57]SK_.3|_LAHGFEILC[+57...

SEN / CTL

Q9Y5X1

Sorting nexin-9

SNX9

3.98

1.35

0.0362

0.0155

mitotic cytokinesis,intracellular protein transpor...

protein binding,1-phosphatidylinositol binding,ubi...

ruffle,cytoplasm,endosome,trans-Golgi network,plas...

32

23

32

_ELLTVGQEHWK_.2|_ELLTVGQEHWK_.3|_DLHFLMEC[+57]NHEY...

SEN / CTL

P05165

Propionyl-CoA carboxylase alpha chain, mitochondrial

PCCA

3.98

1.71

0.0562

0.0201

biotin metabolic process,short-chain fatty acid ca...

biotin carboxylase activity,propionyl-CoA carboxyl...

mitochondrial matrix,cytosol

117

59

117

_HIEIQVLGDK_.2|_HGNALWLNER_.3|_HGNALWLNER_.2|_TVAI...

SEN / CTL

O75083

WD repeat-containing protein 1

WDR1

3.97

1.41

0.0394

0.0164

neutrophil mediated immunity,platelet degranulatio...

actin filament binding

podosome,extracellular region,cytoplasm,cytosol,ce...

76

47

76

_NIDNPALADIYTEHAHQVVVAK_.4|_NIDNPALADIYTEHAHQVVVAK...

SEN / CTL

Q96PY6

Serine/threonine-protein kinase Nek1

NEK1

3.95

1.45

0.042

0.0167

protein phosphorylation,mitotic nuclear division,p...

protein kinase activity,receptor signaling protein...

pericentriolar material,nucleus,cytoplasm,centroso...

71

47

71

_DRPSVNSILEK_.2|_DRPSVNSILEK_.3|_HTVGEVIK_.2|_LHLE...

SEN / CTL

Q9Y305

Acyl-coenzyme A thioesterase 9, mitochondrial

ACOT9

3.95

1.74

0.0589

0.0204

acyl-CoA metabolic process,long-chain fatty-acyl-C...

acetyl-CoA hydrolase activity,acyl-CoA hydrolase a...

mitochondrion,mitochondrial matrix

37

27

37

_YLTVQNTVR_.2|_VHSEVASLQEK_.3|_VHSEVASLQEK_.2|_SLE...

SEN / CTL

Q9H267

Vacuolar protein sorting-associated protein 33B

VPS33B

3.95

1.76

0.0604

0.0207

vesicle docking involved in exocytosis,endosome or...

protein binding

cytoplasm,lysosome,lysosomal membrane,late endosom...

21

18

21

_YIASLVNADK_.2|_TEHALLEGFNIR_.3|_TEHALLEGFNIR_.2|_...

SEN / CTL

Q8IXK0

Polyhomeotic-like protein 2

PHC2

3.95

2.22

0.0914

0.0269

multicellular organism development,spermatogenesis...

DNA binding,protein binding,zinc ion binding,ident...

heterochromatin,nucleus,nucleoplasm,PcG protein co...

12

10

12

_DLVGMGHHFLPSEPTK_.3|_DLVGMGHHFLPSEPTK_.4|_SSLLVGN...

SEN / CTL

Q9P0V3

SH3 domain-binding protein 4

SH3BP4

3.95

2.49

0.111

0.031

endocytosis,negative regulation of cell proliferat...

GDP-dissociation inhibitor activity,protein bindin...

nucleus,cytoplasm,clathrin-coated pit,clathrin-coa...

41

35

41

_DVIQELHLGLDK_.2|_LKEDC[+57]NNTENKER_.4|_LKEDC[+57...

SEN / CTL

Q92626

Peroxidasin homolog

PXDN

3.93

2.12

0.00621

0.00489

negative regulation of cytokine-mediated signaling...

peroxidase activity,interleukin-1 receptor antagon...

proteinaceous extracellular matrix,extracellular s...

36

30

36

_AGEIFER_.2|_AEGNPKPEIIWLR_.3|_AFFSPFR_.2|_ITHLVPG...

SEN / CTL

P01133

Pro-epidermal growth factor

EGF

3.93

1.61

0.0518

0.019

MAPK cascade,activation of MAPKK activity,activati...

protein tyrosine kinase activity,Ras guanyl-nucleo...

extracellular region,extracellular space,lysosomal...

1

1

1

_QSVIEM[+16]ANLDGSK_.2

SEN / CTL

Q9NVA2

Septin-11

11-Sep

3.9

1.73

0.0597

0.0205

cell cycle,protein heterooligomerization,cell divi...

protein binding,GTP binding

stress fiber,cytoplasm,cell junction,axon,dendriti...

45

28

45

_SYELQESNVR_.2|_ADTIAKNELHK_.3|_KKELEEEVNNFQK_.4|_...

SEN / CTL

P49427

Ubiquitin-conjugating enzyme E2 R1

CDC34

3.89

1.46

0.0441

0.0173

G1/S transition of mitotic cell cycle,protein poly...

ubiquitin-protein transferase activity,protein bin...

nucleus,nucleoplasm,cytoplasm

4

4

4

_GLQEEPVEGFR_.2|_LKFPIDYPYSPPAFR_.3|_VPTTLAEYC[+57...

SEN / CTL

Q9NUQ3

Gamma-taxilin

TXLNG

3.88

1.69

0.058

0.0204

transcription, DNA-templated,regulation of transcr...

syntaxin binding,protein heterodimerization activi...

cytosol,nuclear membrane

34

26

34

_YADLLEESR_.2|_RALGAHLEAEPK_.3|_RALGAHLEAEPK_.2|_G...

SEN / CTL

Q9Y265

RuvB-like 1

RUVBL1

3.87

1.38

0.0401

0.0165

box C/D snoRNP assembly,DNA repair,DNA recombinati...

DNA helicase activity,protein binding,ATP binding,...

Swr1 complex,nucleus,nucleoplasm,cytoplasm,Golgi a...

55

35

55

_TM[+16]LYTPQEMK_.2|_TMLYTPQEMK_.2|_KTEVLMENFR_.3|...

SEN / CTL

Q13823

Nucleolar GTP-binding protein 2

GNL2

3.87

1.52

0.0475

0.018

biological_process,ribosome biogenesis

GTPase activity,GTP binding,poly(A) RNA binding

nucleus,nucleolus,membrane

26

23

26

_VC[+57]NVAPIAGETK_.2|_AQREEEQEHSNKAPR_.4|_GAFIQLL...

SEN / CTL

P13995

Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

MTHFD2

3.86

0.68

0.0102

0.00708

one-carbon metabolic process,folic acid-containing...

magnesium ion binding,methenyltetrahydrofolate cyc...

extracellular space,mitochondrion,mitochondrial ma...

45

25

45

_LVGDVDFEGVR_.2|_VHDPVTAK_.2|_DVDGFHVINVGR_.3|_DVD...

SEN / CTL

Q6PI48

Aspartate--tRNA ligase, mitochondrial

DARS2

3.86

1.59

0.0522

0.019

tRNA aminoacylation for protein translation,tRNA a...

tRNA binding,aspartate-tRNA ligase activity,protei...

nucleus,mitochondrion,mitochondrial matrix

60

37

60

_EFLVPSREPGK_.2|_EFLVPSREPGK_.3|_VSKPTDSKAER_.3|_L...

SEN / CTL

Q13769

THO complex subunit 5 homolog

THOC5

3.86

1.63

0.0546

0.0197

termination of RNA polymerase II transcription,RNA...

mRNA binding,protein binding

transcription export complex,THO complex,THO compl...

32

22

32

_EYLSSLQPR_.2|_YNHPQGFFSHR_.3|_SRGGKDVAIEIEER_.3|_...

SEN / CTL

P10809

60 kDa heat shock protein, mitochondrial

HSPD1

3.84

3.05

0.161

0.0421

B cell cytokine production,MyD88-dependent toll-li...

lipopolysaccharide binding,p53 binding,DNA replica...

extracellular space,cytoplasm,mitochondrion,mitoch...

188

80

188

_RGVMLAVDAVIAELK_.2|_RGVMLAVDAVIAELK_.3|_RGVM[+16]...

SEN / CTL

E9PAV3

Nascent polypeptide-associated complex subunit alpha, muscle-specific form

NACA

3.83

0.89

0.0173

0.0102

transcription, DNA-templated,regulation of transcr...

DNA binding

nucleus,cytoplasm

28

16

28

_GAPTPPAATPPSPK_.2|_SKNILFVITKPDVYK_.4|_SKNILFVITK...

SEN / CTL

Q2NKX8

DNA excision repair protein ERCC-6-like

ERCC6L

3.83

1.41

0.0421

0.0167

sister chromatid cohesion,mitotic nuclear division...

DNA binding,helicase activity,protein binding,ATP ...

condensed chromosome kinetochore,nucleoplasm,cytop...

24

20

24

_FFSSQIPSSVNK_.2|_LRDEGHQTLVFSQSR_.4|_LRDEGHQTLVFS...

SEN / CTL

P49757

Protein numb homolog

NUMB

3.83

2.53

0.119

0.0326

axonogenesis,lateral ventricle development,neurobl...

protein binding,beta-catenin binding,alpha-catenin...

nucleus,early endosome,plasma membrane,cell-cell a...

27

22

27

_PAHTALAPVAMPVRETNPWAHAPDAANK_.5|_YLGHVEVDESR_.3|_...

SEN / CTL

P40222

Alpha-taxilin

TXLNA

3.82

1.69

0.0595

0.0205

exocytosis,cell proliferation,B cell activation

cytokine activity,protein binding,syntaxin binding...

extracellular region,cytoplasm,membrane

51

37

51

_QQLALYTEK_.2|_KYAELLEEHR_.3|_KYAELLEEHR_.2|_LRQEN...

SEN / CTL

P17936

Insulin-like growth factor-binding protein 3

IGFBP3

3.79

0.79

0.0000774

0.000138

regulation of cell growth,osteoblast differentiati...

fibronectin binding,protein binding,insulin-like g...

extracellular region,extracellular space,nucleus,i...

13

10

13

_FLNVLSPR_.2|_EMEDTLNHLK_.3|_EM[+16]EDTLNHLK_.3|_S...

SEN / CTL

Q09666

Neuroblast differentiation-associated protein AHNAK

AHNAK

3.79

2.11

0.000664

0.000881

regulation of RNA splicing,protein oligomerization...

protein binding,S100 protein binding,poly(A) RNA b...

nucleus,cytoplasm,lysosomal membrane,cytosol,plasm...

666

433

666

_FSMPGFK_.2|_FSM[+16]PGFK_.2|_ISMPDLDLNLKGPK_.3|_I...

SEN / CTL

P50851

Lipopolysaccharide-responsive and beige-like anchor protein

LRBA

3.79

1.52

0.0495

0.0185

biological_process

molecular_function

lysosome,endoplasmic reticulum,Golgi apparatus,pla...

87

75

87

_LSSAIAFTYNPR_.2|_ILAYTEGLHGK_.3|_DLSKPIGALNPK_.3|...

SEN / CTL

Q5JTV8

Torsin-1A-interacting protein 1

TOR1AIP1

3.78

0.74

0.0124

0.00823

positive regulation of ATPase activity,protein loc...

ATPase activator activity,protein binding,lamin bi...

nucleus,nuclear inner membrane,integral component ...

26

21

26

_TPQEWAPQTAR_.2|_ISHLVLPVQPENALKR_.4|_YEATSVQQK_.2...

SEN / CTL

P01625

Ig kappa chain V-IV region Len

NaN

3.78

0.99

0.0222

0.012

8

5

8

_SSQSVLYSSNSK_.2|_LLIYWASTR_.2|_NYLAWYQQK_.2|_NYLA...

SEN / CTL

P23528

Q9Y281

Cofilin-1;Cofilin-2

CFL1

CFL2

3.77

0.38

0.00342

0.00319

cytoskeleton organization,Rho protein signal trans...

protein binding,actin filament binding;protein bin...

extracellular space,nucleus,cytoplasm,focal adhesi...

1

1

1

_YALYDATYETK_.2

SEN / CTL

Q9P2R7

Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial

SUCLA2

3.75

0.93

0.02

0.0112

tricarboxylic acid cycle,succinyl-CoA metabolic pr...

succinate-CoA ligase (ADP-forming) activity,protei...

mitochondrion,mitochondrial matrix,myelin sheath,e...

34

28

34

_IC[+57]NQVLVC[+57]ER_.2|_GTFESGLK_.2|_DLEIKIPVVVR...

SEN / CTL

Q9Y5P6

Mannose-1-phosphate guanyltransferase beta

GMPPB

3.75

2.07

0.0881

0.0263

GDP-mannose biosynthetic process

mannose-1-phosphate guanylyltransferase activity,p...

cytoplasm,mitochondrion,extracellular exosome

22

15

22

_SHSWLESC[+57]IVGWR_.3|_SHSWLESC[+57]IVGWR_.2|_HHG...

SEN / CTL

Q15311

RalA-binding protein 1

RALBP1

3.74

0.93

0.0198

0.0111

transport,endocytosis,chemotaxis,signal transducti...

GTPase activator activity,protein binding,ATPase a...

cytosol,membrane

12

9

12

_LRAEIAEIQSR_.2|_LRAEIAEIQSR_.3|_QEFLLNC[+57]LHR_....

SEN / CTL

O00400

Acetyl-coenzyme A transporter 1

SLC33A1

3.73

1

0.023

0.0122

transport,acetyl-CoA transport,proton transport,BM...

acetyl-CoA transporter activity,solute:proton symp...

Golgi membrane,endoplasmic reticulum membrane,inte...

6

6

6

_EETQGITDTYK_.2|_TPDAVELC[+57]K_.2|_IGFSAADAVTGLK_...

SEN / CTL

Q15027

Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1

ACAP1

3.73

1.07

0.0264

0.013

protein transport,positive regulation of GTPase ac...

GTPase activator activity,protein binding,metal io...

membrane,recycling endosome membrane

16

14

16

_RAQEAEEAGAALRTAR_.4|_RAQEAEEAGAALRTAR_.3|_EGPGGLV...

SEN / CTL

P30711

Glutathione S-transferase theta-1

GSTT1

3.73

1.45

0.047

0.0178

glutathione metabolic process,cellular oxidant det...

glutathione transferase activity,glutathione perox...

cytosol,extracellular exosome

23

14

23

_VPDYWYPQDLQAR_.2|_GQHLSDAFAQVNPLKK_.4|_ARVDEYLAWQ...

SEN / CTL

Q9Y4A5

Transformation/transcription domain-associated protein

TRRAP

3.71

0.92

0.0198

0.0111

DNA repair,transcription, DNA-templated,regulation...

transcription cofactor activity,protein binding,ki...

PCAF complex,Swr1 complex,nucleus,nucleoplasm,Golg...

85

71

85

_RGLSVDSAQEVK_.2|_C[+57]ATPLKDEER_.3|_KGIEHDNPISR_...

SEN / CTL

Q9H3P7

Golgi resident protein GCP60

ACBD3

3.7

1.41

0.0454

0.0175

steroid biosynthetic process,transport

fatty-acyl-CoA binding,protein binding,protein kin...

Golgi membrane,mitochondrion,Golgi apparatus,membr...

35

24

35

_EDAMVEFVK_.2|_C[+57]C[+57]HLFSTYVASHK_.4|_C[+57]C...

SEN / CTL

Q9Y240

C-type lectin domain family 11 member A

CLEC11A

3.68

1.48

0.00174

0.00194

positive regulation of cell proliferation

growth factor activity,carbohydrate binding

extracellular region,extracellular space,cytoplasm

16

12

16

_VVELTQGLR_.2|_LAGLDAGLHQLHVR_.3|_LAGLDAGLHQLHVR_....

SEN / CTL

Q14692

Ribosome biogenesis protein BMS1 homolog

BMS1

3.68

0.94

0.0212

0.0116

maturation of SSU-rRNA from tricistronic rRNA tran...

GTPase activity,ATP binding,GTP binding,U3 snoRNA ...

nucleus,nucleoplasm,nucleolus,90S preribosome

39

32

39

_GPVTIVSGK_.2|_IMGVLTHLDSFK_.3|_AFAVQSAVR_.2|_SRDP...

SEN / CTL

P30837

Aldehyde dehydrogenase X, mitochondrial

ALDH1B1

3.68

1.32

0.0404

0.0165

carbohydrate metabolic process,ethanol catabolic p...

aldehyde dehydrogenase (NAD) activity

nucleoplasm,mitochondrion,mitochondrial matrix,int...

51

31

51

_YGLAAAVFTR_.2|_LLC[+57]GGER_.2|_IEEVVER_.2|_KIEEV...

SEN / CTL

Q10570

Cleavage and polyadenylation specificity factor subunit 1

CPSF1

3.67

0.85

0.0173

0.0102

mRNA splicing, via spliceosome,termination of RNA ...

protein binding,enzyme binding,mRNA 3'-UTR AU-rich...

nucleoplasm,mRNA cleavage and polyadenylation spec...

61

47

61

_RVDATAGWSAAGK_.2|_ADFHVGAHVNTFWR_.4|_ADFHVGAHVNTF...

SEN / CTL

O95817

BAG family molecular chaperone regulator 3

BAG3

3.67

1.01

0.0243

0.0126

protein folding,brain development,extrinsic apopto...

adenyl-nucleotide exchange factor activity,protein...

cytoplasm,cytosol,plasma membrane,cell-cell adhere...

42

29

42

_FRTEAAAAAPQR_.2|_FRTEAAAAAPQR_.3|_VEAILEK_.2|_SST...

SEN / CTL

Q12923

Tyrosine-protein phosphatase non-receptor type 13

PTPN13

3.67

1.29

0.0385

0.0162

protein dephosphorylation,regulation of phosphatid...

protein tyrosine phosphatase activity,protein bind...

nucleus,cytoplasm,cytoskeleton,plasma membrane,lam...

156

110

156

_VNIMLLNGQR_.2|_TVLDAC[+57]SAHIR_.3|_TVLDAC[+57]SA...

SEN / CTL

Q71U36

Tubulin alpha-1A chain

TUBA1A

3.66

2.53

4.93e-14

5.46e-13

G2/M transition of mitotic cell cycle,cytoskeleton...

GTPase activity,structural molecule activity,struc...

nucleus,cytosol,microtubule,cytoplasmic microtubul...

112

45

112

_DVNAAIATIK_.2|_AVFVDLEPTVIDEVRTGTYR_.3|_AVFVDLEPT...

SEN / CTL

Q7LG56

Ribonucleoside-diphosphate reductase subunit M2 B

RRM2B

3.65

0.6

0.00884

0.0064

kidney development,renal system process,mitochondr...

ribonucleoside-diphosphate reductase activity, thi...

nucleoplasm,cytoplasm,mitochondrion,ribonucleoside...

15

12

15

_FSQEVQVPEAR_.2|_RVSEYQR_.2|_SNEEPLLR_.2|_LLVELGFS...

SEN / CTL

P06239

P06241

P07947

P07948

P08631

P09769

P11362

P20794

P21802

P22455

P22607

P51451

Q8IZL9

Q9UPZ9

Tyrosine-protein kinase Lck;Tyrosine-protein kinase Fyn;Tyrosine-protein kinase Yes;Tyrosine-protein kinase Lyn;Tyrosine-protein kinase HCK;Tyrosine-protein kinase Fgr;Fibroblast growth factor receptor 1;Serine/threonine-protein kinase MAK;Fibroblast growth factor receptor 2;Fibroblast growth factor receptor 4;Fibroblast growth factor receptor 3;Tyrosine-protein kinase Blk;Cyclin-dependent kinase 20;Serine/threonine-protein kinase ICK

LCK

FYN

YES1

LYN

HCK

FGR

FGFR1

MAK

FGFR2

FGFR4

FGFR3

BLK

CDK20

ICK

3.64

0.86

0.0182

0.0105

protein phosphorylation,protein dephosphorylation,...

glycoprotein binding,protein tyrosine kinase activ...

pericentriolar material,immunological synapse,cyto...

1

1

1

_IADFGLAR_.2

SEN / CTL

O95619

YEATS domain-containing protein 4

YEATS4

3.64

1.17

0.0325

0.0145

transcription, DNA-templated,cytoskeleton organiza...

DNA binding,transcription factor activity, sequenc...

nucleoplasm,nuclear matrix,NuA4 histone acetyltran...

7

6

7

_TSFEIAELK_.2|_GVTIVKPIVYGNVAR_.3|_NEDMSAYVK_.2|_I...

SEN / CTL

Q15434

RNA-binding motif, single-stranded-interacting protein 2

RBMS2

3.63

0.74

0.0137

0.00867

RNA processing

nucleotide binding,RNA binding,poly(A) RNA binding

nucleus

8

5

8

_C[+57]EAIITHFNGK_.2|_C[+57]EAIITHFNGK_.3|_GLQPGTT...

SEN / CTL

O00148

ATP-dependent RNA helicase DDX39A

DDX39A

3.63

0.84

0.0173

0.0102

mRNA splicing, via spliceosome,termination of RNA ...

ATP-dependent RNA helicase activity,protein bindin...

nucleus,nucleoplasm,spliceosomal complex,membrane,...

52

28

52

_NC[+57]PHVVVGTPGR_.2|_NC[+57]PHVVVGTPGR_.3|_DFLLK...

SEN / CTL

O95674

Phosphatidate cytidylyltransferase 2

CDS2

3.63

0.97

0.0231

0.0122

phosphatidylglycerol biosynthetic process,CDP-diac...

phosphatidate cytidylyltransferase activity

mitochondrial inner membrane,endoplasmic reticulum...

10

7

10

_VAHEPVAPPEDK_.2|_VAHEPVAPPEDK_.3|_VAHEPVAPPEDKESE...

SEN / CTL

P57729

Q13637

Ras-related protein Rab-38;Ras-related protein Rab-32

RAB38

RAB32

3.63

1.09

0.0287

0.0139

mitochondrion organization,small GTPase mediated s...

GTPase activity,protein binding,GTP binding,GTP-de...

mitochondrion,lysosome,early endosome,endoplasmic ...

1

1

1

_ATIGVDFALK_.2

SEN / CTL

P33527

Multidrug resistance-associated protein 1

ABCC1

3.62

1.3

0.0406

0.0166

leukotriene metabolic process,transport,cobalamin ...

transporter activity,ATP binding,cobalamin-transpo...

plasma membrane,integral component of plasma membr...

25

23

25

_SSLTLGLFR_.2|_IGLHDLR_.2|_VVYSSKDPAQPK_.3|_DGGGTN...

SEN / CTL

O75347

Tubulin-specific chaperone A

TBCA

3.61

1.81

0.0000252

0.0000518

protein folding,tubulin complex assembly,post-chap...

protein binding,poly(A) RNA binding,beta-tubulin b...

nucleolus,cytoplasm,microtubule,microtubule cytosk...

23

14

23

_LVLDSVKLEA_.2|_RLEAAYLDLQR_.3|_RLEAAYLDLQR_.2|_MM...

SEN / CTL

P06733

Alpha-enolase

ENO1

3.6

2.5

4.54e-22

1.48e-20

gluconeogenesis,transcription, DNA-templated,respo...

magnesium ion binding,DNA binding,phosphopyruvate ...

phosphopyruvate hydratase complex,extracellular sp...

114

54

114

_TIAPALVSK_.2|_AGAVEKGVPLYR_.3|_AVEHINKTIAPALVSK_....

SEN / CTL

Q08752

Peptidyl-prolyl cis-trans isomerase D

PPID

3.6

0.61

0.00944

0.00666

negative regulation of transcription from RNA poly...

peptidyl-prolyl cis-trans isomerase activity,prote...

nucleus,nucleoplasm,nucleolus,cytoplasm

29

24

29

_ILLITEDLK_.2|_EYDQALADLKK_.3|_EYDQALADLKK_.2|_AIQ...

SEN / CTL

P13797

Plastin-3

PLS3

3.6

0.79

0.0158

0.00963

actin filament bundle assembly,actin filament netw...

calcium ion binding,actin filament binding

cytoplasm,actin filament,actin filament bundle

71

44

71

_VYALPEDLVEVKPK_.3|_VYALPEDLVEVKPK_.2|_LMLDGDR_.2|...

SEN / CTL

Q7Z417

Nuclear fragile X mental retardation-interacting protein 2

NUFIP2

3.6

0.9

0.0201

0.0112

RNA binding,protein binding,poly(A) RNA binding

nucleus,cytoplasm,cytoplasmic stress granule,membr...

34

25

34

_GC[+57]ENLNIVQDK_.2|_HTLQQHQETPK_.3|_HTLQQHQETPK_...

SEN / CTL

O15195

Villin-like protein

VILL

3.6

1.32

0.0419

0.0167

cytoskeleton organization,actin filament capping

actin binding,structural constituent of cytoskelet...

actin cytoskeleton

24

20

24

_GLALTYSLR_.2|_HVETNLFNIQR_.3|_HVETNLFNIQR_.2|_LQD...

SEN / CTL

Q14839

Chromodomain-helicase-DNA-binding protein 4

CHD4

3.59

1.03

0.0264

0.013

negative regulation of transcription from RNA poly...

RNA polymerase II repressing transcription factor ...

nuclear chromatin,nucleus,nucleoplasm,cytoplasm,ce...

90

75

90

_QLEELLSDMK_.2|_GNFLEIK_.2|_C[+57]TC[+57]PALK_.2|_...

SEN / CTL

Q13825

Methylglutaconyl-CoA hydratase, mitochondrial

AUH

3.58

1.32

0.0426

0.0169

leucine catabolic process,fatty acid beta-oxidatio...

mRNA 3'-UTR binding,enoyl-CoA hydratase activity,m...

mitochondrion,mitochondrial matrix

12

10

12

_DRLEGLLAFK_.2|_HLEEENRGIVVLGINR_.4|_HLEEENRGIVVLG...

SEN / CTL

O15230

Laminin subunit alpha-5

LAMA5

3.58

1.46

0.0511

0.0189

angiogenesis,branching involved in ureteric bud mo...

integrin binding,structural molecule activity

extracellular region,basement membrane,basal lamin...

88

76

88

_TLAEVER_.2|_LLHSLDQAKEELER_.4|_LLHSLDQAKEELER_.3|...

SEN / CTL

Q4ZIN3

Membralin

TMEM259

3.57

1.68

0.0666

0.022

response to endoplasmic reticulum stress,negative ...

endoplasmic reticulum membrane,integral component ...

3

3

3

_APVFLQFC[+57]DSGGR_.2|_GLAENEENKGFLR_.3|_TPNLNPNP...

SEN / CTL

P31150

Rab GDP dissociation inhibitor alpha

GDI1

3.56

1.02

0.000352

0.000528

signal transduction,protein transport,Rab protein ...

GDP-dissociation inhibitor activity,Rab GDP-dissoc...

cytoplasm,Golgi apparatus,cytosol,midbody,neuron p...

53

28

53

_MAGTAFDFENMKR_.3|_M[+16]AGTAFDFENMKR_.3|_MAGTAFDF...

SEN / CTL

P61026

Ras-related protein Rab-10

RAB10

3.56

0.88

0.0197

0.0111

Golgi to plasma membrane transport,small GTPase me...

GTPase activity,protein binding,GTP binding,GDP bi...

Golgi membrane,endosome,endoplasmic reticulum memb...

19

14

19

_FHTITTSYYR_.2|_FHTITTSYYR_.3|_ANINIEK_.2|_SFENISK...

SEN / CTL

O75122

CLIP-associating protein 2

CLASP2

3.56

0.9

0.0205

0.0114

microtubule cytoskeleton organization,vesicle targ...

dystroglycan binding,protein binding,microtubule b...

condensed chromosome kinetochore,cytoplasm,Golgi a...

107

70

107

_SSGSVASLPQSDR_.2|_HAAVLVETIKK_.3|_HAAVLVETIKK_.2|...

SEN / CTL

Q6IQ23

Pleckstrin homology domain-containing family A member 7

PLEKHA7

3.56

0.9

0.0207

0.0114

zonula adherens maintenance,epithelial cell-cell a...

delta-catenin binding

nucleus,cytoplasm,centrosome,zonula adherens,cell ...

48

39

48

_ILVESVKNPER_.2|_SMLEVPR_.2|_TGEPVNSGHMIR_.3|_ILVE...

SEN / CTL

Q16853

Membrane primary amine oxidase

AOC3

3.56

1.36

0.0452

0.0175

xenobiotic metabolic process,inflammatory response...

copper ion binding,calcium ion binding,protein bin...

cytoplasm,early endosome,endoplasmic reticulum,Gol...

22

18

22

_NLVTMTTAPR_.2|_AAALAHLDRGSPPPAR_.4|_AAALAHLDRGSPP...

SEN / CTL

A3KMH1

von Willebrand factor A domain-containing protein 8

VWA8

3.56

1.36

0.0457

0.0176

ATP binding,ATPase activity

extracellular region,mitochondrion

57

51

57

_LVAAFGELR_.2|_LIHDRELSLYDGSR_.4|_LIHDRELSLYDGSR_....

SEN / CTL

Q14149

MORC family CW-type zinc finger protein 3

MORC3

3.55

1.22

0.0372

0.0157

protein phosphorylation,cell aging,post-embryonic ...

RNA binding,zinc ion binding

nucleoplasm,nuclear matrix,PML body

28

23

28

_IIIWNLR_.2|_HLSEGTNSYATR_.3|_HLSEGTNSYATR_.2|_IPE...

SEN / CTL

Q96P70

Importin-9

IPO9

3.55

1.3

0.0417

0.0167

protein import into nucleus,transcription factor i...

protein binding,Ran GTPase binding,protein transpo...

nuclear envelope,cytoplasm,cytosol,membrane

49

30

49

_QHLFYGQYEGK_.3|_QHLFYGQYEGK_.2|_LLQHGINADDK_.3|_L...

SEN / CTL

P51149

Ras-related protein Rab-7a

RAB7A

3.51

1.15

0.0339

0.0148

protein targeting to lysosome,endocytosis,epiderma...

GTPase activity,protein binding,GTP binding,GDP bi...

autophagosome membrane,lysosome,lysosomal membrane...

34

23

34

_ATIGADFLTK_.2|_EVMVDDR_.2|_TSLMNQYVNKK_.3|_TSLMNQ...

SEN / CTL

Q15527

Surfeit locus protein 2

SURF2

3.51

1.43

0.0508

0.0189

biological_process

molecular_function

cellular_component,nucleus,nucleolus,plasma membra...

8

7

8

_C[+57]ILTGHELPC[+57]R_.3|_RREDQMDGDGPRPR_.4|_QGVE...

SEN / CTL

Q5T0F9

Coiled-coil and C2 domain-containing protein 1B

CC2D1B

3.5

0.88

0.0206

0.0114

negative regulation of transcription from RNA poly...

RNA polymerase II core promoter proximal region se...

nucleus,nucleoplasm,intracellular membrane-bounded...

18

14

18

_GQAPLPMAHIEK_.2|_GQAPLPMAHIEK_.3|_RFGAVLEALEK_.3|...

SEN / CTL

Q08174

Protocadherin-1

PCDH1

3.5

1.13

0.0329

0.0146

homophilic cell adhesion via plasma membrane adhes...

calcium ion binding

plasma membrane,integral component of plasma membr...

5

5

5

_TGDIFTTETSIDR_.2|_VTVLDTNDNAPK_.2|_SPKPVKPVEDEDEA...

SEN / CTL

Q14643

Inositol 1,4,5-trisphosphate receptor type 1

ITPR1

3.5

1.16

0.0349

0.0152

response to hypoxia,calcium ion transport,signal t...

inositol 1,4,5-trisphosphate-sensitive calcium-rel...

nuclear inner membrane,nucleolus,endoplasmic retic...

58

49

58

_LTFEVVNLAR_.2|_GGDSLVPR_.2|_NVGHNIYILAHQLAR_.4|_N...

SEN / CTL

P82675

28S ribosomal protein S5, mitochondrial

MRPS5

3.5

1.54

0.0588

0.0204

translation,mitochondrial translational elongation...

structural constituent of ribosome,poly(A) RNA bin...

mitochondrion,mitochondrial inner membrane,mitocho...

29

20

29

_DPEPEDEVPDVK_.2|_GAAGFSIGK_.2|_GQIIGEGR_.2|_YEDHT...

SEN / CTL

Q92805

Golgin subfamily A member 1

GOLGA1

3.49

0.79

0.0168

0.01

protein targeting to Golgi

protein binding

Golgi apparatus,trans-Golgi network,cytosol,Golgi ...

22

18

22

_TLAEQNLEDTR_.2|_EDVITHLQEK_.3|_EDVITHLQEK_.2|_IRP...

SEN / CTL

Q96ME1

F-box/LRR-repeat protein 18

FBXL18

3.48

1.51

0.0573

0.0203

18

18

18

_VNLSGC[+57]HLTSLR_.3|_HLNLSAAHHHSSEGLGR_.4|_NVVLD...

SEN / CTL

O94760

N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

DDAH1

3.48

1.53

0.0587

0.0204

citrulline metabolic process,regulation of systemi...

catalytic activity,dimethylargininase activity,ami...

mitochondrion,cytosol,extracellular exosome

37

21

37

_GAEILADTFK_.2|_AERQHQLYVGVLGSK_.4|_AERQHQLYVGVLGS...

SEN / CTL

Q14644

Ras GTPase-activating protein 3

RASA3

3.47

0.97

0.0251

0.0127

MAPK cascade,signal transduction,positive regulati...

GTPase activator activity,calcium-release channel ...

cytoplasm,cytosol,intrinsic component of the cytop...

25

24

25

_LTNHEFTYHK_.2|_SLKPDDLGSLR_.3|_QVIAGVGALEQEHAQYKR...

SEN / CTL

Q3SY69

Mitochondrial 10-formyltetrahydrofolate dehydrogenase

ALDH1L2

3.47

1.58

0.063

0.0213

one-carbon metabolic process,biosynthetic process,...

aldehyde dehydrogenase (NAD) activity,formyltetrah...

mitochondrion,mitochondrial matrix,extracellular e...

42

38

42

_VSYASLADVDK_.2|_KVSLELGGK_.2|_ADPLALAAEK_.2|_GVIN...

SEN / CTL

Q99798

Aconitate hydratase, mitochondrial

ACO2

3.47

2.2

0.112

0.0311

liver development,generation of precursor metaboli...

aconitate hydratase activity,iron ion binding,3 ir...

nucleus,mitochondrion,mitochondrial matrix,myelin ...

142

75

142

_NDANPETHAFVTSPEIVTALAIAGTLK_.3|_NDANPETHAFVTSPEIV...

SEN / CTL

Q15287

RNA-binding protein with serine-rich domain 1

RNPS1

3.46

1.02

0.0276

0.0134

nuclear-transcribed mRNA catabolic process, nonsen...

nucleotide binding,mRNA 3'-UTR binding,protein bin...

nucleus,nucleoplasm,cytoplasm,cytosol,nuclear spec...

17

6

17

_DHIM[+16]EIFSTYGK_.2|_DHIMEIFSTYGK_.3|_DHIM[+16]E...

SEN / CTL

A0AVT1

Ubiquitin-like modifier-activating enzyme 6

UBA6

3.46

1.43

0.0522

0.019

ubiquitin-dependent protein catabolic process,lear...

ubiquitin activating enzyme activity,protein bindi...

cytoplasm,cytosol

84

57

84

_MYSIEPADRFK_.3|_NLVLAGIK_.2|_MLYVPVMPGHAK_.3|_MLY...

SEN / CTL

P19338

Nucleolin

NCL

3.46

1.63

0.0665

0.022

angiogenesis,positive regulation of transcription ...

nucleotide binding,RNA binding,protein binding,pro...

nucleus,nucleoplasm,nucleolus,cell cortex,membrane...

97

63

97

_FGYVDFESAEDLEK_.3|_FGYVDFESAEDLEK_.2|_LELQGPR_.2|...

SEN / CTL

Q9UF12

Probable proline dehydrogenase 2

PRODH2

3.45

1.51

0.0587

0.0204

proline catabolic process to glutamate,oxidation-r...

proline dehydrogenase activity,FAD binding

mitochondrion,mitochondrial inner membrane

15

11

15

_GWQSLSFDGGAFHLK_.2|_GWQSLSFDGGAFHLK_.3|_RPGASLELS...

SEN / CTL

O43314

Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2

PPIP5K2

3.45

1.71

0.0727

0.0232

inositol metabolic process,phosphorylation,dephosp...

inositol-1,3,4,5,6-pentakisphosphate kinase activi...

cytosol

26

22

26

_VSLNTYTPAK_.2|_FHVELHFSPGAK_.3|_IYASDEGR_.2|_LYFT...

SEN / CTL

Q9C0I1

Myotubularin-related protein 12

MTMR12

3.45

1.86

0.0852

0.0257

regulation of catalytic activity,toxin transport

protein binding,phosphatase regulator activity

cytoplasm

13

11

13

_HHSQQAPQAEAPC[+57]LLR_.3|_HHSQQAPQAEAPC[+57]LLR_....

SEN / CTL

O15212

Prefoldin subunit 6

PFDN6

3.45

2.87

0.173

0.0443

protein folding,chaperone-mediated protein complex...

unfolded protein binding,chaperone binding

cytoplasm,prefoldin complex

20

15

20

_KLQGEVEK_.2|_RLDYITAEIK_.3|_RLDYITAEIK_.2|_LLGPVL...

SEN / CTL

Q14019

Coactosin-like protein

COTL1

3.44

3.13

0.000801

0.00103

biological_process,defense response to fungus

actin binding,protein binding,enzyme binding

nucleus,cytoplasm,cytoskeleton,extracellular exoso...

26

20

26

_SKFALITWIGENVSGLQR_.3|_SKFALITWIGENVSGLQR_.2|_EVV...

SEN / CTL

P17516

P42330

Q04828

Aldo-keto reductase family 1 member C4;Aldo-keto reductase family 1 member C3;Aldo-keto reductase family 1 member C1

AKR1C4

AKR1C3

AKR1C1

3.43

0.91

0.0228

0.0121

retinoid metabolic process,bile acid biosynthetic ...

retinal dehydrogenase activity,aldo-keto reductase...

cytoplasm,cytosol,extracellular exosome;intracellu...

1

1

1

_LAIEAGFR_.2

SEN / CTL

Q13541

Eukaryotic translation initiation factor 4E-binding protein 1

EIF4EBP1

3.43

0.97

0.0258

0.0129

G1/S transition of mitotic cell cycle,IRES-depende...

protein binding,eukaryotic initiation factor 4E bi...

nucleoplasm,cytoplasm,cytosol,protein complex

8

6

8

_RAGGEESQFEMDI_.2|_AGGEESQFEMDI_.2|_DLPTIPGVTSPSSD...

SEN / CTL

Q92890

Ubiquitin fusion degradation protein 1 homolog

UFD1L

3.43

1.1

0.0325

0.0145

skeletal system development,ubiquitin-dependent pr...

thiol-dependent ubiquitin-specific protease activi...

nucleus,nucleoplasm,cytosol,VCP-NPL4-UFD1 AAA ATPa...

16

11

16

_C[+57]FSVSMLAGPNDR_.2|_AVLENALR_.2|_FVAFSGEGQSLRK...

SEN / CTL

Q96CV9

Optineurin

OPTN

3.42

1.09

0.032

0.0144

protein targeting to Golgi,G2/M transition of mito...

protein binding,protein C-terminus binding,Rab GTP...

Golgi membrane,nucleus,nucleoplasm,cytoplasm,autop...

23

20

23

_GRFEELSAWTEK_.2|_GRFEELSAWTEK_.3|_ADLLGIVSELQLK_....

SEN / CTL

A6NM15

Q4V339

Q5JTY5

Q5RIA9

Q8IUF1

Q9BRT8

Putative COBW domain-containing protein 7;COBW domain-containing protein 6;COBW domain-containing protein 3;COBW domain-containing protein 5;COBW domain-containing protein 2;COBW domain-containing protein 1

CBWD7

CBWD6

CBWD3

CBWD5

CBWD2

CBWD1

3.42

1.88

0.0874

0.0262

;;;;;

ATP binding;ATP binding;ATP binding;ATP binding;AT...

;;;;;

1

1

1

_QLFIATVTETEK_.2

SEN / CTL

P46940

Ras GTPase-activating-like protein IQGAP1

IQGAP1

3.41

1.04

0.0296

0.0141

regulation of cytokine production,signal transduct...

GTPase inhibitor activity,GTPase activator activit...

ruffle,nucleus,cytoplasm,cytosol,microtubule,actin...

200

128

200

_VDFTEEEINNMK_.2|_VDFTEEEINNM[+16]K_.2|_ATGLHFR_.2...

SEN / CTL

P78316

Nucleolar protein 14

NOP14

3.41

1.29

0.0449

0.0174

endonucleolytic cleavage in ITS1 to separate SSU-r...

enzyme binding,snoRNA binding,poly(A) RNA binding

nucleus,nucleoplasm,nucleolus,mitochondrion,membra...

24

20

24

_QLFNSLATQEGEWK_.2|_ASQGSTLVHPFR_.3|_ASQGSTLVHPFR_...

SEN / CTL

P60660

Myosin light polypeptide 6

MYL6

3.39

1.37

0.00000347

0.00000909

muscle contraction,skeletal muscle tissue developm...

motor activity,calcium ion binding,protein binding...

cytosol,brush border,membrane,myosin complex,uncon...

26

14

26

_ALGQNPTNAEVLK_.2|_ILYSQC[+57]GDVMR_.2|_VLDFEHFLPM...

SEN / CTL

Q00536

Cyclin-dependent kinase 16

CDK16

3.38

0.82

0.000162

0.000268

protein phosphorylation,exocytosis,spermatogenesis...

protein serine/threonine kinase activity,cyclin-de...

cytoplasm,plasma membrane,microtubule cytoskeleton...

28

23

28

_VSLSEIGFGK_.2|_LADFGLAR_.2|_SKLTDNLVALK_.3|_SKLTD...

SEN / CTL

Q16539

Mitogen-activated protein kinase 14

MAPK14

3.38

1.39

0.00192

0.00204

DNA damage checkpoint,activation of MAPK activity,...

protein serine/threonine kinase activity,MAP kinas...

spindle pole,nucleus,nucleoplasm,cytoplasm,mitocho...

25

15

25

_LVGTPGAELLK_.2|_NYIQSLTQM[+16]PK_.2|_NYIQSLTQMPK_...

SEN / CTL

Q8NHV4

Protein NEDD1

NEDD1

3.38

2.8

0.171

0.0441

G2/M transition of mitotic cell cycle,mitotic nucl...

pericentriolar material,spindle pole,nucleoplasm,n...

19

16

19

_SSLGDMFSPIR_.2|_IADSIGNNR_.2|_QFHMQLNEMHSLLER_.4|...

SEN / CTL

P15121

Aldose reductase

AKR1B1

3.31

1.59

0.00374

0.00334

tissue homeostasis,renal water homeostasis,carbohy...

alditol:NADP+ 1-oxidoreductase activity,aldo-keto ...

extracellular space,nucleoplasm,cytoplasm,cytosol,...

42

26

42

_MPILGLGTWK_.2|_M[+16]PILGLGTWK_.2|_VC[+57]ALLSC[+...

SEN / CTL

Q9P0N9

TBC1 domain family member 7

TBC1D7

3.3

1.03

0.031

0.0143

positive regulation of protein ubiquitination,nega...

GTPase activator activity,protein binding,Rab GTPa...

cytoplasmic vesicle,ciliary basal body,cytoplasmic...

4

4

4

_AFEQYLNLEDGR_.2|_FVSDATPQAEVYLR_.2|_FLENIPQDSSDAI...

SEN / CTL

P20702

Integrin alpha-X

ITGAX

3.3

1.69

0.077

0.0242

cell adhesion,integrin-mediated signaling pathway,...

receptor activity,protein binding,metal ion bindin...

plasma membrane,integrin complex,cell surface,memb...

33

27

33

_NLRPMLAADAQR_.3|_ELNDIASKPSQEHIFK_.4|_ELNDIASKPSQ...

SEN / CTL

Q99497

Protein deglycase DJ-1

PARK7

3.28

2.09

5.74e-7

0.00000172

negative regulation of protein phosphorylation,neg...

transcription coactivator activity,mRNA binding,re...

chromatin,nucleus,cytoplasm,mitochondrion,mitochon...

55

27

55

_DGLILTSR_.2|_GAEEMETVIPVDVMR_.2|_GAEEMETVIPVDVMR_...

SEN / CTL

P14927

Cytochrome b-c1 complex subunit 7

UQCRB

3.28

1.01

0.0302

0.0142

oxidative phosphorylation,mitochondrial electron t...

protein binding,ubiquinol-cytochrome-c reductase a...

mitochondrial inner membrane,mitochondrial respira...

17

11

17

_RLPENLYNDR_.2|_RLPENLYNDR_.3|_RALDLNLK_.2|_LPENLY...

SEN / CTL

Q16270

Insulin-like growth factor-binding protein 7

IGFBP7

3.26

1.76

4.85e-8

1.75e-7

regulation of cell growth,cell adhesion,embryo imp...

protein binding,insulin-like growth factor binding

extracellular region,extracellular space,extracell...

15

12

15

_SRYPVC[+57]GSDGTTYPSGC[+57]QLR_.3|_AGAAAGGPGVSGVC...

SEN / CTL

Q9H2G9

Golgin-45

BLZF1

3.26

0.95

0.0269

0.0132

regulation of cell growth,regulation of transcript...

DNA binding,transcription factor activity, sequenc...

Golgi membrane,nucleus,nucleoplasm,cytoplasm,Golgi...

3

3

3

_NTAQLSEQLER_.2|_AAITHDIPNK_.2|_EQTYSPSVQPHSTAELAL...

SEN / CTL

P22692

Insulin-like growth factor-binding protein 4

IGFBP4

3.25

1.32

0.0000782

0.000138

skeletal system development,regulation of cell gro...

receptor binding,insulin-like growth factor I bind...

extracellular region,extracellular space

5

3

5

_EDARPVPQGSC[+57]QSELHR_.4|_GELDC[+57]HQLADSFRE_.3...

SEN / CTL

O43290

U4/U6.U5 tri-snRNP-associated protein 1

SART1

3.25

1.79

0.0878

0.0263

spliceosomal snRNP assembly,mRNA splicing, via spl...

protein binding,poly(A) RNA binding

nucleoplasm,cytoplasm,Golgi apparatus,cytosol,Caja...

44

35

44

_TPYIVLSGSGK_.2|_IEYVDETGRK_.3|_IEYVDETGRK_.2|_QRG...

SEN / CTL

Q9Y4H2

Insulin receptor substrate 2

IRS2

3.23

1.42

0.0585

0.0204

MAPK cascade,positive regulation of mesenchymal ce...

signal transducer activity,Ras guanyl-nucleotide e...

cytosol,plasma membrane,protein complex

143

78

143

_RLSLMEQVSGVEAFLQASQPPDPHR_.3|_RLSLM[+16]EQVSGVEAF...

SEN / CTL

Q9Y3R0

Glutamate receptor-interacting protein 1

GRIP1

3.23

1.69

0.0799

0.0247

protein localization,dendrite development,androgen...

transcription coactivator activity,protein binding...

endoplasmic reticulum,cytosol,plasma membrane,cell...

47

35

47

_SRPVVITC[+57]VRPGGPADR_.3|_SRPVVITC[+57]VRPGGPADR...

SEN / CTL

Q8NDI1

EH domain-binding protein 1

EHBP1

3.21

0.98

0.0299

0.0141

cytoplasm,plasma membrane

12

12

12

_TGVLNENTVSAGK_.2|_AAITETQR_.2|_SLNPQDIK_.2|_QAEEE...

SEN / CTL

P78344

Eukaryotic translation initiation factor 4 gamma 2

EIF4G2

3.21

1

0.0311

0.0143

translational initiation,regulation of translation...

translation initiation factor activity,protein bin...

cytosol,cell-cell adherens junction,membrane,eukar...

64

49

64

_LDLIHESILHK_.3|_LDLIHESILHK_.2|_TNPPLIQEKPAK_.3|_...

SEN / CTL

O60488

Long-chain-fatty-acid--CoA ligase 4

ACSL4

3.2

0.79

0.0198

0.0111

long-chain fatty acid metabolic process,lipid meta...

long-chain fatty acid-CoA ligase activity,ATP bind...

cytoplasm,mitochondrial outer membrane,peroxisomal...

45

31

45

_AEWMIAAQTC[+57]FK_.2|_ALLGGNVR_.2|_LFDHAVSK_.2|_T...

SEN / CTL

Q7Z794

Keratin, type II cytoskeletal 1b

KRT77

3.2

0.84

0.0224

0.012

biological_process

molecular_function,structural molecule activity

cytoskeleton,keratin filament,extracellular exosom...

16

13

16

_YQELQITAGR_.2|_TGSENDFVVLKK_.3|_TGSENDFVVLKK_.2|_...

SEN / CTL

Q69YQ0

Cytospin-A

SPECC1L

3.2

1.42

0.0598

0.0205

microtubule cytoskeleton organization,cell cycle,c...

cytoplasm,microtubule organizing center,spindle,ga...

33

27

33

_TPPAAAVSPMQR_.2|_IKPENSSSASTGGK_.3|_RPNYGEIPVQEHL...

SEN / CTL

O00469

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2

PLOD2

3.2

1.54

0.0688

0.0224

response to hypoxia,cellular protein modification ...

iron ion binding,procollagen-lysine 5-dioxygenase ...

endoplasmic reticulum,endoplasmic reticulum membra...

47

33

47

_IVGPEENLSQAEAR_.2|_IVGPEENLSQAEAR_.3|_LTHLHEGLPVK...

SEN / CTL

Q99873

Q9NR22

Protein arginine N-methyltransferase 1;Protein arginine N-methyltransferase 8

PRMT1

PRMT8

3.19

1.16

0.0413

0.0167

regulation of transcription, DNA-templated,protein...

protein binding,methyltransferase activity,N-methy...

nucleus,nucleoplasm,cytoplasm,cytosol,methylosome;...

1

1

1

_GKVEEVELPVEK_.3

SEN / CTL

P24539

ATP synthase F(0) complex subunit B1, mitochondrial

ATP5F1

3.19

1.65

0.0791

0.0246

ATP biosynthetic process,ATP synthesis coupled pro...

protein binding,transmembrane transporter activity...

mitochondrial proton-transporting ATP synthase com...

41

22

41

_KYGPFVADFADK_.3|_KYGPFVADFADK_.2|_RHYLFDVQR_.3|_R...

SEN / CTL

Q9Y376

Calcium-binding protein 39

CAB39

3.19

1.7

0.083

0.0253

cell cycle arrest,positive regulation of peptidyl-...

protein binding,kinase binding,protein kinase acti...

cytosol,protein complex,extracellular exosome,seri...

31

22

31

_NIQFEAFHVFK_.2|_NIQFEAFHVFK_.3|_LLHSENYVTK_.3|_LL...

SEN / CTL

Q8NEY4

V-type proton ATPase subunit C 2

ATP6V1C2

3.18

0.98

0.03

0.0141

insulin receptor signaling pathway,ATP hydrolysis ...

hydrogen-exporting ATPase activity, phosphorylativ...

vacuolar proton-transporting V-type ATPase, V1 dom...

6

5

6

_MAQSVVEVMEDSK_.2|_LDTFAESLIR_.2|_QPLVSVVDTIAK_.2|...

SEN / CTL

Q9UGI9

Q9UGJ0

5'-AMP-activated protein kinase subunit gamma-3;5'-AMP-activated protein kinase subunit gamma-2

PRKAG3

PRKAG2

3.17

0.93

0.0275

0.0134

glycogen biosynthetic process,protein phosphorylat...

AMP-activated protein kinase activity,ATP binding,...

extracellular space,nucleoplasm,cytosol,nucleotide...

1

1

1

_KAFFALVANGVR_.3

SEN / CTL

O00244

Copper transport protein ATOX1

ATOX1

3.17

1

0.0316

0.0144

copper ion transport,cellular copper ion homeostas...

copper ion transmembrane transporter activity,copp...

cytosol

18

11

18

_TVSYLGLE_.2|_KVC[+57]IESEHSMDTLLATLKK_.5|_KVC[+57...

SEN / CTL

Q9NUD5

Zinc finger CCHC domain-containing protein 3

ZCCHC3

3.15

1

0.0318

0.0144

zinc ion binding,poly(A) RNA binding

9

8

9

_HLPGAFFLGAER_.3|_AVHNSVAAQLTGVAGH_.3|_AVHNSVAAQLT...

SEN / CTL

P14868

Aspartate--tRNA ligase, cytoplasmic

DARS

3.14

1.24

0.0483

0.0181

translation,tRNA aminoacylation for protein transl...

aminoacylase activity,aspartate-tRNA ligase activi...

cytoplasm,cytosol,membrane,extracellular exosome

70

43

70

_IYVISLAEPR_.2|_IHDPQLLTER_.3|_IHDPQLLTER_.2|_LQSG...

SEN / CTL

Q9Y6C2

EMILIN-1

EMILIN1

3.13

1.76

0.00742

0.00559

cell adhesion

protein binding,extracellular matrix constituent c...

extracellular region,proteinaceous extracellular m...

48

36

48

_LLASVEER_.2|_VLLNDGGYYDPETGVFTAPLAGR_.3|_YLLSAVLT...

SEN / CTL

Q08426

Peroxisomal bifunctional enzyme

EHHADH

3.13

0.87

0.0248

0.0127

internal protein amino acid acetylation,fatty acid...

3-hydroxyacyl-CoA dehydrogenase activity,dodecenoy...

mitochondrion,peroxisome,peroxisomal matrix,cytoso...

79

59

79

_GIVISFAR_.2|_IHKPDPWLSK_.3|_FSAGADIR_.2|_RQHPGC[+...

SEN / CTL

P69849

Q15155

Q5JPE7

Nodal modulator 3;Nodal modulator 1;Nodal modulator 2

NOMO3

NOMO1

NOMO2

3.12

0.81

0.0215

0.0117

biological_process;biological_process;protein dest...

molecular_function,carbohydrate binding;molecular_...

cellular_component,integral component of membrane;...

1

1

1

_EHLYFETVTIK_.2

SEN / CTL

Q4G0J3

La-related protein 7

LARP7

3.1

0.97

0.0314

0.0143

RNA processing

nucleotide binding,protein binding,poly(A) RNA bin...

nucleus,nucleoplasm,cytoplasm,Golgi apparatus,intr...

31

25

31

_QVLADIAK_.2|_IISTEPLPGRK_.3|_LEILSGDHEQR_.3|_LEIL...

SEN / CTL

Q9BZ23

Q9H999

Pantothenate kinase 2, mitochondrial;Pantothenate kinase 3

PANK2

PANK3

3.08

1.2

0.0471

0.0178

spermatid development,aerobic respiration,coenzyme...

pantothenate kinase activity,ATP binding;pantothen...

cytoplasm,mitochondrion,mitochondrial intermembran...

1

1

1

_LLAYALDYWSK_.2

SEN / CTL

P04179

Superoxide dismutase [Mn], mitochondrial

SOD2

3.06

0.4

0.00000833

0.0000197

response to reactive oxygen species,response to su...

superoxide dismutase activity,manganese ion bindin...

mitochondrion,mitochondrial matrix,extracellular e...

42

23

42

_AIWNVINWENVTER_.3|_AIWNVINWENVTER_.2|_DFGSFDK_.2|...

SEN / CTL

P06756

Integrin alpha-V

ITGAV

3.06

0.58

0.0118

0.00789

angiogenesis,vasculogenesis,antigen processing and...

virus receptor activity,fibronectin binding,protea...

plasma membrane,integral component of plasma membr...

56

49

56

_ALFLYSR_.2|_LEVSVDSDQKK_.3|_LEVSVDSDQKK_.2|_AMLHL...

SEN / CTL

Q06203

Amidophosphoribosyltransferase

PPAT

3.05

1.1

0.0409

0.0166

G1/S transition of mitotic cell cycle,kidney devel...

amidophosphoribosyltransferase activity,metal ion ...

cytosol

36

26

36

_LIPVSDINDK_.2|_RIVLVDDSIVR_.3|_RIVLVDDSIVR_.2|_HN...

SEN / CTL

P62851

40S ribosomal protein S25

RPS25

3.04

2.55

0.174

0.0447

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,protein binding,poly(A) RNA binding

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,ri...

13

11

13

_AQVIYTR_.2|_DKLNNLVLFDK_.3|_DKLNNLVLFDK_.2|_LITPA...

SEN / CTL

P00338

L-lactate dehydrogenase A chain

LDHA

3.03

1.9

3.83e-12

2.63e-11

response to hypoxia,lactate metabolic process,pyru...

L-lactate dehydrogenase activity,protein binding,k...

nucleus,cytosol,cell-cell adherens junction,membra...

92

38

92

_LVIITAGAR_.2|_VTLTSEEEAR_.2|_SADTLWGIQKELQF_.2|_V...

SEN / CTL

Q9BR76

Coronin-1B

CORO1B

3.03

1.1

0.0415

0.0167

cell migration,actin cytoskeleton organization,ruf...

protein binding,identical protein binding,actin fi...

stress fiber,cytoplasm,cytosol,actin filament,plas...

44

27

44

_VGIIAWHPTAR_.3|_VGIIAWHPTAR_.2|_AIFLADGK_.2|_IC[+...

SEN / CTL

P30566

Adenylosuccinate lyase

ADSL

3.01

1.07

0.0397

0.0164

response to hypoxia,purine nucleotide biosynthetic...

N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-for...

mitochondrion,cytosol

56

32

56

_QQIGSSAM[+16]PYK_.2|_QQIGSSAMPYK_.2|_LRHDVMAHVHTF...

SEN / CTL

Q9UBR2

Cathepsin Z

CTSZ

3

3.79

0.11

0.0309

angiotensin maturation,proteolysis,ER to Golgi ves...

cysteine-type endopeptidase activity,protein bindi...

Golgi membrane,extracellular space,lysosome,endopl...

25

16

25

_VGDYGSLSGREK_.3|_VGDYGSLSGR_.2|_NVDGVNYASITR_.3|_...

SEN / CTL

Q9UI17

Dimethylglycine dehydrogenase, mitochondrial

DMGDH

2.98

1.06

0.0398

0.0164

glycine metabolic process,amino-acid betaine catab...

electron carrier activity,poly(A) RNA binding,dime...

mitochondrial matrix

48

37

48

_WTTTQYTEAK_.2|_GGYDVEIK_.2|_KC[+57]GALLKYPAPVTSLK...

SEN / CTL

O75533

Splicing factor 3B subunit 1

SF3B1

2.97

0.93

0.0313

0.0143

spliceosomal complex assembly,RNA splicing, via tr...

mRNA binding,protein binding,poly(A) RNA binding

nucleus,nucleoplasm,spliceosomal complex,U2 snRNP,...

139

77

139

_VVNGAAASQPPSK_.2|_THEDIEAQIR_.3|_THEDIEAQIR_.2|_V...

SEN / CTL

Q2QD12

Q96AT9

Ribulose-phosphate 3-epimerase-like protein 1;Ribulose-phosphate 3-epimerase

RPEL1

RPE

2.96

0.48

0.00858

0.00624

pentose-phosphate shunt, non-oxidative branch,pent...

ribulose-phosphate 3-epimerase activity,metal ion ...

cytosol;cytosol,extracellular exosome

1

1

1

_SVINLLR_.2

SEN / CTL

P0DMV8

P0DMV9

Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B

HSPA1A

HSPA1B

2.96

2.69

0.0107

0.00733

positive regulation of gene expression,negative re...

virus receptor activity,G-protein coupled receptor...

nucleoplasm,cytoplasm,mitochondrion,centriole,cyto...

132

60

132

_ARFEELC[+57]SDLFR_.3|_ARFEELC[+57]SDLFR_.2|_TTPSY...

SEN / CTL

P42704

Leucine-rich PPR motif-containing protein, mitochondrial

LRPPRC

2.96

1.39

0.0662

0.022

negative regulation of mitochondrial RNA catabolic...

single-stranded DNA binding,RNA binding,endonuclea...

condensed nuclear chromosome,nucleus,nuclear inner...

204

122

204

_EKDIQEESTFSSR_.2|_EKDIQEESTFSSR_.3|_ISIMAER_.2|_L...

SEN / CTL

O95954

Formimidoyltransferase-cyclodeaminase

FTCD

2.95

1.11

0.044

0.0173

histidine catabolic process,folic acid-containing ...

protein binding,folic acid binding,microtubule bin...

Golgi membrane,cytoplasm,endoplasmic reticulum,end...

29

23

29

_TQAALVLDC[+57]LETRQE_.3|_SDLQVAAK_.2|_AFVGEVGAR_....

SEN / CTL

A5A3E0

POTE ankyrin domain family member F

POTEF

2.94

0.78

0.0228

0.0121

retina homeostasis

extracellular space,cell cortex,extracellular exos...

2

2

2

_VAPEEHPVLLTEATLNPK_.3|_LC[+57]YVALDFEQEMATVASSSSL...

SEN / CTL

Q49A26

Putative oxidoreductase GLYR1

GLYR1

2.91

0.81

0.025

0.0127

oxidation-reduction process

DNA binding,phosphogluconate dehydrogenase (decarb...

nucleosome,nucleoplasm,cytoplasm,Golgi apparatus

29

23

29

_LGDLVWGK_.2|_FFGTEDHAWIK_.3|_RFQQAVDAVEEFLRR_.4|_...

SEN / CTL

P36873

P62136

P62140

Serine/threonine-protein phosphatase PP1-gamma catalytic subunit;Serine/threonine-protein phosphatase PP1-alpha catalytic subunit;Serine/threonine-protein phosphatase PP1-beta catalytic subunit

PPP1CC

PPP1CA

PPP1CB

2.91

1.4

0.0692

0.0224

glycogen metabolic process,protein dephosphorylati...

phosphoprotein phosphatase activity,protein serine...

condensed chromosome kinetochore,nucleus,nucleolus...

1

1

1

_AHQVVEDGYEFFAK_.3

SEN / CTL

Q5JSL3

Q96BY6

Q9BZ29

Dedicator of cytokinesis protein 11;Dedicator of cytokinesis protein 10;Dedicator of cytokinesis protein 9

DOCK11

DOCK10

DOCK9

2.89

1.48

0.0778

0.0244

small GTPase mediated signal transduction,blood co...

Rho guanyl-nucleotide exchange factor activity,pro...

cytosol;intracellular,membrane,extracellular exoso...

1

1

1

_TVLMATAQMK_.2

SEN / CTL

P26640

Valine--tRNA ligase

VARS

2.89

2.6

0.194

0.0477

tRNA aminoacylation for protein translation,valyl-...

aminoacyl-tRNA editing activity,valine-tRNA ligase...

mitochondrion,cytosol

116

72

116

_LVNWSC[+57]TLNSAISDIEVDKK_.3|_LVNWSC[+57]TLNSAISD...

SEN / CTL

P09493

Tropomyosin alpha-1 chain

TPM1

2.88

0.59

0.0135

0.00862

in utero embryonic development,positive regulation...

actin binding,structural constituent of cytoskelet...

stress fiber,cytosol,cytoskeleton,muscle thin fila...

36

24

36

_HIAEDADRKYEEVAR_.4|_HIAEDADRKYEEVAR_.3|_AEERAELSE...

SEN / CTL

P25788

Proteasome subunit alpha type-3

PSMA3

2.88

0.96

0.0353

0.0152

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

25

15

25

_AVENSSTAIGIR_.2|_C[+57]KDGVVFGVEK_.3|_C[+57]KDGVV...

SEN / CTL

P01344

Insulin-like growth factor II

IGF2

2.88

1.27

0.059

0.0204

skeletal system development,ossification,positive ...

insulin receptor binding,insulin-like growth facto...

extracellular region,extracellular space,plasma me...

3

2

3

_GIVEEC[+57]C[+57]FR_.2|_SC[+57]DLALLETYC[+57]ATPA...

SEN / CTL

Q16881

Thioredoxin reductase 1, cytoplasmic

TXNRD1

2.87

1.87

0.000249

0.000393

response to reactive oxygen species,response to ox...

thioredoxin-disulfide reductase activity,protein b...

nucleus,mitochondrion,cytosol,extracellular exosom...

60

37

60

_QFVPIKVEQIEAGTPGR_.3|_WGLGGTC[+57]VNVGC[+57]IPK_....

SEN / CTL

P21399

Cytoplasmic aconitate hydratase

ACO1

2.87

0.76

0.0227

0.0121

tricarboxylic acid cycle,citrate metabolic process...

RNA binding,aconitate hydratase activity,protein b...

cytoplasm,mitochondrion,endoplasmic reticulum,Golg...

66

42

66

_AVLAESYER_.2|_KQDIENILHWNVTQHK_.5|_KQDIENILHWNVTQ...

SEN / CTL

Q06187

Tyrosine-protein kinase BTK

BTK

2.86

0.45

0.00805

0.00595

positive regulation of type III hypersensitivity,p...

protein tyrosine kinase activity,non-membrane span...

nucleus,cytoplasm,cytosol,plasma membrane,extrinsi...

27

21

27

_SQAEQLLK_.2|_STGDPQGVIR_.2|_HLFSTIPELINYHQHNSAGLI...

SEN / CTL

Q9Y657

Spindlin-1

SPIN1

2.86

1.38

0.0698

0.0225

multicellular organism development,gamete generati...

protein binding,methylated histone binding

nucleus,nucleolus,spindle

7

6

7

_VSALEVLPDR_.2|_TGMVIHQVEAK_.3|_ADAGHAGVSANMMK_.3|...

SEN / CTL

Q8NF50

Dedicator of cytokinesis protein 8

DOCK8

2.84

1.43

0.0749

0.0236

immunological synapse formation,small GTPase media...

guanyl-nucleotide exchange factor activity,protein...

cytosol,membrane,cell leading edge

58

46

58

_SGAPTALLDPR_.2|_HLNVLC[+57]DVSGK_.3|_HLNVLC[+57]D...

SEN / CTL

P46778

60S ribosomal protein L21

RPL21

2.84

1.52

0.0832

0.0253

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleolus,cytoplasm,cytosol,membrane,cytosolic lar...

17

10

17

_VYNVTQHAVGIVVNK_.3|_VYNVTQHAVGIVVNK_.2|_HGVVPLATY...

SEN / CTL

Q9BW27

Nuclear pore complex protein Nup85

NUP85

2.84

1.59

0.0899

0.0267

mRNA export from nucleus,tRNA export from nucleus,...

protein binding,structural constituent of nuclear ...

condensed chromosome kinetochore,nuclear envelope,...

31

22

31

_VSLELHIER_.2|_IPLNTEQK_.2|_C[+57]LEDLTSR_.2|_AC[+...

SEN / CTL

Q7L9L4

Q9H8S9

MOB kinase activator 1B;MOB kinase activator 1A

MOB1B

MOB1A

2.84

1.76

0.107

0.0302

regulation of protein autophosphorylation,hippo si...

protein binding,kinase activator activity,kinase b...

nucleus,cytoplasm,cytosol,extracellular exosome;cy...

10

6

10

_HAEATLGSGNLR_.2|_HAEATLGSGNLR_.3|_KNIPEGSHQYELLK_...

SEN / CTL

P37802

Transgelin-2

TAGLN2

2.83

2.67

0.00371

0.00334

epithelial cell differentiation,cell-cell adhesion

protein binding,cadherin binding involved in cell-...

cell-cell adherens junction,vesicle,extracellular ...

53

26

53

_IQASTMAFK_.2|_IQASTM[+16]AFK_.2|_QMEQISQFLQAAER_....

SEN / CTL

Q9H3R2

Mucin-13

MUC13

2.83

0.84

0.0279

0.0136

O-glycan processing,maintenance of gastrointestina...

protein homodimerization activity

extracellular space,Golgi lumen,cytosol,integral c...

10

8

10

_DSQMQNPYSR_.2|_HSMAYQDLHSEITSLFK_.4|_HSMAYQDLHSEI...

SEN / CTL

P02042

P02100

P68871

P69891

P69892

Hemoglobin subunit delta;Hemoglobin subunit epsilon;Hemoglobin subunit beta;Hemoglobin subunit gamma-1;Hemoglobin subunit gamma-2

HBD

HBE1

HBB

HBG1

HBG2

2.83

1

0.0395

0.0164

blood coagulation,oxygen transport;blood coagulati...

oxygen transporter activity,iron ion binding,prote...

cytosol,hemoglobin complex,blood microparticle;cyt...

1

1

1

_LLVVYPWTQR_.2

SEN / CTL

P26006

Integrin alpha-3

ITGA3

2.83

1.09

0.0459

0.0176

neuron migration,cell-matrix adhesion,integrin-med...

glycoprotein binding,fibronectin binding,protease ...

plasma membrane,focal adhesion,integrin complex,ex...

39

26

39

_EC[+57]GPDNKC[+57]ESNLQMR_.3|_EC[+57]GPDNKC[+57]E...

SEN / CTL

Q96JC1

Vam6/Vps39-like protein

VPS39

2.83

1.38

0.0708

0.0227

intracellular protein transport,autophagy,endosome...

lysosomal membrane,AP-3 adaptor complex,HOPS compl...

27

22

27

_ALQVLVDQSK_.2|_ANLQAALQVLELHHSK_.4|_ANLQAALQVLELH...

SEN / CTL

Q15149

Plectin

PLEC

2.81

3.81

0.0000452

0.0000868

hemidesmosome assembly,cell-cell adhesion

actin binding,protein binding,structural constitue...

cytoplasm,cytosol,plasma membrane,brush border,cel...

728

489

728

_LAAEQELIR_.2|_IKELQNAGDR_.2|_YASGSSASLGGPESAVA_.2...

SEN / CTL

O95757

Heat shock 70 kDa protein 4L

HSPA4L

2.81

1.45

0.0788

0.0246

protein folding,response to unfolded protein

ATP binding

nucleus,cytoplasm,cytosol

66

48

66

_LSLTQDPVVK_.2|_QDLPPLDEKPR_.3|_SSGEM[+16]EVD_.2|_...

SEN / CTL

Q9BTC0

Death-inducer obliterator 1

DIDO1

2.79

1.33

0.0683

0.0224

transcription, DNA-templated,apoptotic signaling p...

zinc ion binding,poly(A) RNA binding

nucleus,cytoplasm,spindle

53

46

53

_QDVPKPVLTSVMVPK_.3|_APEAAAAER_.2|_GAQGALPER_.2|_E...

SEN / CTL

O43390

O60506

Heterogeneous nuclear ribonucleoprotein R;Heterogeneous nuclear ribonucleoprotein Q

HNRNPR

SYNCRIP

2.78

1.11

0.0494

0.0185

mRNA splicing, via spliceosome,mRNA processing,cir...

nucleotide binding,RNA binding,mRNA 3'-UTR binding...

nucleoplasm,spliceosomal complex,endoplasmic retic...

1

1

1

_AGPIWDLR_.2

SEN / CTL

O75153

Clustered mitochondria protein homolog

CLUH

2.75

2.19

0.162

0.0422

mitochondrion organization,intracellular distribut...

mRNA binding

cytoplasm

66

53

66

_C[+57]LTQQAVALQR_.2|_NFAVLQK_.2|_VLELVLR_.2|_TGIQ...

SEN / CTL

Q99487

Platelet-activating factor acetylhydrolase 2, cytoplasmic

PAFAH2

2.73

0.55

0.0132

0.00847

lipid metabolic process,lipid catabolic process,ne...

1-alkyl-2-acetylglycerophosphocholine esterase act...

cytoplasm

13

12

13

_DSGYPLIIFSHGLGAFR_.2|_DSGYPLIIFSHGLGAFR_.3|_AMLAF...

SEN / CTL

P01033

Metalloproteinase inhibitor 1

TIMP1

2.72

1.11

4.15e-10

2.6e-9

cell activation,platelet degranulation,aging,posit...

protease binding,cytokine activity,protein binding...

extracellular region,proteinaceous extracellular m...

11

7

11

_EPGLC[+57]TWQSLR_.2|_GFQALGDAADIR_.2|_LQDGLLHITTC...

SEN / CTL

P04075

Fructose-bisphosphate aldolase A

ALDOA

2.71

2.04

7.29e-21

1.75e-19

platelet degranulation,fructose metabolic process,...

actin binding,fructose-bisphosphate aldolase activ...

extracellular region,extracellular space,nucleus,c...

110

51

110

_ALANSLAC[+57]QGK_.2|_PYQYPALTPEQKKELSDIAHR_.5|_LQ...

SEN / CTL

P07996

Thrombospondin-1

THBS1

2.71

1.97

4.37e-16

6.29e-15

activation of MAPK activity,response to hypoxia,ne...

phosphatidylserine binding,glycoprotein binding,fi...

extracellular region,fibrinogen complex,extracellu...

89

63

89

_FYVVMWK_.2|_TIVTTLQDSIR_.2|_FVFGTTPEDILR_.2|_SC[+...

SEN / CTL

P29218

Inositol monophosphatase 1

IMPA1

2.71

1.29

0.0679

0.0223

inositol metabolic process,inositol biosynthetic p...

magnesium ion binding,protein binding,inositol mon...

cytoplasm,cytosol,extracellular exosome

22

16

22

_EIQVIPLQR_.2|_LFC[+57]IPVHGIR_.3|_LFC[+57]IPVHGIR...

SEN / CTL

O14828

Secretory carrier-associated membrane protein 3

SCAMP3

2.71

1.41

0.0793

0.0246

post-Golgi vesicle-mediated transport,protein tran...

ubiquitin protein ligase binding

Golgi membrane,integral component of membrane,intr...

22

12

22

_TAAANAAAGAAENAFRAP_.3|_TAAANAAAGAAENAFRAP_.2|_ERE...

SEN / CTL

Q16643

Drebrin

DBN1

2.69

0.82

0.0294

0.0141

actin filament organization,cell communication by ...

actin binding,protein binding,profilin binding,cad...

cytoplasm,plasma membrane,cell-cell adherens junct...

56

35

56

_MAPTPIPTR_.2|_M[+16]APTPIPTR_.2|_DSQAALPK_.2|_QQT...

SEN / CTL

P09467

Fructose-1,6-bisphosphatase 1

FBP1

2.69

1.43

0.0827

0.0253

sucrose biosynthetic process,fructose metabolic pr...

protein binding,AMP binding,fructose 1,6-bisphosph...

cytoplasm,cytosol,extracellular exosome

40

25

40

_SSFATC[+57]VLVSEEDKHAIIVEPEKR_.5|_YVGSMVADVHR_.3|...

SEN / CTL

P51532

Transcription activator BRG1

SMARCA4

2.69

1.43

0.0826

0.0253

negative regulation of transcription from RNA poly...

RNA polymerase II transcription coactivator activi...

nuclear chromatin,extracellular space,nucleus,nucl...

54

45

54

_GPTPFNQNQLHQLR_.3|_GPTPFNQNQLHQLR_.2|_AVATYHANTER...

SEN / CTL

O00299

Chloride intracellular channel protein 1

CLIC1

2.68

0.24

0.0026

0.00258

chloride transport,signal transduction,regulation ...

voltage-gated ion channel activity,chloride channe...

extracellular space,nucleus,nuclear envelope,cytop...

42

24

42

_YRGFTIPEAFR_.3|_YRGFTIPEAFR_.2|_LHIVQVVC[+57]KK_....

SEN / CTL

A8MUH7

Q5T2W1

Putative PDZ domain-containing protein PDZK1P1;Na(+)/H(+) exchange regulatory cofactor NHE-RF3

PDZK1P1

PDZK1

2.68

1.41

0.0806

0.0249

;transport,cell proliferation,carnitine transport,...

;scavenger receptor binding,transporter activity,p...

;plasma membrane,apical plasma membrane,brush bord...

1

1

1

_NVTLLVC[+57]GK_.2

SEN / CTL

Q8N3C0

Activating signal cointegrator 1 complex subunit 3

ASCC3

2.68

1.49

0.0893

0.0266

DNA dealkylation involved in DNA repair,transcript...

protein binding,ATP binding,ATP-dependent 3'-5' DN...

intracellular,nucleus,nucleoplasm,cytoplasm,Golgi ...

69

57

69

_PVYIQDLDEIGQLAFK_.2|_AGRPQFDDQGK_.3|_TSAFIAGAK_.2...

SEN / CTL

Q92643

GPI-anchor transamidase

PIGK

2.68

1.5

0.0903

0.0267

proteolysis,attachment of GPI anchor to protein,pr...

protein disulfide isomerase activity,GPI-anchor tr...

endoplasmic reticulum membrane,membrane,integral c...

12

10

12

_YAEQLPVAQIIHQK_.3|_HVANTLSVYR_.2|_KVEITTETIK_.2|_...

SEN / CTL

P01137

Transforming growth factor beta-1

TGFB1

2.68

1.51

0.0911

0.0269

protein import into nucleus, translocation,negativ...

glycoprotein binding,antigen binding,type II trans...

extracellular region,proteinaceous extracellular m...

20

16

20

_GGEIEGFR_.2|_VEQHVELYQK_.3|_VEQHVELYQK_.2|_LKVEQH...

SEN / CTL

P14625

Endoplasmin

HSP90B1

2.67

1.08

0.00177

0.00194

response to hypoxia,toll-like receptor signaling p...

RNA binding,calcium ion binding,protein binding,AT...

extracellular region,nucleus,endoplasmic reticulum...

166

85

166

_LIINSLYK_.2|_GVVDSDDLPLNVSR_.2|_GVVDSDDLPLNVSR_.3...

SEN / CTL

P05067

Amyloid beta A4 protein

APP

2.67

1.22

0.00306

0.00293

suckling behavior,platelet degranulation,mRNA poly...

DNA binding,serine-type endopeptidase inhibitor ac...

extracellular region,extracellular space,nuclear e...

26

21

26

_THPHFVIPYR_.3|_WYFDVTEGK_.2|_QQLVETHMAR_.3|_HDSGY...

SEN / CTL

O43837

Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial

IDH3B

2.67

0.59

0.0159

0.00963

tricarboxylic acid cycle,isocitrate metabolic proc...

magnesium ion binding,isocitrate dehydrogenase (NA...

nucleus,mitochondrion,mitochondrial matrix

40

22

40

_GVIEC[+57]LK_.2|_HNNLDLVIIR_.3|_HNNLDLVIIR_.2|_LD...

SEN / CTL

O43704

Sulfotransferase family cytosolic 1B member 1

SULT1B1

2.66

1.44

0.0849

0.0256

cellular biogenic amine metabolic process,xenobiot...

aryl sulfotransferase activity,protein binding,sul...

cytosol

22

13

22

_VAYGSWFTHVK_.3|_IIHHTSFEVM[+16]K_.3|_IIHHTSFEVMK_...

SEN / CTL

P28072

Proteasome subunit beta type-6

PSMB6

2.65

0.35

0.00559

0.00453

MAPK cascade,protein polyubiquitination,stimulator...

endopeptidase activity,threonine-type endopeptidas...

proteasome complex,nucleus,nucleoplasm,cytoplasm,G...

17

11

17

_LAAIAESGVER_.2|_DGSSGGVIR_.2|_VTDKLTPIHDR_.3|_VTD...

SEN / CTL

Q5TA50

Ceramide-1-phosphate transfer protein

CPTP

2.64

1.09

0.0522

0.019

glycosphingolipid metabolic process,ceramide 1-pho...

phospholipid binding,phospholipid transporter acti...

nucleus,nuclear outer membrane,nucleolus,cytoplasm...

5

4

5

_AVTVAFC[+57]TLPTR_.2|_SLQAMVAHELSNR_.3|_SLQAMVAHE...

SEN / CTL

P52789

Hexokinase-2

HK2

2.62

1.88

0.00311

0.00296

cellular glucose homeostasis,response to ischemia,...

glucokinase activity,hexokinase activity,protein b...

mitochondrial outer membrane,cytosol,membrane

62

45

62

_MLPTFVR_.2|_EELLFGGK_.2|_GLGATTHPTAAVK_.2|_GLGATT...

SEN / CTL

P39060

Collagen alpha-1(XVIII) chain

COL18A1

2.62

2.54

0.0531

0.0192

angiogenesis,endothelial cell morphogenesis,cell a...

structural molecule activity,metal ion binding

extracellular region,collagen trimer,basement memb...

46

31

46

_AVGLAGTFR_.2|_TEAPSATGQASSLLGGR_.2|_TEAPSATGQASSL...

SEN / CTL

Q12904

Aminoacyl tRNA synthase complex-interacting multifunctional protein 1

AIMP1

2.61

0.62

0.0183

0.0105

angiogenesis,negative regulation of endothelial ce...

tRNA binding,cytokine activity,protein binding,pro...

extracellular space,nucleus,cytoplasm,endoplasmic ...

43

25

43

_MVILLC[+57]NLKPAK_.3|_QQVSLLK_.2|_AILQATLREEK_.3|...

SEN / CTL

Q9NVD7

Alpha-parvin

PARVA

2.61

1.07

0.0517

0.019

sprouting angiogenesis,outflow tract septum morpho...

actin binding,protein binding,cadherin binding inv...

cytosol,cytoskeleton,plasma membrane,cell-cell adh...

14

11

14

_TMVDPNSR_.2|_TLITFVNK_.2|_HERDAFDTLFDHAPDK_.4|_PR...

SEN / CTL

Q15853

Upstream stimulatory factor 2

USF2

2.6

0.81

0.031

0.0143

regulation of transcription from RNA polymerase II...

transcription factor activity, sequence-specific D...

nucleus,nucleoplasm,intracellular membrane-bounded...

3

3

3

_TETNGGQVTYR_.2|_IIPDC[+57]NADNSK_.2|_AQLQQHNLEMVG...

SEN / CTL

Q14240

Eukaryotic initiation factor 4A-II

EIF4A2

2.6

1.51

0.0962

0.0278

nuclear-transcribed mRNA poly(A) tail shortening,t...

translation initiation factor activity,ATP-depende...

cytosol,eukaryotic translation initiation factor 4...

29

18

29

_ETQALVLAPTR_.2|_KGVAINFVTEEDKR_.4|_KGVAINFVTEEDKR...

SEN / CTL

P62318

Small nuclear ribonucleoprotein Sm D3

SNRPD3

2.6

1.57

0.102

0.0292

spliceosomal complex assembly,spliceosomal snRNP a...

protein binding,enzyme binding,U2 snRNA binding,po...

commitment complex,nucleoplasm,spliceosomal comple...

8

6

8

_FLILPDMLK_.2|_FLILPDM[+16]LK_.2|_VLHEAEGHIVTC[+57...

SEN / CTL

P07195

L-lactate dehydrogenase B chain

LDHB

2.59

1.83

0.0000138

0.0000297

carbohydrate metabolic process,lactate metabolic p...

L-lactate dehydrogenase activity,protein binding,k...

cytoplasm,mitochondrion,cytosol,membrane,myelin sh...

73

35

73

_GLTSVINQK_.2|_IVVVTAGVR_.2|_SADTLWDIQKDLKDL_.3|_S...

SEN / CTL

P06400

Retinoblastoma-associated protein

RB1

2.59

1.08

0.053

0.0192

cell cycle checkpoint,G1/S transition of mitotic c...

core promoter binding,RNA polymerase II activating...

chromatin,nucleus,nucleoplasm,spindle,SWI/SNF comp...

25

24

25

_MNDSMDTSNKEEK_.3|_KYDVLFALFSK_.3|_KYDVLFALFSK_.2|...

SEN / CTL

P61019

Q8WUD1

Ras-related protein Rab-2A;Ras-related protein Rab-2B

RAB2A

RAB2B

2.57

1.33

0.0789

0.0246

Golgi organization,small GTPase mediated signal tr...

GTPase activity,protein binding,GTP binding,GDP bi...

Golgi membrane,nucleus,lysosomal membrane,endoplas...

1

1

1

_SC[+57]LLLQFTDKR_.2

SEN / CTL

Q9NZN5

Rho guanine nucleotide exchange factor 12

ARHGEF12

2.56

1.46

0.0933

0.0272

G-protein coupled receptor signaling pathway,regul...

G-protein coupled receptor binding,guanyl-nucleoti...

cytoplasm,cytosol,membrane,extracellular exosome

24

23

24

_SMGLTLAESELTK_.2|_MIHEGPLVWK_.3|_VNGTLVTHSNHLEVVK...

SEN / CTL

O00115

Deoxyribonuclease-2-alpha

DNASE2

2.55

1.44

0.0921

0.027

DNA metabolic process,apoptotic DNA fragmentation,...

DNA binding,deoxyribonuclease II activity

lysosome,extracellular exosome

6

6

6

_ALINSPEGAVGR_.2|_AFQPLVK_.2|_YLDESSGGWR_.2|_NYQPC...

SEN / CTL

Q99988

Growth/differentiation factor 15

GDF15

2.54

0.5

0.000201

0.00102

signal transduction,transforming growth factor bet...

cytokine activity,transforming growth factor beta ...

extracellular region,extracellular space,nucleus,c...

18

7

7

LKPDTVPAPC[CAM]C[CAM]VPASYNPMVLIQK.3|LSPPPSQSDQLLA...

SEN / CTL

Q14974

Importin subunit beta-1

KPNB1

2.54

0.54

0.0149

0.00932

protein import into nucleus, docking,protein impor...

protein binding,nuclear localization sequence bind...

nuclear envelope,nuclear pore,nucleoplasm,cytoplas...

109

54

109

_VLANPGNSQVAR_.2|_VLANPGNSQVAR_.3|_NSLTSKDPDIK_.3|...

SEN / CTL

P19878

Neutrophil cytosol factor 2

NCF2

2.54

1.21

0.0685

0.0224

antigen processing and presentation of exogenous p...

protein binding,protein C-terminus binding,electro...

acrosomal vesicle,nucleolus,cytoplasm,cytosol,phag...

20

19

20

_AEEQLALATSMK_.2|_DKHLAVAYFQR_.3|_GNQLIDYK_.2|_KAE...

SEN / CTL

P17096

High mobility group protein HMG-I/HMG-Y

HMGA1

2.53

0.35

0.00647

0.00503

DNA unwinding involved in DNA replication,nucleoso...

transcriptional activator activity, RNA polymerase...

nucleus,nucleoplasm,transcription factor complex,c...

13

9

13

_KQPPVSPGTALVGSQKEPSEVPTPK_.4|_KQPPVSPGTALVGSQKEPS...

SEN / CTL

P07339

Cathepsin D

CTSD

2.52

1.42

0.092

0.027

proteolysis,autophagy,antigen processing and prese...

aspartic-type endopeptidase activity,cysteine-type...

extracellular region,extracellular space,lysosome,...

62

30

62

_FDGILGMAYPR_.2|_FDGILGM[+16]AYPR_.2|_VGFAEAAR_.2|...

SEN / CTL

P16930

Fumarylacetoacetase

FAH

2.51

2.01

0.163

0.0425

arginine catabolic process,L-phenylalanine catabol...

fumarylacetoacetase activity,protein binding,metal...

cytosol,extracellular exosome

34

22

34

_QHATNVGIMFR_.3|_VLPALLPS_.2|_GTKPIDLGNGQTR_.3|_GT...

SEN / CTL

P08603

Complement factor H

CFH

2.5

1.33

0.0824

0.0253

complement activation,complement activation, alter...

protein binding,heparin binding,heparan sulfate pr...

extracellular region,extracellular space,extracell...

109

63

109

_HRTGDEITYQC[+57]R_.2|_HGGLYHENMR_.3|_HGGLYHENM[+1...

SEN / CTL

P11142

Heat shock cognate 71 kDa protein

HSPA8

2.49

2.1

1.78e-9

1.03e-8

mRNA splicing, via spliceosome,transcription, DNA-...

G-protein coupled receptor binding,phosphatidylser...

Prp19 complex,extracellular space,intracellular,nu...

115

50

115

_IINEPTAAAIAYGLDKK_.3|_ARFEELNADLFR_.3|_ARFEELNADL...

SEN / CTL

P32119

Peroxiredoxin-2

PRDX2

2.48

1.76

0.00286

0.00281

response to reactive oxygen species,response to ox...

thioredoxin peroxidase activity,antioxidant activi...

cytoplasm,cytosol,extracellular exosome

40

24

40

_GLFIIDGK_.2|_GLFIIDGKGVLR_.3|_GLFIIDGKGVLR_.2|_KE...

SEN / CTL

Q01518

Adenylyl cyclase-associated protein 1

CAP1

2.48

2.17

0.186

0.0464

cell morphogenesis,ameboidal-type cell migration,r...

actin binding,adenylate cyclase binding

extracellular space,plasma membrane,focal adhesion...

99

51

99

_TLWNGQK_.2|_EPAVLELEGKK_.3|_KEPAVLELEGK_.3|_KEPAV...

SEN / CTL

P09429

High mobility group protein B1

HMGB1

2.47

0.93

0.0775

0.0158

negative regulation of transcription from RNA poly...

four-way junction DNA binding,bubble DNA binding,l...

condensed chromosome,extracellular region,extracel...

30

26

57

RPPSAFFLFC[CAM]SEYRPK.3|RPPSAFFLFC[CAM]SEYRPK.4|RP...

SEN / CTL

Q15631

Translin

TSN

2.47

1.84

0.145

0.0383

DNA recombination,RNA metabolic process,gene silen...

DNA binding,single-stranded DNA binding,mRNA bindi...

nucleus,cytosol

25

16

25

_KVEEVVYDLSIR_.3|_KVEEVVYDLSIR_.2|_THLTSLK_.2|_KVV...

SEN / CTL

Q10471

Polypeptide N-acetylgalactosaminyltransferase 2

GALNT2

2.46

0.62

0.000199

0.000322

immunoglobulin biosynthetic process,protein O-link...

polypeptide N-acetylgalactosaminyltransferase acti...

Golgi membrane,endoplasmic reticulum membrane,Golg...

40

28

40

_NVPYGNIQSR_.2|_HVGSNLC[+57]LDSR_.3|_HVGSNLC[+57]L...

SEN / CTL

P62937

Peptidyl-prolyl cis-trans isomerase A

PPIA

2.45

2.02

1.02e-12

8.67e-12

protein peptidyl-prolyl isomerization,RNA-dependen...

peptidyl-prolyl cis-trans isomerase activity,prote...

extracellular region,extracellular space,nucleus,c...

52

24

52

_VSFELFADKVPK_.3|_VSFELFADKVPK_.2|_KITIADC[+57]GQL...

SEN / CTL

Q16527

Cysteine and glycine-rich protein 2

CSRP2

2.45

1.74

0.0182

0.0105

multicellular organism development,cell differenti...

molecular_function,protein binding,zinc ion bindin...

nucleus,focal adhesion

14

10

14

_TVYHAEEVQC[+57]DGR_.3|_TVYHAEEVQC[+57]DGR_.2|_GFG...

SEN / CTL

Q02809

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1

PLOD1

2.44

1.36

1.26e-12

1.01e-11

response to hypoxia,cellular protein modification ...

iron ion binding,procollagen-lysine 5-dioxygenase ...

endoplasmic reticulum membrane,rough endoplasmic r...

56

37

56

_SEDYVDIVQGR_.2|_VGVDYEGGGC[+57]R_.2|_HTLGHLLSLDSY...

SEN / CTL

Q8TB72

Pumilio homolog 2

PUM2

2.44

1.47

0.102

0.0292

posttranscriptional regulation of gene expression,...

RNA binding,mRNA 3'-UTR binding,protein binding,po...

cytoplasm,cytoplasmic stress granule,nuclear membr...

17

14

17

_ESLSTSSDLYK_.2|_FASNVVEK_.2|_DLIGHIVEFSQDQHGSR_.4...

SEN / CTL

Q9UPN3

Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5

MACF1

2.42

0.01

0.0000086

0.00002

regulation of epithelial cell migration,Wnt signal...

actin binding,calcium ion binding,protein binding,...

cytoplasm,Golgi apparatus,cytoskeleton,microtubule...

303

255

303

_SELNLLVEK_.2|_C[+57]IVHQESGFK_.3|_C[+57]IVHQESGFK...

SEN / CTL

Q8IXH7

Negative elongation factor C/D

NELFCD

2.42

0.07

0.000284

0.000439

transcription from RNA polymerase II promoter,tran...

protein binding

nucleoplasm,membrane,NELF complex

22

17

22

_LDTDISLIR_.2|_FPVVAMGVLK_.2|_AVETVHNLC[+57]C[+57]...

SEN / CTL

P35579

Myosin-9

MYH9

2.4

1.94

1.09e-8

4.36e-8

meiotic spindle organization,cytokinesis,angiogene...

microfilament motor activity,motor activity,actin ...

stress fiber,ruffle,uropod,nucleus,cytoplasm,spind...

479

242

479

_IRELESQISELQEDLESERASR_.4|_QLEEAEEEAQRANASR_.3|_D...

SEN / CTL

O75643

U5 small nuclear ribonucleoprotein 200 kDa helicase

SNRNP200

2.4

2.02

0.0334

0.0148

cis assembly of pre-catalytic spliceosome,mRNA spl...

ATP-dependent RNA helicase activity,protein bindin...

nucleus,nucleoplasm,spliceosomal complex,U5 snRNP,...

239

152

239

_KADEVLEILK_.2|_VFSLSSEFK_.2|_NQVLVFVHSR_.3|_NQVLV...

SEN / CTL

P13639

Elongation factor 2

EEF2

2.39

3.25

0.013

0.00837

hematopoietic progenitor cell differentiation,resp...

p53 binding,translation elongation factor activity...

nucleus,cytoplasm,cytosol,plasma membrane,cell-cel...

182

83

182

_VNFTVDQIR_.2|_FSVSPVVR_.2|_KVEDMMK_.2|_KVEDM[+16]...

SEN / CTL

P08697

Alpha-2-antiplasmin

SERPINF2

2.38

1.49

0.0114

0.00773

regulation of blood vessel size by renin-angiotens...

protease binding,endopeptidase inhibitor activity,...

extracellular region,fibrinogen complex,extracellu...

29

20

29

_LC[+57]QDLGPGAFR_.2|_GISEQSLVVSGVQHQSTLELSEVGVEAA...

SEN / CTL

P51659

Peroxisomal multifunctional enzyme type 2

HSD17B4

2.38

1.67

0.133

0.0356

very long-chain fatty acid metabolic process,osteo...

C-3 sterol dehydrogenase (C-4 sterol decarboxylase...

mitochondrion,peroxisome,peroxisomal membrane,pero...

84

51

84

_DIGPEVVK_.2|_IDVVVNNAGILR_.3|_IDVVVNNAGILR_.2|_TA...

SEN / CTL

Q01082

Spectrin beta chain, non-erythrocytic 1

SPTBN1

2.37

2.56

0.0244

0.0126

MAPK cascade,mitotic cytokinesis,ER to Golgi vesic...

actin binding,Ras guanyl-nucleotide exchange facto...

nucleolus,cytoplasm,cytosol,cell-cell adherens jun...

362

217

362

_RLVSDGNINSDRIQEK_.3|_VLVLSQDYGK_.2|_LISDINK_.2|_D...

SEN / CTL

P49588

Alanine--tRNA ligase, cytoplasmic

AARS

2.37

2.22

0.205

0.0497

hair follicle development,tRNA modification,tRNA a...

tRNA binding,aminoacyl-tRNA editing activity,alani...

cytoplasm,cytosol,membrane,extracellular exosome,m...

112

62

112

_KAEEIANEM[+16]IEAAK_.3|_KAEEIANEMIEAAK_.3|_KAEEIA...

SEN / CTL

Q9NX76

CKLF-like MARVEL transmembrane domain-containing protein 6

CMTM6

2.36

1.99

0.176

0.0451

chemotaxis

cytokine activity

extracellular space,membrane,integral component of...

2

2

2

_AEALTEPLNA_.2|_SGLAAYFFMGR_.2

SEN / CTL

P02545

Prelamin-A/C

LMNA

2.35

2

8.45e-13

7.6e-12

mitotic nuclear envelope disassembly,mitotic nucle...

structural molecule activity,protein binding

nucleus,nuclear envelope,lamin filament,nucleoplas...

142

85

142

_SLETENAGLR_.2|_NTKKEGDLIAAQAR_.3|_LQLELSK_.2|_SGA...

SEN / CTL

P00558

Phosphoglycerate kinase 1

PGK1

2.32

1.75

8.98e-19

1.85e-17

gluconeogenesis,phosphorylation,epithelial cell di...

phosphoglycerate kinase activity,protein binding,A...

cytosol,membrane,membrane raft,extracellular exoso...

126

59

126

_ELNYFAK_.2|_ALESPERPFLAILGGAK_.3|_ALESPERPFLAILGG...

SEN / CTL

O75369

Filamin-B

FLNB

2.31

1.4

0.00000215

0.00000573

keratinocyte development,epithelial cell morphogen...

actin binding,protein binding,identical protein bi...

stress fiber,cytoplasm,cytosol,plasma membrane,bru...

345

207

345

_IAGPGLGSGVR_.2|_PAEFTIDTK_.2|_VLFASQEIPASPFR_.2|_...

SEN / CTL

Q13568

Interferon regulatory factor 5

IRF5

2.31

1.23

0.0833

0.0253

transcription, DNA-templated,response to peptidogl...

regulatory region DNA binding,transcription factor...

nucleus,cytoplasm,cytosol

17

13

17

_ALTISNPHGC[+57]R_.2|_HGPSQDGDNTIFK_.3|_HGPSQDGDNT...

SEN / CTL

P13804

Electron transfer flavoprotein subunit alpha, mitochondrial

ETFA

2.3

0.49

0.015

0.00932

respiratory electron transport chain,fatty acid be...

fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti...

mitochondrion,mitochondrial matrix,extracellular e...

48

29

48

_C[+57]DKVAQDLC[+57]K_.2|_SPDTFVR_.2|_VAQDLC[+57]K...

SEN / CTL

Q9NVN3

Synembryn-B

RIC8B

2.26

1.84

0.167

0.0433

regulation of G-protein coupled receptor protein s...

G-protein alpha-subunit binding,guanyl-nucleotide ...

cytoplasm,centrosome,cytosol,plasma membrane,cell ...

1

1

1

_GSSYREGLTPVLSLLTEC[+57]SR_.3

SEN / CTL

P08670

Vimentin

VIM

2.25

2.17

1.34e-32

9.67e-31

movement of cell or subcellular component,positive...

glycoprotein binding,double-stranded RNA binding,s...

cytoplasm,peroxisome,cytosol,cytoskeleton,intermed...

188

93

188

_EYQDLLNVK_.2|_FLEQQNKILLAELEQLKGQGK_.4|_FLEQQNKIL...

SEN / CTL

P16070

CD44 antigen

CD44

2.25

0.65

1.09e-7

3.73e-7

cell-matrix adhesion,single organismal cell-cell a...

protein binding,collagen binding,hyaluronic acid b...

cytoplasm,Golgi apparatus,plasma membrane,integral...

18

12

18

_ALSIGFETC[+57]R_.2|_YGFIEGHVVIPR_.3|_YGFIEGHVVIPR...

SEN / CTL

Q05682

Caldesmon

CALD1

2.25

2.27

0.0018

0.00195

movement of cell or subcellular component,muscle c...

actin binding,protein binding,calmodulin binding,t...

cytosol,cytoskeleton,plasma membrane,cell-cell adh...

87

61

87

_SAKPTKPAASDLPVPAEGVR_.4|_SAKPTKPAASDLPVPAEGVR_.3|...

SEN / CTL

P02753

Retinol-binding protein 4

RBP4

2.24

1.44

0.0125

0.00823

retinoid metabolic process,eye development,glucone...

protein binding,retinal binding,retinol binding,re...

extracellular region,extracellular space,cytosol,p...

16

11

16

_QRQEELC[+57]LAR_.3|_QRQEELC[+57]LAR_.2|_YWGVASFLQ...

SEN / CTL

P42285

Superkiller viralicidic activity 2-like 2

SKIV2L2

2.22

1.92

0.183

0.0459

mRNA splicing, via spliceosome,maturation of 5.8S ...

ATP-dependent RNA helicase activity,protein bindin...

nucleus,nucleoplasm,nucleolus,catalytic step 2 spl...

75

54

75

_LTEQLAGPLR_.2|_LDFNTDEEKK_.3|_LDFNTDEEKK_.2|_SFYQ...

SEN / CTL

P30626

Sorcin

SRI

2.21

1.17

0.0817

0.0251

action potential,proteolysis,transport,calcium ion...

protease binding,calcium-dependent cysteine-type e...

nucleoplasm,cytoplasm,mitochondrion,endoplasmic re...

28

18

28

_ALTDSFR_.2|_QHFISFDTDR_.3|_QHFISFDTDR_.2|_ALTTMGF...

SEN / CTL

P27348

14-3-3 protein theta

YWHAQ

2.21

2.86

0.117

0.0321

protein targeting,small GTPase mediated signal tra...

protein binding,protein C-terminus binding,protein...

cytoplasm,mitochondrion,cytosol,focal adhesion,mem...

46

23

46

_AVTEQGAELSNEER_.2|_AVTEQGAELSNEER_.3|_LAEQAERYDDM...

SEN / CTL

Q15233

Non-POU domain-containing octamer-binding protein

NONO

2.2

1.75

0.0276

0.0134

mRNA splicing, via spliceosome,DNA repair,DNA reco...

nucleotide binding,transcription regulatory region...

nucleus,nucleoplasm,nucleolus,membrane,nuclear mat...

99

43

99

_AAPGAEFAPNKR_.2|_AAPGAEFAPNKR_.3|_PVTVEPM[+16]DQL...

SEN / CTL

Q9NSE4

Isoleucine--tRNA ligase, mitochondrial

IARS2

2.2

1.68

0.152

0.04

tRNA aminoacylation for protein translation,isoleu...

tRNA binding,aminoacyl-tRNA editing activity,isole...

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

74

48

74

_DSFLGSIPGK_.2|_TVIVHGFTLGEKGEK_.4|_TVIVHGFTLGEKGE...

SEN / CTL

Q06830

Peroxiredoxin-1

PRDX1

2.17

1.27

2.29e-9

1.18e-8

response to reactive oxygen species,skeletal syste...

peroxidase activity,protein binding,thioredoxin pe...

extracellular space,nucleus,cytoplasm,mitochondrio...

60

29

60

_QITVNDLPVGR_.2|_QITVNDLPVGR_.3|_GLFIIDDKGILR_.3|_...

SEN / CTL

P50395

Rab GDP dissociation inhibitor beta

GDI2

2.16

1.83

7.42e-9

3.14e-8

signal transduction,small GTPase mediated signal t...

Rab GDP-dissociation inhibitor activity,GTPase act...

cytoplasm,Golgi apparatus,cytosol,focal adhesion,m...

113

56

113

_LYSESLAR_.2|_YGKSPYLYPLYGLGELPQGFAR_.3|_MTGSEFDFE...

SEN / CTL

P14314

Glucosidase 2 subunit beta

PRKCSH

2.16

1.47

0.0023

0.00235

protein folding,N-glycan processing,intracellular ...

protein kinase C binding,calcium ion binding,ion c...

intracellular,endoplasmic reticulum,endoplasmic re...

64

34

64

_SLEDQVEMLR_.2|_SLEDQVEM[+16]LR_.2|_LWEEQLAAAK_.2|...

SEN / CTL

Q13740

CD166 antigen

ALCAM

2.16

1.28

0.00901

0.00649

adaptive immune response,cell adhesion,heterophili...

receptor binding,protein binding

immunological synapse,integral component of plasma...

45

30

45

_WKYEKPDGSPVFIAFR_.4|_WKYEKPDGSPVFIAFR_.3|_SSNTYTL...

SEN / CTL

O60287

Nucleolar pre-ribosomal-associated protein 1

URB1

2.16

0.38

0.0104

0.00713

biological_process

poly(A) RNA binding

nucleolus

50

39

50

_LVVHC[+57]EQLDAQNQQR_.3|_LVVHC[+57]EQLDAQNQQR_.2|...

SEN / CTL

P62942

Peptidyl-prolyl cis-trans isomerase FKBP1A

FKBP1A

2.15

2.23

0.00666

0.00513

protein peptidyl-prolyl isomerization,heart morpho...

peptidyl-prolyl cis-trans isomerase activity,signa...

cytoplasm,endoplasmic reticulum membrane,cytosol,t...

23

8

23

_GVQVETISPGDGRTFPK_.3|_GVQVETISPGDGR_.2|_GVQVETISP...

SEN / CTL

Q96AY3

Peptidyl-prolyl cis-trans isomerase FKBP10

FKBP10

2.14

1.12

0.000449

0.000647

protein peptidyl-prolyl isomerization,chaperone-me...

peptidyl-prolyl cis-trans isomerase activity,calci...

endoplasmic reticulum lumen,endoplasmic reticulum ...

53

34

53

_IIIPPFLAYGEK_.2|_GLMGMC[+57]VNER_.2|_GLM[+16]GMC[...

SEN / CTL

Q9GZX9

Twisted gastrulation protein homolog 1

TWSG1

2.14

0.92

0.00235

0.00237

ossification,mesoderm formation,salivary gland mor...

protein binding

extracellular space,extracellular exosome

6

4

6

_STVEELHEPIPSLFR_.3|_STVEELHEPIPSLFR_.2|_ISC[+57]E...

SEN / CTL

P22090

P62701

40S ribosomal protein S4, Y isoform 1;40S ribosomal protein S4, X isoform

RPS4Y1

RPS4X

2.14

1.84

0.181

0.0456

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,rRN...

nucleus,nucleoplasm,cytosol,polysome,membrane,cyto...

1

1

1

_ERHPGSFDVVHVKDANGNSFATR_.5

SEN / CTL

Q7Z6Z7

E3 ubiquitin-protein ligase HUWE1

HUWE1

2.12

3.16

0.0795

0.0246

protein polyubiquitination,base-excision repair,pr...

DNA binding,ubiquitin-protein transferase activity...

nucleus,nucleoplasm,cytoplasm,cytosol,membrane,ext...

217

152

217

_GSGTASDDEFENLR_.2|_TTSNTLHYIHIEQLDK_.4|_TTSNTLHYI...

SEN / CTL

P54727

UV excision repair protein RAD23 homolog B

RAD23B

2.11

0.67

0.0000133

0.0000291

nucleotide-excision repair, DNA damage recognition...

damaged DNA binding,single-stranded DNA binding,pr...

proteasome complex,nucleus,nucleoplasm,cytoplasm,X...

33

20

33

_EQVIAALR_.2|_NFVVVMVTKPK_.3|_NFVVVMVTKPK_.2|_QIIQ...

SEN / CTL

O60504

Vinexin

SORBS3

2.11

0.21

0.00318

0.00301

negative regulation of transcription from RNA poly...

structural constituent of cytoskeleton,protein bin...

nucleus,cytosol,cytoskeleton,focal adhesion

20

17

20

_NWLEGEHHGR_.2|_GDIVYIHK_.2|_FDFQAQSPK_.2|_AGLSLDD...

SEN / CTL

Q9UPU9

Protein Smaug homolog 1

SAMD4A

2.11

1.26

0.101

0.0289

nuclear-transcribed mRNA poly(A) tail shortening,r...

mRNA binding,protein binding,translation repressor...

cytoplasmic mRNA processing body,cell junction,den...

38

28

38

_NTFQEEGSGMK_.2|_DIIEGGSLR_.2|_ILAHSIEHNQHIEESR_.4...

SEN / CTL

P19823

Inter-alpha-trypsin inhibitor heavy chain H2

ITIH2

2.1

0.85

0.00175

0.00194

negative regulation of endopeptidase activity,hyal...

endopeptidase inhibitor activity,serine-type endop...

extracellular region,extracellular exosome,blood m...

62

38

62

_IQPSGGTNINEALLR_.2|_FYNQVSTPLLR_.2|_DKHADPDFTR_.3...

SEN / CTL

P78417

Glutathione S-transferase omega-1

GSTO1

2.09

2.06

0.00489

0.00416

glutathione metabolic process,regulation of releas...

glutathione transferase activity,protein binding,o...

cytoplasm,cytosol,extracellular exosome

41

28

41

_FC[+57]PFAER_.2|_VPSLVGSFIR_.2|_GSAPPGPVPEGSIR_.2...

SEN / CTL

P29401

Transketolase

TKT

2.08

1.92

1.26e-10

8.23e-10

xylulose biosynthetic process,pentose-phosphate sh...

transketolase activity,protein binding,protein hom...

nucleus,nucleoplasm,peroxisome,cytosol,vesicle,mye...

103

53

103

_TVPFC[+57]STFAAFFTR_.2|_TVPFC[+57]STFAAFFTR_.3|_N...

SEN / CTL

Q13615

Myotubularin-related protein 3

MTMR3

2.06

0.96

0.0652

0.0218

protein dephosphorylation,phosphatidylinositol bio...

phosphatidylinositol-3-phosphatase activity,protei...

nucleoplasm,cytoplasm,cytosol,membrane,extrinsic c...

17

17

17

_AEDAIIALSNYR_.2|_EESGVEEPAHR_.3|_SYAAAVANR_.2|_QI...

SEN / CTL

P34059

N-acetylgalactosamine-6-sulfatase

GALNS

2.06

1.76

0.18

0.0455

keratan sulfate catabolic process

N-acetylgalactosamine-4-sulfatase activity,sulfuri...

lysosomal lumen,extracellular exosome

17

12

17

_YYEEFPINLK_.2|_NGFYTTNAHAR_.3|_NGFYTTNAHAR_.2|_GD...

SEN / CTL

Q9Y2I8

WD repeat-containing protein 37

WDR37

2.05

1.24

0.103

0.0293

maturation of 5.8S rRNA,maturation of LSU-rRNA

preribosome, large subunit precursor,PeBoW complex

28

21

28

_EIDTLNER_.2|_YAGHVGSVNSIK_.3|_YAGHVGSVNSIK_.2|_IN...

SEN / CTL

P98179

RNA-binding protein 3

RBM3

2.05

1.45

0.134

0.036

RNA processing,regulation of translation,positive ...

nucleotide binding,RNA binding,protein binding,pol...

nucleus,nucleoplasm,nucleolus,cytoplasm,dendrite,l...

18

10

18

_GFGFITFTNPEHASVAMR_.3|_GFGFITFTNPEHASVAMR_.4|_GFG...

SEN / CTL

Q9UNN8

Endothelial protein C receptor

PROCR

2.04

1.45

0.00295

0.00287

blood coagulation,negative regulation of coagulati...

receptor activity,protein binding

extracellular region,centrosome,plasma membrane,in...

7

5

7

_TLAFPLTIR_.2|_TQSGLQSYLLQFHGLVR_.3|_TQSGLQSYLLQFH...

SEN / CTL

P05204

Non-histone chromosomal protein HMG-17

HMGN2

2.04

0.34

0.00925

0.00659

protein binding,nucleosomal DNA binding,poly(A) RN...

chromatin,nucleus,cytoplasm

14

10

14

_LSAKPAPPKPEPKPK_.3|_LSAKPAPPKPEPK_.3|_GKADAGKEGNN...

SEN / CTL

P11021

78 kDa glucose-regulated protein

HSPA5

2.03

1.37

1.24e-13

1.19e-12

ER overload response,activation of signaling prote...

glycoprotein binding,calcium ion binding,protein b...

nucleus,mitochondrion,endoplasmic reticulum,endopl...

133

68

133

_AKFEELNMDLFR_.3|_AKFEELNMDLFR_.2|_AKFEELNM[+16]DL...

SEN / CTL

Q16610

Extracellular matrix protein 1

ECM1

2.03

1.95

3.91e-7

0.00000121

ossification,angiogenesis,positive regulation of e...

protease binding,signal transducer activity,interl...

extracellular region,proteinaceous extracellular m...

28

22

28

_VTPNLMGHLC[+57]GNQR_.3|_FSC[+57]FQEEAPQPHYQLR_.3|...

SEN / CTL

Q14789

Golgin subfamily B member 1

GOLGB1

2.03

0.95

0.0661

0.022

regulation of transcription, DNA-templated,ER to G...

transcription factor activity, sequence-specific D...

Golgi membrane,endoplasmic reticulum-Golgi interme...

198

169

198

_KRDVETLQQTIEEK_.3|_LKEDNC[+57]SVLK_.3|_SKEISQFLNR...

SEN / CTL

P01009

Alpha-1-antitrypsin

SERPINA1

2.03

1.73

0.18

0.0455

platelet degranulation,ER to Golgi vesicle-mediate...

glycoprotein binding,protease binding,serine-type ...

Golgi membrane,extracellular region,proteinaceous ...

85

44

85

_QINDYVEK_.2|_KLSSWVLLMK_.3|_KLSSWVLLMK_.2|_KQINDY...

SEN / CTL

Q562R1

Beta-actin-like protein 2

ACTBL2

2.02

1.3

0.00162

0.00185

biological_process

molecular_function,protein binding,ATP binding

extracellular space,cytoplasm,cytoskeleton,extrace...

17

9

17

_VAPDEHPILLTEAPLNPK_.3|_VAPDEHPILLTEAPLNPK_.4|_KDL...

SEN / CTL

Q8N3V7

Synaptopodin

SYNPO

2.02

1.15

0.0926

0.0271

positive regulation of actin filament bundle assem...

actin binding,protein binding

nucleus,bicellular tight junction,postsynaptic den...

23

19

23

_VYSEVHFTLAKPPSVVNR_.4|_VYSEVHFTLAKPPSVVNR_.3|_C[+...

SEN / CTL

P18206

Vinculin

VCL

2.01

2.28

5.23e-9

2.43e-8

morphogenesis of an epithelium,platelet degranulat...

dystroglycan binding,actin binding,structural mole...

podosome,extracellular region,cytosol,cytoskeleton...

192

102

192

_ELTPQVVSAAR_.2|_AVAGNISDPGLQK_.2|_AVAGNISDPGLQK_....

SEN / CTL

P09211

Glutathione S-transferase P

GSTP1

2.01

2.32

0.000122

0.000207

response to reactive oxygen species,negative regul...

glutathione transferase activity,glutathione perox...

extracellular space,intracellular,nucleus,cytoplas...

44

20

44

_PPYTVVYFPVR_.2|_PPYTVVYFPVR_.3|_FQDGDLTLYQSNTILR_...

SEN / CTL

Q86TU7

Histone-lysine N-methyltransferase setd3

SETD3

2.01

1.22

0.103

0.0293

transcription, DNA-templated,histone H3-K36 methyl...

RNA polymerase II activating transcription factor ...

nuclear chromatin,nucleoplasm

29

27

29

_EHLLGDSAIDR_.2|_EHLLGDSAIDR_.3|_NHDLSVR_.2|_GLSVT...

SEN / CTL

Q96FW1

Ubiquitin thioesterase OTUB1

OTUB1

2

1.21

0.104

0.0293

adaptive immune response,DNA repair,cellular respo...

thiol-dependent ubiquitin-specific protease activi...

nucleus,cytoplasm,extracellular exosome

23

13

23

_FFEHFIEGGR_.3|_FFEHFIEGGR_.2|_TRPDGNC[+57]FYR_.3|...

SEN / CTL

P22392

Nucleoside diphosphate kinase B

NME2

1.99

1.36

0.0000568

0.000106

purine nucleotide metabolic process,nucleoside dip...

DNA binding,transcription factor activity, sequenc...

ruffle,nucleus,cytoplasm,cytosol,lamellipodium,ext...

36

19

36

_TFIAIKPDGVQR_.3|_TFIAIKPDGVQR_.2|_SC[+57]AHDWVYE_...

SEN / CTL

P10253

Lysosomal alpha-glucosidase

GAA

1.99

1.13

0.00764

0.0057

maltose metabolic process,regulation of the force ...

alpha-1,4-glucosidase activity,oligo-1,6-glucosida...

lysosome,lysosomal membrane,membrane,lysosomal lum...

49

34

49

_GAYTQVIFLAR_.2|_WTQLGAFYPFMR_.2|_WTQLGAFYPFM[+16]...

SEN / CTL

P63241

Q6IS14

Q9GZV4

Eukaryotic translation initiation factor 5A-1;Eukaryotic translation initiation factor 5A-1-like;Eukaryotic translation initiation factor 5A-2

EIF5A

EIF5AL1

EIF5A2

1.99

1.98

0.0571

0.0203

mRNA export from nucleus,translational frameshifti...

RNA binding,translation elongation factor activity...

nucleus,annulate lamellae,nuclear pore,cytoplasm,e...

2

2

2

_VHLVGIDIFTGK_.3|_KYEDIC[+57]PSTHNMDVPNIKR_.5

SEN / CTL

Q8IY81

pre-rRNA processing protein FTSJ3

FTSJ3

1.99

1.18

0.0992

0.0285

maturation of LSU-rRNA from tricistronic rRNA tran...

protein binding,rRNA (uridine-2'-O-)-methyltransfe...

nucleus,nucleolus,preribosome, large subunit precu...

37

29

37

_TVTELVTK_.2|_AQEVAELK_.2|_KAEAVVNTVDISEREK_.4|_KA...

SEN / CTL

Q9UBG0

C-type mannose receptor 2

MRC2

1.98

0.56

0.0258

0.0129

osteoblast differentiation,endocytosis,signal tran...

transmembrane signaling receptor activity,protein ...

integral component of plasma membrane,focal adhesi...

39

30

39

_TLGDQLSLLLGAR_.2|_FFEHHSTWAQAQR_.4|_FFEHHSTWAQAQR...

SEN / CTL

Q14766

Latent-transforming growth factor beta-binding protein 1

LTBP1

1.97

2.64

0.0257

0.0129

ventricular septum development,transmembrane recep...

transforming growth factor beta-activated receptor...

microfibril,extracellular region,proteinaceous ext...

44

35

44

_VQEGYTC[+57]DC[+57]FDGYHLDTAK_.3|_C[+57]FQETIGSQC...

SEN / CTL

P13929

Beta-enolase

ENO3

1.95

0.62

0.000582

0.000798

gluconeogenesis,aging,response to drug,skeletal mu...

magnesium ion binding,phosphopyruvate hydratase ac...

phosphopyruvate hydratase complex,extracellular sp...

26

18

26

_VNQIGSVTESIQAC[+57]K_.2|_VNQIGSVTESIQAC[+57]K_.3|...

SEN / CTL

P21333

Filamin-A

FLNA

1.94

2.15

1.2e-17

1.92e-16

platelet degranulation,adenylate cyclase-inhibitin...

G-protein coupled receptor binding,glycoprotein bi...

extracellular region,nucleus,nucleolus,cytoplasm,c...

388

207

388

_AGGPGLERAEAGVPAEFSIWTR_.3|_AWGPGLEGGVVGK_.2|_VHGP...

SEN / CTL

P06753

Tropomyosin alpha-3 chain

TPM3

1.94

1.65

7.85e-9

3.23e-8

movement of cell or subcellular component,muscle c...

molecular_function,protein binding,structural cons...

stress fiber,cytosol,cytoskeleton,muscle thin fila...

55

33

55

_AADAEAEVASLNRR_.3|_IQLVEEELDRAQER_.3|_IQLVEEELDRA...

SEN / CTL

P02462

Collagen alpha-1(IV) chain

COL4A1

1.92

0.58

4.28e-9

2.13e-8

patterning of blood vessels,brain development,neur...

extracellular matrix structural constituent,protei...

extracellular region,collagen type IV trimer,basem...

11

7

11

_HSQTIDDPQC[+57]PSGTK_.3|_HSQTIDDPQC[+57]PSGTK_.2|...

SEN / CTL

Q969H8

Myeloid-derived growth factor

MYDGF

1.92

1.86

0.0044

0.00379

angiogenesis,positive regulation of protein phosph...

protein binding

extracellular space,endoplasmic reticulum lumen,en...

13

8

13

_SYLYFTQFK_.2|_GAEIEYAMAYSK_.2|_GAEIEYAM[+16]AYSK_...

SEN / CTL

Q14847

LIM and SH3 domain protein 1

LASP1

1.92

1.96

0.00599

0.00478

ion transport,positive regulation of signal transd...

SH3/SH2 adaptor activity,protein binding,zinc ion ...

cytoplasm,cell-cell adherens junction,focal adhesi...

35

20

35

_TGDTGMLPANYVEAI_.2|_TGDTGM[+16]LPANYVEAI_.2|_GKGF...

SEN / CTL

P07951

Tropomyosin beta chain

TPM2

1.89

0.68

1.17e-9

7e-9

muscle contraction,actin filament organization,mus...

actin binding,structural constituent of muscle,act...

cytosol,muscle thin filament tropomyosin,actin fil...

46

29

46

_AMKDEEKMELQEMQLK_.4|_AMKDEEKMELQEMQLK_.3|_HIAEDSD...

SEN / CTL

P60900

Proteasome subunit alpha type-6

PSMA6

1.89

0.53

0.0249

0.0127

MAPK cascade,protein polyubiquitination,stimulator...

RNA binding,endopeptidase activity,threonine-type ...

proteasome complex,cytoplasmic mRNA processing bod...

30

20

30

_AINQGGLTSVAVR_.2|_AINQGGLTSVAVR_.3|_GKDC[+57]AVIV...

SEN / CTL

P61970

Nuclear transport factor 2

NUTF2

1.89

1.53

0.0295

0.0141

protein import into nucleus, translocation,protein...

protein binding,protein transmembrane transporter ...

nuclear inner membrane,nuclear outer membrane,nucl...

20

8

20

_LSSLPFQK_.2|_AAIVEKLSSLPFQK_.3|_AAIVEKLSSLPFQK_.2...

SEN / CTL

P63220

40S ribosomal protein S21

RPS21

1.89

0.91

0.069

0.0224

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,poly(A) RNA bin...

nucleoplasm,cytoplasm,cytosol,small ribosomal subu...

18

7

18

_TYAIC[+57]GAIR_.2|_RMGESDDSILR_.3|_RM[+16]GESDDSI...

SEN / CTL

Q6R327

Rapamycin-insensitive companion of mTOR

RICTOR

1.89

1.17

0.108

0.0303

positive regulation of endothelial cell proliferat...

protein binding,enzyme activator activity,protein ...

cytosol,TORC2 complex

149

100

149

_LALLNEAK_.2|_APSIATIK_.2|_NYKDEQLHR_.3|_NYKDEQLHR...

SEN / CTL

P98160

Basement membrane-specific heparan sulfate proteoglycan core protein

HSPG2

1.89

3.17

0.111

0.031

retinoid metabolic process,angiogenesis,glycosamin...

calcium ion binding,protein binding,protein C-term...

extracellular region,basement membrane,extracellul...

239

163

239

_FSSGITGC[+57]VK_.2|_LVSEDPINDGEWHR_.3|_LGTVPQFPR_...

SEN / CTL

Q15717

ELAV-like protein 1

ELAVL1

1.88

0.64

0.0366

0.0156

mRNA splicing, via spliceosome,multicellular organ...

nucleotide binding,RNA binding,double-stranded RNA...

nucleus,nucleoplasm,cytoplasm,cytosol,membrane,rib...

35

21

35

_VLVDQTTGLSR_.2|_DANLYISGLPR_.3|_DANLYISGLPR_.2|_F...

SEN / CTL

P13489

Ribonuclease inhibitor

RNH1

1.88

0.65

0.037

0.0157

mRNA catabolic process,negative regulation of cata...

protein binding,ribonuclease inhibitor activity

nucleoplasm,cytoplasm,angiogenin-PRI complex,extra...

55

31

55

_LDDC[+57]GLTEAR_.2|_VNPALAELNLR_.3|_VNPALAELNLR_....

SEN / CTL

Q8WTW3

Conserved oligomeric Golgi complex subunit 1

COG1

1.88

0.89

0.067

0.0221

retrograde transport, vesicle recycling within Gol...

protein binding

Golgi membrane,Golgi apparatus,Golgi transport com...

36

27

36

_LLLEIPEK_.2|_TLAHPISQEYLK_.3|_TLAHPISQEYLK_.2|_C[...

SEN / CTL

Q6VMQ6

Activating transcription factor 7-interacting protein 1

ATF7IP

1.88

1.2

0.113

0.0312

negative regulation of transcription from RNA poly...

transcription corepressor activity,protein binding...

nucleus,nucleoplasm,transcription factor complex,c...

23

18

23

_TVLTELQAK_.2|_LPPEAASTSLPQKPHLK_.4|_NGADEKLEQIQSK...

SEN / CTL

P40925

Malate dehydrogenase, cytoplasmic

MDH1

1.87

1.54

0.000328

0.000502

gluconeogenesis,tricarboxylic acid cycle,oxaloacet...

malic enzyme activity,protein binding,L-malate deh...

extracellular space,cytoplasm,mitochondrion,centro...

39

23

39

_FVEGLPINDFSR_.2|_SAPSIPKENFSC[+57]LTR_.3|_SAPSIPK...

SEN / CTL

P08572

Collagen alpha-2(IV) chain

COL4A2

1.86

1.95

0.0024

0.0024

angiogenesis,transcription, DNA-templated,negative...

extracellular matrix structural constituent,protei...

extracellular region,collagen type IV trimer,extra...

19

15

19

_IAVQPGTVGPQGR_.2|_SVSIGYLLVK_.2|_FSTMPFLYC[+57]NP...

SEN / CTL

Q9HCD5

Nuclear receptor coactivator 5

NCOA5

1.86

1.67

0.194

0.0477

transcription, DNA-templated,regulation of transcr...

chromatin binding,protein binding,poly(A) RNA bind...

extracellular space,nucleus,actin cytoskeleton

29

20

29

_DPYGFGDSR_.2|_GGPEEGVR_.2|_GGHPPAIQSLINLLADNR_.4|...

SEN / CTL

Q6EMK4

Vasorin

VASN

1.85

1.76

0.000347

0.000526

negative regulation of epithelial to mesenchymal t...

protein binding,transforming growth factor beta bi...

extracellular space,mitochondrion,lysosomal membra...

8

8

8

_YLQGSSVQLR_.2|_LAGLGLQQLDEGLFSR_.2|_SLTLGIEPVSPTS...

SEN / CTL

P15311

Ezrin

EZR

1.85

1.49

0.165

0.0428

negative regulation of transcription from RNA poly...

actin binding,protein binding,microtubule binding,...

ruffle,immunological synapse,uropod,extracellular ...

90

50

90

_ELSEQIQR_.2|_LTRDQWEDR_.3|_QAVDQIK_.2|_AKEELERQAV...

SEN / CTL

Q14315

Filamin-C

FLNC

1.84

2.39

0.0000232

0.0000484

cell junction assembly,muscle fiber development

protein binding,cytoskeletal protein binding,ankyr...

cytoplasm,cytosol,cytoskeleton,plasma membrane,foc...

210

148

210

_LGSFGSITR_.2|_IQQNTFTR_.2|_YGGDEIPYSPFR_.2|_SPFEV...

SEN / CTL

P18669

Phosphoglycerate mutase 1

PGAM1

1.83

2.43

9.91e-7

0.00000291

gluconeogenesis,glycolytic process,regulation of g...

bisphosphoglycerate mutase activity,phosphoglycera...

cytoplasm,cytosol,membrane,myelin sheath,extracell...

83

38

83

_VLIAAHGNSLR_.2|_YADLTEDQLPSC[+57]ESLKDTIAR_.3|_YA...

SEN / CTL

P13611

Versican core protein

VCAN

1.8

1.67

0.00000198

0.00000538

skeletal system development,osteoblast differentia...

extracellular matrix structural constituent,calciu...

extracellular region,proteinaceous extracellular m...

23

17

23

_AQC[+57]GGGLLGVR_.2|_VSVPTHPEAVGDASLTVVK_.3|_YEIN...

SEN / CTL

P17931

Galectin-3

LGALS3

1.8

2.38

0.00504

0.00421

monocyte chemotaxis,mRNA processing,RNA splicing,n...

protein binding,IgE binding,carbohydrate binding,c...

immunological synapse,extracellular space,nucleus,...

19

12

19

_IALDFQR_.2|_GNDVAFHFNPR_.3|_GNDVAFHFNPR_.2|_VAVND...

SEN / CTL

P07686

Beta-hexosaminidase subunit beta

HEXB

1.79

1.51

0.00176

0.00194

skeletal system development,glycosphingolipid meta...

beta-N-acetylhexosaminidase activity,acetylglucosa...

acrosomal vesicle,extracellular space,membrane,azu...

38

27

38

_GILIDTSR_.2|_GIAAQPLYAGYC[+57]NHENM_.2|_LAPGTIVEV...

SEN / CTL

P40197

Platelet glycoprotein V

GP5

1.77

1.31

0.144

0.0382

cell adhesion,axonogenesis,blood coagulation,blood...

protein binding

plasma membrane,integral component of plasma membr...

17

11

17

_YLGVTLSPR_.2|_QHLGLVGGEEPPR_.3|_QHLGLVGGEEPPR_.2|...

SEN / CTL

P30101

Protein disulfide-isomerase A3

PDIA3

1.76

1.72

2.07e-9

1.15e-8

antigen processing and presentation of peptide ant...

protein disulfide isomerase activity,cysteine-type...

nucleus,endoplasmic reticulum,endoplasmic reticulu...

120

62

120

_LAPEYEAAATR_.2|_FLQDYFDGNLKR_.3|_FLQDYFDGNLKR_.2|...

SEN / CTL

P07237

Protein disulfide-isomerase

P4HB

1.76

2.04

0.00000968

0.0000218

response to reactive oxygen species,peptidyl-proli...

protein disulfide isomerase activity,integrin bind...

extracellular region,endoplasmic reticulum,endopla...

113

62

113

_ALAPEYAK_.2|_LAKVDATEESDLAQQYGVR_.3|_LAKVDATEESDL...

SEN / CTL

Q6UXS9

Inactive caspase-12

CASP12

1.76

0.66

0.0434

0.0171

endoplasmic reticulum unfolded protein response,re...

cysteine-type endopeptidase activity involved in a...

endoplasmic reticulum,IPAF inflammasome complex,NL...

2

1

2

_AGADTHGRLLQGNIC[+57]NDAVTK_.3|_AGADTHGRLLQGNIC[+5...

SEN / CTL

P26022

Pentraxin-related protein PTX3

PTX3

1.76

1.95

0.0779

0.0244

response to yeast,inflammatory response,opsonizati...

complement component C1q binding,(1->3)-beta-D-glu...

extracellular region,extracellular space

7

7

7

_LTSALDELLQATR_.2|_ALAAVLEELR_.2|_ETGGAESC[+57]HIR...

SEN / CTL

P31946

14-3-3 protein beta/alpha

YWHAB

1.75

1.92

0.0000264

0.0000536

MAPK cascade,protein targeting,viral process,negat...

transcription corepressor activity,protein binding...

nucleus,cytoplasm,mitochondrion,cytosol,cell-cell ...

87

37

87

_NLLSVAYK_.2|_NLLSVAYK_.1|_NLLSVAYKNVVGAR_.3|_NLLS...

SEN / CTL

Q7Z401

C-myc promoter-binding protein

DENND4A

1.75

1.17

0.122

0.0332

transcription, DNA-templated,regulation of transcr...

DNA binding,Rab guanyl-nucleotide exchange factor ...

nucleus

135

90

135

_ISGESM[+16]ESTPELLLISSLEDTNETR_.3|_ISGESMESTPELLL...

SEN / CTL

Q15369

Transcription elongation factor B polypeptide 1

TCEB1

1.74

0.75

0.057

0.0203

regulation of transcription from RNA polymerase II...

protein binding,protein complex binding,ubiquitin-...

nucleoplasm,cytosol,VCB complex,elongin complex

18

9

18

_AMLSGPGQFAENETNEVNFR_.3|_AM[+16]LSGPGQFAENETNEVNF...

SEN / CTL

P17174

Aspartate aminotransferase, cytoplasmic

GOT1

1.73

0.34

0.0125

0.00823

gluconeogenesis,2-oxoglutarate metabolic process,o...

L-aspartate:2-oxoglutarate aminotransferase activi...

nucleus,cytoplasm,lysosome,cytosol,axon terminus,e...

57

36

57

_IGADFLAR_.2|_VGNLTVVGK_.2|_LALGDDSPALKEK_.3|_INVS...

SEN / CTL

P61916

Epididymal secretory protein E1

NPC2

1.72

1.21

0.0179

0.0104

cholesterol metabolic process,response to virus,ph...

protein binding,cholesterol binding,enzyme binding

extracellular space,lysosome,endoplasmic reticulum...

19

12

19

_SGINC[+57]PIQK_.2|_AVVHGILMGVPVPFPIPEPDGC[+57]K_....

SEN / CTL

P27816

Microtubule-associated protein 4

MAP4

1.72

1.55

0.196

0.0479

mitotic spindle organization,neuron projection dev...

structural molecule activity,protein binding,micro...

cytoplasm,microtubule,microtubule associated compl...

96

68

96

_VGSLDNVGHLPAGGAVK_.3|_VGSLDNVGHLPAGGAVK_.2|_ASPSK...

SEN / CTL

Q12792

Q6IBS0

Twinfilin-1;Twinfilin-2

TWF1

TWF2

1.71

1.46

0.18

0.0455

negative regulation of actin filament polymerizati...

actin monomer binding,ATP binding,phosphatidylinos...

cytoplasm,cell-cell junction,cell-cell adherens ju...

1

1

1

_MLYAATR_.2

SEN / CTL

P52565

Rho GDP-dissociation inhibitor 1

ARHGDIA

1.68

1.41

0.00168

0.0019

movement of cell or subcellular component,negative...

Rho GDP-dissociation inhibitor activity,GTPase act...

cytosol,cytoskeleton,extracellular exosome

29

15

29

_AEEYEFLTPVEEAPK_.2|_AEEYEFLTPVEEAPK_.3|_IDKTDYMVG...

SEN / CTL

Q9BY43

Charged multivesicular body protein 4a

CHMP4A

1.68

0.63

0.0442

0.0173

cell separation after cytokinesis,posttranslationa...

protein binding,lipid binding,identical protein bi...

ESCRT III complex,nucleus,cytoplasm,cytosol,cytopl...

12

11

12

_FEQQLAQTDGTLSTLEFQR_.3|_FEQQLAQTDGTLSTLEFQR_.2|_L...

SEN / CTL

Q14112

Nidogen-2

NID2

1.67

1.63

5.99e-9

2.69e-8

cell adhesion,cell-matrix adhesion,extracellular m...

calcium ion binding,protein binding,collagen bindi...

extracellular region,basement membrane,extracellul...

59

45

59

_VLYREDTSPAVLGLAAR_.3|_HAQAQYAYPGAR_.3|_HAQAQYAYPG...

SEN / CTL

Q8NAV1

Pre-mRNA-splicing factor 38A

PRPF38A

1.67

0.64

0.0461

0.0176

mRNA processing,RNA splicing

protein binding,poly(A) RNA binding

nucleus,nuclear membrane,precatalytic spliceosome

18

13

18

_FVGGVYGGNIK_.2|_DAHSIHGTNPQYLVEK_.4|_DAHSIHGTNPQY...

SEN / CTL

P48729

Casein kinase I isoform alpha

CSNK1A1

1.67

2.2

0.123

0.0333

protein phosphorylation,phagocytosis,Golgi organiz...

protein kinase activity,protein serine/threonine k...

condensed chromosome kinetochore,centrosome,cytoso...

28

17

28

_TSLPWQGLK_.2|_KMSTPVEVLC[+57]K_.2|_KMSTPVEVLC[+57...

SEN / CTL

P15586

N-acetylglucosamine-6-sulfatase

GNS

1.66

0.87

3.17e-7

0.00000101

glycosaminoglycan catabolic process,keratan sulfat...

protein binding,N-acetylglucosamine-6-sulfatase ac...

lysosomal lumen,extracellular exosome

33

18

33

_TIDPELLGK_.2|_IQEPNTFPAILR_.2|_AFQNVFAPR_.2|_WQTL...

SEN / CTL

P06865

Beta-hexosaminidase subunit alpha

HEXA

1.65

1.05

0.00151

0.00174

carbohydrate metabolic process,glycosaminoglycan b...

beta-N-acetylhexosaminidase activity,acetylglucosa...

membrane,azurophil granule,lysosomal lumen,extrace...

32

21

32

_ALLSAPWYLNR_.2|_GLLLDTSR_.2|_SNPEIQDFMR_.2|_IQPDT...

SEN / CTL

P63244

Guanine nucleotide-binding protein subunit beta-2-like 1

GNB2L1

1.65

1.75

0.0698

0.0225

osteoblast differentiation,positive regulation of ...

protein kinase C binding,receptor binding,protein ...

phagocytic cup,nucleus,cytoplasm,mitochondrion,cyt...

51

30

51

_DGQAMLWDLNEGKHLYTLDGGDIINALC[+57]FSPNR_.4|_DGQAM[...

SEN / CTL

P35908

Keratin, type II cytoskeletal 2 epidermal

KRT2

1.64

2.01

0.00000425

0.0000107

keratinocyte development,epidermis development,ker...

structural constituent of cytoskeleton,protein bin...

extracellular space,nucleus,cytoplasm,Golgi appara...

103

55

103

_YLDGLTAER_.2|_HGGGGGGFGGGGFGSR_.3|_HGGGGGGFGGGGFG...

SEN / CTL

P24821

Tenascin

TNC

1.64

1.41

0.00201

0.00209

osteoblast differentiation,cell adhesion,negative ...

syndecan binding

extracellular region,basement membrane,interstitia...

105

77

105

_VSIYGVIR_.2|_ITAQGQYELR_.2|_GLEPGQEYNVLLTAEK_.2|_...

SEN / CTL

Q96CG8

Collagen triple helix repeat-containing protein 1

CTHRC1

1.64

0.81

0.00418

0.00363

cell migration,positive regulation of protein bind...

frizzled binding,Wnt-protein binding

proteinaceous extracellular matrix,collagen trimer...

3

3

3

_IIIEELPK_.2|_QC[+57]SWSSLNYGIDLGK_.2|_GDASTGWNSVS...

SEN / CTL

Q14116

Interleukin-18

IL18

1.64

1.05

0.114

0.0314

MAPK cascade,angiogenesis,inflammatory response,im...

cytokine activity,protein binding

extracellular region,extracellular space,cytosol,e...

18

14

18

_EMNPPDNIK_.2|_GMAVTISVK_.2|_EM[+16]NPPDNIKDTK_.3|...

SEN / CTL

Q9NRY6

Phospholipid scramblase 3

PLSCR3

1.61

1.19

0.143

0.038

apoptotic process,phospholipid scrambling,glucose ...

calcium ion binding,protein binding,SH3 domain bin...

plasma membrane,integral component of membrane,mit...

1

1

1

_FSIQDADR_.2

SEN / CTL

O43790

P78385

P78386

Q14533

Keratin, type II cuticular Hb6;Keratin, type II cuticular Hb3;Keratin, type II cuticular Hb5;Keratin, type II cuticular Hb1

KRT86

KRT83

KRT85

KRT81

1.61

1.45

0.194

0.0477

;aging,epidermis development,hair cycle;epidermis ...

structural molecule activity,protein binding;struc...

extracellular space,keratin filament,extracellular...

1

1

1

_LGLDIEIATYR_.2

SEN / CTL

P26038

Moesin

MSN

1.6

1.94

6.57e-9

2.87e-8

movement of cell or subcellular component,cytoskel...

double-stranded RNA binding,actin binding,receptor...

uropod,extracellular space,nucleus,cytoplasm,cytos...

112

62

112

_IGFPWSEIR_.2|_QRIDEFESM_.2|_ISQLEMAR_.2|_ISQLEM[+...

SEN / CTL

P09936

Ubiquitin carboxyl-terminal hydrolase isozyme L1

UCHL1

1.6

2.05

0.000393

0.000584

response to ischemia,axon target recognition,adult...

cysteine-type endopeptidase activity,thiol-depende...

nucleoplasm,cytoplasm,endoplasmic reticulum membra...

39

20

39

_LGVAGQWR_.2|_FSAVALC[+57]K_.2|_EFTEREQGEVR_.3|_QI...

SEN / CTL

P08253

72 kDa type IV collagenase

MMP2

1.6

0.72

0.0607

0.0207

angiogenesis,response to hypoxia,blood vessel matu...

metalloendopeptidase activity,serine-type endopept...

extracellular region,proteinaceous extracellular m...

2

2

2

_IIGYTPDLDPETVDDAFAR_.2|_IDAVYEAPQEEK_.2

SEN / CTL

Q04760

Lactoylglutathione lyase

GLO1

1.59

0.75

0.00347

0.0032

carbohydrate metabolic process,pyruvate metabolic ...

lactoylglutathione lyase activity,zinc ion binding

cytoplasm,cytosol,extracellular exosome

31

16

31

_SLDFYTR_.2|_IAWALSR_.2|_FEELGVK_.2|_DFLLQQTMLR_.3...

SEN / CTL

Q02818

Nucleobindin-1

NUCB1

1.57

1.71

1.94e-7

6.49e-7

response to cisplatin,regulation of protein target...

G-protein alpha-subunit binding,DNA binding,calciu...

extracellular space,nucleus,early endosome,rough e...

46

33

46

_LSQETEALGR_.2|_ELDFVSHHVR_.3|_ELDFVSHHVR_.2|_ELQQ...

SEN / CTL

Q5JTZ5

Uncharacterized protein C9orf152

C9orf152

1.57

1.35

0.18

0.0455

3

3

3

_LEEAAQGC[+57]LQAPK_.2|_GPPLSIQFLR_.2|_FSTQC[+57]P...

SEN / CTL

O43447

Peptidyl-prolyl cis-trans isomerase H

PPIH

1.56

0.3

0.0118

0.00789

mRNA splicing, via spliceosome,protein peptidyl-pr...

peptidyl-prolyl cis-trans isomerase activity,prote...

nucleoplasm,spliceosomal complex,cytoplasm,nuclear...

20

12

20

_IIDGLLVM[+16]R_.2|_IIDGLLVMR_.2|_C[+57]DWLDGK_.2|...

SEN / CTL

P47897

Glutamine--tRNA ligase

QARS

1.56

0.69

0.0593

0.0205

tRNA aminoacylation for protein translation,glutam...

RNA binding,glutamine-tRNA ligase activity,protein...

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

100

58

100

_VGVTVAQTTMEPHLLEAC[+57]VR_.3|_VGVTVAQTTM[+16]EPHL...

SEN / CTL

Q15274

Nicotinate-nucleotide pyrophosphorylase [carboxylating]

QPRT

1.56

0.75

0.0688

0.0224

NAD biosynthetic process,NAD metabolic process,qui...

nicotinate-nucleotide diphosphorylase (carboxylati...

cytoplasm,cytosol,extracellular exosome

15

11

15

_VALNTLAR_.2|_YGLLVGGAASHR_.3|_YGLLVGGAASHR_.2|_GP...

SEN / CTL

Q86Y46

Keratin, type II cytoskeletal 73

KRT73

1.56

2.08

0.125

0.0338

biological_process

molecular_function,structural molecule activity,pr...

nucleus,keratin filament,extracellular exosome

3

3

3

_FLEQQNQVLETK_.2|_LSLDIEIATYR_.2|_LSLDIEIATYRK_.3

SEN / CTL

P00441

Superoxide dismutase [Cu-Zn]

SOD1

1.55

1.2

0.00000183

0.00000506

activation of MAPK activity,response to reactive o...

superoxide dismutase activity,copper ion binding,p...

extracellular region,extracellular space,nucleus,n...

39

20

39

_LAC[+57]GVIGIAQ_.2|_GLTEGLHGFHVHEFGDNTAGC[+57]TSA...

SEN / CTL

P40926

Malate dehydrogenase, mitochondrial

MDH2

1.55

1.97

0.0000368

0.0000725

gluconeogenesis,tricarboxylic acid cycle,oxaloacet...

L-malate dehydrogenase activity,protein self-assoc...

nucleus,nucleoplasm,mitochondrion,mitochondrial in...

62

31

62

_ANTFVAELK_.2|_IQEAGTEVVK_.2|_HGVYNPNKIFGVTTLDIVR_...

SEN / CTL

P07858

Cathepsin B

CTSB

1.54

1.53

0.00000598

0.0000143

toll-like receptor signaling pathway,proteolysis,c...

cysteine-type endopeptidase activity,serine-type e...

extracellular region,extracellular space,intracell...

46

22

46

_LC[+57]GTFLGGPKPPQR_.3|_EQWPQC[+57]PTIK_.2|_LPASF...

SEN / CTL

P37837

Transaldolase

TALDO1

1.53

1.32

0.00208

0.00214

carbohydrate metabolic process,xylulose biosynthet...

sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosp...

nucleus,cytoplasm,cytosol,extracellular exosome

43

31

43

_SYEPLEDPGVK_.2|_LLGELLQDNAK_.2|_LLGELLQDNAK_.3|_L...

SEN / CTL

Q86V81

THO complex subunit 4

ALYREF

1.53

0.37

0.0186

0.0106

regulation of DNA recombination,mRNA splicing, via...

nucleotide binding,protein binding,poly(A) RNA bin...

transcription export complex,nucleus,nucleoplasm,c...

20

12

20

_SLGTADVHFER_.3|_SLGTADVHFER_.2|_AAVHYDR_.2|_GAGGF...

SEN / CTL

Q09028

Histone-binding protein RBBP4

RBBP4

1.53

1.42

0.0459

0.0176

DNA replication,DNA replication-dependent nucleoso...

histone deacetylase activity,protein binding,histo...

nuclear chromatin,nucleus,nucleoplasm,Sin3 complex...

36

18

36

_LNVWDLSK_.2|_LHSFESHKDEIFQVQWSPHNETILASSGTDR_.5|_...

SEN / CTL

Q00839

Heterogeneous nuclear ribonucleoprotein U

HNRNPU

1.53

1.03

0.123

0.0333

mRNA splicing, via spliceosome,osteoblast differen...

core promoter binding,DNA binding,RNA binding,prot...

nucleus,nucleoplasm,cell surface,membrane,intracel...

129

64

129

_LSDKGLKAELMER_.3|_M[+16]MVAGFK_.2|_VSELKEELKK_.3|...

SEN / CTL

P30041

Peroxiredoxin-6

PRDX6

1.53

1.17

0.152

0.0401

response to reactive oxygen species,lipid cataboli...

glutathione peroxidase activity,protein binding,hy...

extracellular space,cytoplasm,lysosome,cytosol,cel...

62

31

62

_DFTPVC[+57]TTELGR_.2|_DFTPVC[+57]TTELGR_.3|_LPFPI...

SEN / CTL

P00374

Q86XF0

Dihydrofolate reductase;Dihydrofolate reductase, mitochondrial

DHFR

DHFRL1

1.5

0.96

0.0126

0.00823

G1/S transition of mitotic cell cycle,regulation o...

mRNA binding,dihydrofolate reductase activity,foli...

cellular_component,nucleoplasm,cytosol;mitochondri...

2

2

2

_M[+16]TTTSSVEGK_.2|_TWFSIPEK_.2

SEN / CTL

P04080

Cystatin-B

CSTB

1.5

1.24

0.0308

0.0143

adult locomotory behavior,negative regulation of p...

protease binding,endopeptidase inhibitor activity,...

extracellular space,nucleolus,cytoplasm,extracellu...

11

8

11

_SQVVAGTNYFIK_.2|_SQVVAGTNYFIK_.3|_VHVGDEDFVHLR_.3...

SEN / CTL

Q14152

Eukaryotic translation initiation factor 3 subunit A

EIF3A

1.5

3.01

0.172

0.0441

formation of cytoplasmic translation initiation co...

RNA binding,mRNA binding,structural molecule activ...

nucleus,nucleolus,cytoplasm,cytosol,eukaryotic tra...

150

97

150

_RGAEDDRGPWR_.3|_LEEIPLIK_.2|_TLSFGSDLNYATREDAPIGP...

SEN / CTL

P09651

Heterogeneous nuclear ribonucleoprotein A1

HNRNPA1

1.47

1.9

0.115

0.0318

mRNA splicing, via spliceosome,mRNA processing,RNA...

nucleotide binding,single-stranded DNA binding,RNA...

nucleus,nucleoplasm,spliceosomal complex,cytoplasm...

92

41

92

_GFGFVTYATVEEVDAAMNARPHKVDGR_.5|_GFGFVTYATVEEVDAAM...

SEN / CTL

Q08380

Galectin-3-binding protein

LGALS3BP

1.46

1.7

2.41e-8

8.88e-8

platelet degranulation,receptor-mediated endocytos...

scavenger receptor activity

extracellular region,proteinaceous extracellular m...

30

23

30

_IYTSPTWSAFVTDSSWSAR_.3|_IYTSPTWSAFVTDSSWSAR_.2|_S...

SEN / CTL

P16035

Metalloproteinase inhibitor 2

TIMP2

1.46

1.48

0.00183

0.00197

central nervous system development,aging,negative ...

protease binding,integrin binding,protein binding,...

extracellular region,proteinaceous extracellular m...

11

8

11

_AVSEKEVDSGNDIYGNPIKR_.4|_AVSEKEVDSGNDIYGNPIKR_.3|...

SEN / CTL

P62736

P63267

Actin, aortic smooth muscle;Actin, gamma-enteric smooth muscle

ACTA2

ACTG2

1.46

1.97

0.0562

0.0201

muscle contraction,regulation of blood pressure,re...

ATP binding,protein kinase binding;ATP binding

extracellular space,cytoplasm,cytosol,actin cytosk...

3

3

3

_VAPEEHPTLLTEAPLNPK_.3|_LC[+57]YVALDFENEM[+16]ATAA...

SEN / CTL

P07602

Prosaposin

PSAP

1.44

1.87

0.0000538

0.000102

platelet degranulation,glycosphingolipid metabolic...

G-protein coupled receptor binding,protein binding...

extracellular region,extracellular space,cytoplasm...

59

30

59

_DGGFC[+57]EVC[+57]K_.2|_DGGFC[+57]EVC[+57]KK_.3|_...

SEN / CTL

P22314

Ubiquitin-like modifier-activating enzyme 1

UBA1

1.43

2.26

0.0935

0.0272

cellular response to DNA damage stimulus,protein u...

ubiquitin activating enzyme activity,ubiquitin-pro...

nucleus,cytoplasm,mitochondrion,cytosol,extracellu...

128

67

128

_QFLDYFK_.2|_LQTSSVLVSGLR_.2|_NIILGGVK_.2|_ATLPSPD...

SEN / CTL

Q9H299

SH3 domain-binding glutamic acid-rich-like protein 3

SH3BGRL3

1.41

1

0.000508

0.00071

regulation of actin filament depolymerization,regu...

GTPase activator activity,electron carrier activit...

nucleus,cytoplasm,lamellipodium,extracellular exos...

15

7

15

_VYSTSVTGSR_.2|_IQYQLVDISQDNALRDEMR_.3|_IQYQLVDISQ...

SEN / CTL

P43246

DNA mismatch repair protein Msh2

MSH2

1.41

2.12

0.163

0.0425

meiotic mismatch repair,in utero embryonic develop...

Y-form DNA binding,heteroduplex DNA loop binding,d...

nuclear chromosome, telomeric region,nucleoplasm,m...

55

44

55

_IIQEFLSK_.2|_LDSSAQFGYYFR_.2|_HVIEC[+57]AK_.2|_GG...

SEN / CTL

P14550

Alcohol dehydrogenase [NADP(+)]

AKR1A1

1.4

1.39

0.00506

0.00421

glucose metabolic process,cellular aldehyde metabo...

alditol:NADP+ 1-oxidoreductase activity,aldo-keto ...

extracellular space,cytosol,apical plasma membrane...

45

26

45

_YALSVGYR_.2|_ALEALVAK_.2|_DAGHPLYPFNDPY_.2|_MPLIG...

SEN / CTL

P09382

Galectin-1

LGALS1

1.38

2

0.00000879

0.0000201

plasma cell differentiation,apoptotic process,sign...

glycoprotein binding,signal transducer activity,pr...

proteinaceous extracellular matrix,extracellular s...

33

17

33

_SFVLNLGKDSNNLC[+57]LHFNPR_.4|_SFVLNLGKDSNNLC[+57]...

SEN / CTL

Q15582

Transforming growth factor-beta-induced protein ig-h3

TGFBI

1.37

1.79

1.97e-12

1.49e-11

angiogenesis,chondrocyte differentiation,cell adhe...

integrin binding,protein binding,collagen binding,...

extracellular region,proteinaceous extracellular m...

60

38

60

_NSLC[+57]IENSC[+57]IAAHDKR_.4|_NSLC[+57]IENSC[+57...

SEN / CTL

P12110

Collagen alpha-2(VI) chain

COL6A2

1.37

1.94

0.0000777

0.000138

cell adhesion,response to glucose,extracellular ma...

protein binding

extracellular region,proteinaceous extracellular m...

57

42

57

_FVEQVAR_.2|_VFAVVITDGRHDPRDDDLNLR_.5|_VFAVVITDGRH...

SEN / CTL

P13667

Protein disulfide-isomerase A4

PDIA4

1.37

1.2

0.186

0.0464

protein folding,protein secretion,response to endo...

protein disulfide isomerase activity,protein bindi...

endoplasmic reticulum lumen,cell surface,melanosom...

125

69

125

_IDATSASVLASR_.2|_KGQAVDYEGSR_.3|_KGQAVDYEGSR_.2|_...

SEN / CTL

Q15063

Periostin

POSTN

1.36

1.84

0.0126

0.00823

skeletal system development,response to hypoxia,ne...

protein binding,heparin binding,metal ion binding,...

proteinaceous extracellular matrix,extracellular s...

80

48

80

_GFEPGVTNILK_.2|_AAAITSDILEALGR_.2|_TTVLYEC[+57]C[...

SEN / CTL

O00468

Agrin

AGRN

1.36

1.91

0.0309

0.0143

retinoid metabolic process,glycosaminoglycan biosy...

dystroglycan binding,structural constituent of cyt...

extracellular region,basal lamina,cytoplasm,Golgi ...

64

54

64

_SFLAFPTLR_.2|_AYGTGFVGC[+57]LR_.2|_SAGDVDTLAFDGR_...

SEN / CTL

Q9P246

Stromal interaction molecule 2

STIM2

1.35

0.18

0.00585

0.0047

store-operated calcium entry,cellular calcium ion ...

calcium channel regulator activity,calcium ion bin...

endoplasmic reticulum,endoplasmic reticulum membra...

17

15

17

_HITIEDLWK_.2|_RQYAEQELEQVR_.3|_RQYAEQELEQVR_.2|_E...

SEN / CTL

P12955

Xaa-Pro dipeptidase

PEPD

1.34

1.26

0.0479

0.018

proteolysis,cellular amino acid metabolic process,...

aminopeptidase activity,metallocarboxypeptidase ac...

extracellular exosome

41

27

41

_AVYEAVLR_.2|_VPLALFALNR_.2|_IDEPGLR_.2|_LPASHATWM...

SEN / CTL

P07108

Acyl-CoA-binding protein

DBI

1.33

1.37

0.0623

0.0211

transport,phosphatidylcholine acyl-chain remodelin...

lipid binding,benzodiazepine receptor binding,long...

endoplasmic reticulum,Golgi apparatus,extracellula...

18

8

18

_TKPSDEEMLFIYGHYK_.3|_TKPSDEEMLFIYGHYK_.4|_TKPSDEE...

SEN / CTL

Q6P2Q9

Pre-mRNA-processing-splicing factor 8

PRPF8

1.33

1.13

0.178

0.0453

spliceosomal tri-snRNP complex assembly,RNA splici...

second spliceosomal transesterification activity,p...

nucleus,nucleoplasm,U5 snRNP,membrane,nuclear spec...

204

138

204

_LVVDSHVQYR_.3|_LVVDSHVQYR_.2|_FGDLILK_.2|_HDVNLGR...

SEN / CTL

P29279

Connective tissue growth factor

CTGF

1.3

0.15

0.00411

0.00359

cartilage condensation,ossification,angiogenesis,r...

fibronectin binding,integrin binding,protein bindi...

extracellular region,proteinaceous extracellular m...

8

8

8

_DGAPC[+57]IFGGTVYR_.2|_C[+57]PDEPAPR_.2|_TTTLPVEF...

SEN / CTL

P22626

Heterogeneous nuclear ribonucleoproteins A2/B1

HNRNPA2B1

1.29

1.89

0.000449

0.000647

negative regulation of transcription from RNA poly...

nucleotide binding,RNA binding,mRNA 3'-UTR binding...

chromosome, telomeric region,nucleus,nucleoplasm,s...

96

47

96

_GFGFVTFDDHDPVDKIVLQK_.4|_GFGFVTFDDHDPVDKIVLQK_.3|...

SEN / CTL

P01034

Cystatin-C

CST3

1.29

1.11

0.0352

0.0152

defense response,negative regulation of peptidase ...

beta-amyloid binding,protease binding,endopeptidas...

extracellular region,extracellular space,extracell...

11

7

11

_ALDFAVGEYNK_.2|_LVGGPMDASVEEEGVRR_.3|_LVGGPM[+16]...

SEN / CTL

P28799

Granulins

GRN

1.28

1.64

0.047

0.0178

signal transduction

cytokine activity,protein binding,growth factor ac...

extracellular space,intracellular membrane-bounded...

23

18

23

_SRC[+57]PDGSTC[+57]C[+57]ELPSGK_.3|_GSEIVAGLEK_.2...

SEN / CTL

Q15057

Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2

ACAP2

1.28

0.74

0.095

0.0275

protein localization to endosome,positive regulati...

GTPase activator activity,Rab GTPase binding,metal...

endosome membrane,membrane

30

27

30

_MAEALAHGADVNWANSEENK_.3|_HLNPGLQLYR_.3|_HLNPGLQLY...

SEN / CTL

Q99715

Collagen alpha-1(XII) chain

COL12A1

1.27

1.77

0.00000486

0.0000119

skeletal system development,cell adhesion,collagen...

extracellular matrix structural constituent confer...

extracellular region,collagen type XII trimer,extr...

114

96

114

_IVEVFDIGPK_.2|_NVGVEVFSLGIK_.2|_NTFTESAGAR_.2|_II...

SEN / CTL

P02533

Keratin, type I cytoskeletal 14

KRT14

1.26

2.12

0.112

0.0311

aging,epidermis development,response to zinc ion,r...

structural constituent of cytoskeleton,protein bin...

nucleus,cytoplasm,cytosol,intermediate filament,ke...

85

47

85

_VLDELTLAR_.2|_ISSVLAGGSC[+57]R_.2|_MSVEADINGLRR_....

SEN / CTL

O43707

Alpha-actinin-4

ACTN4

1.25

1.83

4.81e-9

2.31e-8

response to hypoxia,platelet degranulation,protein...

RNA polymerase II regulatory region sequence-speci...

stress fiber,extracellular region,extracellular sp...

162

89

162

_VGWEQLLTTIAR_.2|_VGWEQLLTTIAR_.3|_TINEVENQILTR_.2...

SEN / CTL

P13987

CD59 glycoprotein

CD59

1.24

1.46

0.0919

0.027

cell activation,negative regulation of activation ...

complement binding,protein binding

Golgi membrane,extracellular space,endoplasmic ret...

9

6

9

_AGLQVYNK_.2|_FEHC[+57]NFNDVTTR_.3|_FEHC[+57]NFNDV...

SEN / CTL

P23284

Peptidyl-prolyl cis-trans isomerase B

PPIB

1.23

1.53

0.00148

0.00172

protein peptidyl-prolyl isomerization,positive reg...

peptidyl-prolyl cis-trans isomerase activity,prote...

nucleus,endoplasmic reticulum,endoplasmic reticulu...

56

28

56

_VLEGMEVVR_.2|_VLEGM[+16]EVVR_.2|_VIFGLFGK_.2|_SIY...

SEN / CTL

P27797

Calreticulin

CALR

1.22

1.85

0.000639

0.00086

negative regulation of transcription from RNA poly...

complement component C1q binding,glycoprotein bind...

acrosomal vesicle,extracellular region,proteinaceo...

95

52

95

_NVLINKDIR_.2|_EQFLDGDGWTSR_.2|_FYGDEEKDKGLQTSQDAR...

SEN / CTL

P63104

14-3-3 protein zeta/delta

YWHAZ

1.22

2.18

0.0012

0.00148

signal transduction,platelet activation,negative r...

protein binding,transcription factor binding,prote...

extracellular space,nucleus,nucleoplasm,cytoplasm,...

53

22

53

_SVTEQGAELSNEER_.2|_SVTEQGAELSNEER_.3|_SVTEQGAELSN...

SEN / CTL

Q13308

Inactive tyrosine-protein kinase 7

PTK7

1.21

1.42

0.000851

0.00108

establishment of planar polarity,ventricular septu...

protein kinase activity,protein binding,ATP bindin...

integral component of plasma membrane,cell-cell ju...

35

30

35

_VVLAPQDVVVAR_.2|_INSVEVYDGTWYR_.2|_ADGSSLPEWVTDNA...

SEN / CTL

O43852

Calumenin

CALU

1.21

1.85

0.00397

0.00349

biological_process

calcium ion binding,protein binding

extracellular region,endoplasmic reticulum,endopla...

62

34

62

_WIYEDVER_.2|_EQFVEFR_.2|_IDGDKDGFVTVDELKDWIK_.4|_...

SEN / CTL

P09972

Fructose-bisphosphate aldolase C

ALDOC

1.21

0.67

0.00661

0.00512

fructose metabolic process,gluconeogenesis,fructos...

fructose-bisphosphate aldolase activity,protein bi...

mitochondrion,cytosol,cytoskeleton,extracellular e...

42

27

42

_VDKGVVPLAGTDGETTTQGLDGLSER_.3|_VDKGVVPLAGTDGETTTQ...

SEN / CTL

P02768

Serum albumin

ALB

1.2

2.62

0.00139

0.00166

retina homeostasis,platelet degranulation,transpor...

DNA binding,fatty acid binding,copper ion binding,...

extracellular region,extracellular space,nucleus,e...

232

107

232

_KVPQVSTPTLVEVSR_.3|_KVPQVSTPTLVEVSR_.2|_KVPQVSTPT...

SEN / CTL

P80723

Brain acid soluble protein 1

BASP1

1.19

1.74

0.0747

0.0236

thorax and anterior abdomen determination,gonad de...

transcription corepressor activity,protein binding...

nucleus,cytoplasm,cytoskeleton,plasma membrane,nuc...

41

28

41

_AQGPAASAEEPKPVEAPAANSDQTVTVKE_.3|_AQGPAASAEEPKPVE...

SEN / CTL

Q14114

Low-density lipoprotein receptor-related protein 8

LRP8

1.18

0.51

0.058

0.0204

negative regulation of transcription from RNA poly...

transmembrane signaling receptor activity,low-dens...

extracellular region,microtubule associated comple...

1

1

1

_AIAVDPLR_.2

SEN / CTL

Q8NBS9

Thioredoxin domain-containing protein 5

TXNDC5

1.17

1.64

0.00202

0.00209

protein folding,response to endoplasmic reticulum ...

protein disulfide isomerase activity,protein bindi...

endoplasmic reticulum,endoplasmic reticulum lumen,...

49

30

49

_GYPTLLLFR_.2|_GYPTLLWFR_.2|_IAEVDC[+57]TAER_.2|_A...

SEN / CTL

P07737

Profilin-1

PFN1

1.11

2

0.000904

0.00114

neural tube closure,positive regulation of epithel...

adenyl-nucleotide exchange factor activity,actin b...

nucleus,cytoplasm,cytosol,cytoskeleton,cell-cell a...

37

19

37

_C[+57]YEMASHLRR_.3|_TFVNITPAEVGVLVGKDR_.3|_TFVNIT...

SEN / CTL

P11279

Lysosome-associated membrane glycoprotein 1

LAMP1

1.11

1.84

0.109

0.0305

granzyme-mediated apoptotic signaling pathway,posi...

virus receptor activity,protein binding,enzyme bin...

cytoplasm,lysosome,lysosomal membrane,late endosom...

13

9

13

_VWVQAFK_.2|_TVESITDIR_.2|_ALQATVGNSYK_.2|_TVESITD...

SEN / CTL

P49257

Protein ERGIC-53

LMAN1

1.1

1.04

0.0487

0.0183

protein folding,ER to Golgi vesicle-mediated trans...

protein binding,mannose binding,metal ion binding,...

Golgi membrane,endoplasmic reticulum membrane,endo...

41

23

41

_KNNPAIVIIGNNGQIHYDHQNDGASQALASC[+57]QR_.5|_KNNPAI...

SEN / CTL

Q9H074

Polyadenylate-binding protein-interacting protein 1

PAIP1

1.1

0.54

0.0713

0.0228

nuclear-transcribed mRNA poly(A) tail shortening,t...

RNA binding,protein binding,translation activator ...

cytoplasm,cytosol

23

18

23

_IENVVLDANC[+57]SR_.2|_GKMDMEEIIQR_.3|_GKMDMEEIIQR...

SEN / CTL

Q9BXK5

Bcl-2-like protein 13

BCL2L13

1.09

0.98

0.192

0.0474

apoptotic process,activation of cysteine-type endo...

protein binding,cysteine-type endopeptidase activa...

nucleus,mitochondrion,integral component of membra...

24

18

24

_TEIEEELK_.2|_SLDSNGAGEK_.2|_ILVPLVLLR_.2|_SENNSSN...

SEN / CTL

P02751

Fibronectin

FN1

1.08

2.02

2.49e-15

2.98e-14

angiogenesis,regulation of protein phosphorylation...

protease binding,integrin binding,protein binding,...

extracellular region,fibrinogen complex,proteinace...

209

126

209

_YQC[+57]YC[+57]YGR_.2|_STTPDITGYR_.2|_WLPSSSPVTGY...

SEN / CTL

P60174

Triosephosphate isomerase

TPI1

1.08

2.28

1.16e-8

4.53e-8

gluconeogenesis,glycolytic process,pentose-phospha...

triose-phosphate isomerase activity,protein bindin...

extracellular space,nucleus,cytosol,extracellular ...

70

37

70

_IAVAAQNC[+57]YK_.2|_SNVSDAVAQSTR_.2|_SNVSDAVAQSTR...

SEN / CTL

Q9NUU7

Q9UHL0

ATP-dependent RNA helicase DDX19A;ATP-dependent RNA helicase DDX25

DDX19A

DDX25

1.08

1

0.201

0.0488

mRNA export from nucleus,biological_process,RNA se...

molecular_function,RNA binding,ATP-dependent RNA h...

nucleus,nuclear pore,cytoplasm,membrane,nuclear me...

1

1

1

_TAAFVLAM[+16]LSR_.2

SEN / CTL

P13645

Keratin, type I cytoskeletal 10

KRT10

1.06

2.61

0.000188

0.000307

keratinocyte differentiation

structural constituent of epidermis

extracellular space,nucleus,cytoplasm,intermediate...

104

55

104

_LAADDFR_.2|_LKYENEVALR_.3|_LKYENEVALR_.2|_SEITELR...

SEN / CTL

P35527

Keratin, type I cytoskeletal 9

KRT9

1.06

1.64

0.000724

0.000939

spermatogenesis,epidermis development,skin develop...

structural constituent of cytoskeleton

extracellular space,nucleus,intermediate filament,...

121

54

121

_TLLDIDNTR_.2|_QGVDADINGLR_.2|_MTLDDFR_.2|_M[+16]T...

SEN / CTL

P62258

14-3-3 protein epsilon

YWHAE

1.06

2.37

0.00833

0.00609

G2/M transition of mitotic cell cycle,neuron migra...

protein binding,potassium channel regulator activi...

mitochondrion,cytosol,kinesin complex,cell-cell ad...

102

36

102

_NLLSVAYKNVIGAR_.3|_NLLSVAYKNVIGAR_.2|_EAAENSLVAYK...

SEN / CTL

P16949

Stathmin

STMN1

1.04

2.88

0.184

0.046

mitotic cytokinesis,microtubule depolymerization,m...

signal transducer activity,protein binding,tubulin...

intracellular,cytoplasm,cytosol,microtubule,membra...

24

18

24

_ASGQAFELILSPR_.2|_ASGQAFELILSPR_.3|_DLSLEEIQK_.2|...

SEN / CTL

P12814

Alpha-actinin-1

ACTN1

1.01

1.85

0.0000785

0.000138

platelet degranulation,actin filament organization...

double-stranded RNA binding,integrin binding,calci...

stress fiber,ruffle,extracellular region,extracell...

187

90

187

_ILAGDKNYITMDELRR_.4|_HRPELIDYGK_.3|_HRPELIDYGK_.2...

SEN / CTL

P02774

Vitamin D-binding protein

GC

1.01

0.82

0.0291

0.014

vitamin D metabolic process,vitamin transport

actin binding,vitamin D binding,vitamin transporte...

extracellular region,extracellular space,cytosol,l...

77

46

77

_LC[+57]DNLSTK_.2|_HQPQEFPTYVEPTNDEIC[+57]EAFR_.3|...

SEN / CTL

P12109

Collagen alpha-1(VI) chain

COL6A1

0.99

1.71

3.95e-7

0.00000121

osteoblast differentiation,cell adhesion,extracell...

platelet-derived growth factor binding

extracellular region,collagen type VI trimer,extra...

69

49

69

_VFSVAITPDHLEPR_.3|_VFSVAITPDHLEPR_.2|_IALVITDGR_....

SEN / CTL

P67936

Tropomyosin alpha-4 chain

TPM4

0.98

1.66

0.00179

0.00195

osteoblast differentiation,movement of cell or sub...

calcium ion binding,protein binding,structural con...

stress fiber,podosome,cytosol,cytoskeleton,muscle ...

42

25

42

_KIQALQQQADEAEDRAQGLQR_.4|_KIQALQQQADEAEDRAQGLQR_....

SEN / CTL

Q13404

Q15819

Ubiquitin-conjugating enzyme E2 variant 1;Ubiquitin-conjugating enzyme E2 variant 2

UBE2V1

UBE2V2

0.98

0.85

0.182

0.0456

protein polyubiquitination,stimulatory C-type lect...

protein binding,ubiquitin protein ligase binding,u...

ubiquitin ligase complex,nucleus,cytoplasm,cytosol...

1

1

1

_WTGMIIGPPR_.2

SEN / CTL

P11387

DNA topoisomerase 1

TOP1

0.92

0.31

0.0357

0.0154

DNA replication,DNA topological change,chromatin r...

core promoter sequence-specific DNA binding,DNA bi...

cytoplasmic mRNA processing body,nucleus,nucleopla...

43

35

43

_LEEQLMK_.2|_RPRDEDDADYKPK_.4|_ITVAWC[+57]K_.2|_LN...

SEN / CTL

O95967

EGF-containing fibulin-like extracellular matrix protein 2

EFEMP2

0.88

0.09

0.00375

0.00334

extracellular matrix structural constituent,calciu...

extracellular region,basement membrane,extracellul...

6

6

6

_AGNSQGDFYIR_.2|_C[+57]INHYGGYLC[+57]LPR_.3|_C[+57...

SEN / CTL

Q07866

Kinesin light chain 1

KLC1

0.88

0.67

0.151

0.0398

retrograde vesicle-mediated transport, Golgi to ER...

motor activity,microtubule motor activity,protein ...

cytosol,kinesin complex,microtubule,membrane,growt...

120

59

120

_QGKFEAAETLEEAAM[+16]R_.3|_QGKFEAAETLEEAAMR_.3|_QG...

SEN / CTL

O76061

Stanniocalcin-2

STC2

0.83

0.56

0.124

0.0337

cellular calcium ion homeostasis,response to oxida...

hormone activity,enzyme binding,heme binding,prote...

extracellular space,endoplasmic reticulum,Golgi ap...

2

2

2

_VIVEMIHFK_.2|_HDLC[+57]AAAQENTR_.2

SEN / CTL

P10643

Complement component C7

C7

0.8

0.39

0.0693

0.0224

cellular sodium ion homeostasis,complement activat...

extracellular region,membrane attack complex,extra...

52

37

52

_LIDQYGTHYLQSGSLGGEYR_.3|_LIDQYGTHYLQSGSLGGEYR_.4|...

SEN / CTL

P62158

Calmodulin

CALM1

0.79

1.04

0.00511

0.00423

G2/M transition of mitotic cell cycle,MAPK cascade...

Ras guanyl-nucleotide exchange factor activity,cal...

spindle pole,extracellular region,nucleus,nucleopl...

30

13

30

_VFDKDGNGYISAAELR_.3|_VFDKDGNGYISAAELR_.2|_DGNGYIS...

SEN / CTL

P21810

Biglycan

BGN

0.78

1.77

0.108

0.0303

blood vessel remodeling,negative regulation of pro...

protein kinase inhibitor activity,extracellular ma...

extracellular region,proteinaceous extracellular m...

37

23

37

_VVQC[+57]SDLGLK_.2|_VPSGLPDLK_.2|_LAIQFGNYK_.2|_I...

SEN / CTL

P06396

Gelsolin

GSN

0.77

1.83

0.0372

0.0157

phagocytosis, engulfment,positive regulation of ge...

actin binding,calcium ion binding,protein binding,...

podosome,extracellular region,extracellular space,...

102

53

102

_HVVPNEVVVQR_.3|_HVVPNEVVVQR_.2|_TASDFITK_.2|_AGKE...

SEN / CTL

P02538

Keratin, type II cytoskeletal 6A

KRT6A

0.77

1.88

0.0574

0.0203

morphogenesis of an epithelium,cytoskeleton organi...

structural constituent of cytoskeleton,protein bin...

nucleus,membrane,keratin filament,extracellular ex...

85

61

85

_AQYEEIAQR_.2|_LLEGEEC[+57]R_.2|_FLEQQNKVLETK_.2|_...

SEN / CTL

P04264

Keratin, type II cytoskeletal 1

KRT1

0.75

1.98

0.0000376

0.0000733

complement activation, lectin pathway,retina homeo...

receptor activity,structural molecule activity,pro...

extracellular space,nucleus,cytoskeleton,plasma me...

118

66

118

_SISISVAR_.2|_SLVNLGGSK_.2|_AQYEDIAQK_.2|_SLNNQFAS...

SEN / CTL

P01023

Alpha-2-macroglobulin

A2M

0.69

1.61

0.168

0.0433

negative regulation of complement activation, lect...

protease binding,serine-type endopeptidase inhibit...

extracellular region,cytosol,platelet alpha granul...

144

89

144

_QTVSWAVTPK_.2|_ATVLNYLPK_.2|_MVSGFIPLKPTVK_.3|_M[...

SEN / CTL

P30086

Phosphatidylethanolamine-binding protein 1

PEBP1

0.68

2.11

0.188

0.0466

MAPK cascade,negative regulation of endopeptidase ...

serine-type endopeptidase inhibitor activity,prote...

nucleus,cytosol,extracellular exosome

48

25

48

_VLTPTQVK_.2|_YVWLVYEQDRPLKC[+57]DEPILSNR_.4|_YVWL...

SEN / CTL

O00391

Sulfhydryl oxidase 1

QSOX1

0.61

1.6

0.00343

0.00319

platelet degranulation,negative regulation of macr...

protein disulfide isomerase activity,flavin-linked...

extracellular region,extracellular space,Golgi app...

29

23

29

_SFYTAYLQR_.2|_VLNTEANVVR_.2|_VPVLMESR_.2|_KFGVTDF...

SEN / CTL

Q15293

Reticulocalbin-1

RCN1

0.6

1.18

0.165

0.0428

in utero embryonic development,camera-type eye dev...

calcium ion binding,protein binding

endoplasmic reticulum,endoplasmic reticulum lumen

48

29

48

_YIFDNVAK_.2|_HWILPQDYDHAQAEAR_.4|_HWILPQDYDHAQAEA...

SEN / CTL

P31949

Protein S100-A11

S100A11

0.56

1.75

0.191

0.0473

signal transduction,negative regulation of DNA rep...

calcium ion binding,protein binding,protein homodi...

ruffle,extracellular space,nucleus,cytoplasm,cell-...

13

8

13

_ISSPTETER_.2|_YAGKDGYNYTLSK_.3|_YAGKDGYNYTLSK_.2|...

SEN / CTL

Q01995

Transgelin

TAGLN

0.52

1.49

0.0847

0.0256

muscle organ development,epithelial cell different...

actin binding,protein binding

cytoplasm

41

24

41

_QMEQVAQFLK_.2|_QM[+16]EQVAQFLK_.2|_AAEDYGVIK_.2|_...

SEN / CTL

Q14103

Heterogeneous nuclear ribonucleoprotein D0

HNRNPD

0.51

0.83

0.195

0.0477

mRNA splicing, via spliceosome,telomere maintenanc...

nucleotide binding,AT DNA binding,chromatin bindin...

nucleus,nucleoplasm,cytosol,intracellular ribonucl...

51

25

51

_KIFVGGLSPDTPEEK_.3|_KIFVGGLSPDTPEEK_.2|_IFVGGLSPD...

SEN / CTL

P09871

Complement C1s subcomponent

C1S

0.5

1.75

0.0369

0.0157

complement activation, lectin pathway,proteolysis,...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular exosome,blood m...

38

26

38

_LLEVPEGR_.2|_TNFDNDIALVR_.2|_YHGDPMPC[+57]PKEDTPN...

SEN / CTL

P12111

Collagen alpha-3(VI) chain

COL6A3

0.48

1.94

0.000149

0.00025

cell adhesion,muscle organ development,negative re...

serine-type endopeptidase inhibitor activity

extracellular region,proteinaceous extracellular m...

233

165

233

_YIAYLVR_.2|_GMTQLQGTR_.2|_ALILVGLER_.2|_ALGSAIEYT...

SEN / CTL

P05155

Plasma protease C1 inhibitor

SERPING1

0.48

1.9

0.119

0.0326

negative regulation of complement activation, lect...

serine-type endopeptidase inhibitor activity,prote...

extracellular region,extracellular space,platelet ...

34

19

34

_TLYSSSPR_.2|_FQPTLLTLPR_.2|_LLDSLPSDTR_.2|_LVLLNA...

SEN / CTL

P07942

Laminin subunit beta-1

LAMB1

0.46

1.62

0.0244

0.0126

cell adhesion,neuronal-glial interaction involved ...

structural molecule activity,extracellular matrix ...

extracellular region,basement membrane,laminin-1 c...

100

76

100

_YVVLPRPVC[+57]FEK_.3|_ISGVIGPYRETVDSVER_.3|_QYIQD...

SEN / CTL

P06744

Glucose-6-phosphate isomerase

GPI

0.45

1.55

0.0573

0.0203

angiogenesis,in utero embryonic development,mesode...

glucose-6-phosphate isomerase activity,cytokine ac...

extracellular space,nucleoplasm,cytoplasm,cytosol,...

107

49

107

_AVLHVALR_.2|_TLAQLNPESSLFIIASK_.2|_TLAQLNPESSLFII...

SEN / CTL

P35555

Fibrillin-1

FBN1

0.36

1.34

0.2

0.0488

skeletal system development,metanephros developmen...

integrin binding,hormone activity,extracellular ma...

microfibril,extracellular region,proteinaceous ext...

32

32

32

_TLPGGNQC[+57]IVPIC[+57]R_.2|_GYILQEDGR_.2|_YNAYC[...

SEN / CTL

Q2NL82

Pre-rRNA-processing protein TSR1 homolog

TSR1

-0.3

0.25

0.18

0.0455

maturation of SSU-rRNA from tricistronic rRNA tran...

GTPase activity,GTP binding,U3 snoRNA binding,poly...

nucleoplasm,nucleolus,cytosol,preribosome, small s...

35

26

35

_IFQFQNFTNTR_.2|_DGPPHQVLVVPLHSR_.4|_DGPPHQVLVVPLH...

SEN / CTL

P02788

Lactotransferrin

LTF

-0.6

0.64

0.0702

0.0226

ossification,regulation of cytokine production,ret...

DNA binding,serine-type endopeptidase activity,iro...

extracellular region,extracellular space,nucleus,c...

117

76

117

_YYGYTGAFR_.2|_C[+57]GLVPVLAENYK_.2|_KPVDKFKDC[+57...

SEN / CTL

P51884

Lumican

LUM

-0.7

1.9

0.00276

0.00272

visual perception,response to organic cyclic compo...

extracellular matrix structural constituent,protei...

extracellular region,proteinaceous extracellular m...

29

21

29

_ILGPLSYSK_.2|_SVPMVPPGIK_.2|_FNALQYLR_.2|_SLEYLDL...

SEN / CTL

Q9H2G2

STE20-like serine/threonine-protein kinase

SLK

-0.7

1.03

0.158

0.0415

apoptotic process,signal transduction by protein p...

protein serine/threonine kinase activity,receptor ...

cytoplasm,cell-cell adherens junction,cell leading...

70

57

70

_FIVDGVEVSVTTSK_.2|_KLQEQEVFFK_.2|_QQQELDGSLKK_.3|...

SEN / CTL

P32320

Cytidine deaminase

CDA

-0.92

0.84

0.198

0.0483

cell surface receptor signaling pathway,pyrimidine...

nucleoside binding,cytidine deaminase activity,pro...

extracellular region,cytosol

12

8

12

_RPAC[+57]TLKPEC[+57]VQQLLVC[+57]SQEAK_.3|_RPAC[+5...

SEN / CTL

P04217

Alpha-1B-glycoprotein

A1BG

-0.96

0.86

0.19

0.0471

platelet degranulation,biological_process

molecular_function

extracellular region,extracellular space,platelet ...

40

21

40

_GVTFLLR_.2|_RGEKELLVPR_.3|_LELHVDGPPPR_.3|_LELHVD...

SEN / CTL

P05997

Collagen alpha-2(V) chain

COL5A2

-1.04

1.22

0.0129

0.00837

skeletal system development,ossification,extracell...

molecular_function,extracellular matrix structural...

extracellular region,collagen type V trimer,extrac...

15

14

15

_GSQFAYGDHQSPNTAITQMTFLR_.3|_NSVGYMDDQAK_.2|_YIVLQ...

SEN / CTL

P07585

Decorin

DCN

-1.14

2.18

0.000463

0.000661

kidney development,placenta development,negative r...

protein kinase inhibitor activity,protein binding,...

extracellular region,collagen type VI trimer,extra...

33

22

33

_VSPGAFTPLVKLER_.3|_VSPGAFTPLVK_.2|_KASYSGVSLFSNPV...

SEN / CTL

P09486

SPARC

SPARC

-1.17

1.69

0.0000575

0.000106

ossification,negative regulation of endothelial ce...

calcium ion binding,protein binding,collagen bindi...

extracellular region,basement membrane,extracellul...

22

14

22

_YIPPC[+57]LDSELTEFPLR_.2|_YIPPC[+57]LDSELTEFPLR_....

SEN / CTL

P08123

Collagen alpha-2(I) chain

COL1A2

-1.31

2.08

2.28e-9

1.18e-8

skeletal system development,blood vessel developme...

extracellular matrix structural constituent,protei...

extracellular region,collagen type I trimer,extrac...

57

44

57

_EMATQLAFMR_.2|_SLNNQIETLLTPEGSR_.3|_SLNNQIETLLTPE...

SEN / CTL

Q9UK76

Hematological and neurological expressed 1 protein

HN1

-1.31

1.13

0.183

0.0459

nucleus,nucleolus,nuclear membrane

18

9

18

_SSGGREDLESSGLQR_.3|_SSGGREDLESSGLQR_.2|_VLRPPGGGS...

SEN / CTL

Q6ICG6

Uncharacterized protein KIAA0930

KIAA0930

-1.46

1.16

0.162

0.0422

37

25

37

_SQQVFASPSKHPMDSK_.4|_SQQVFASPSKHPMDSK_.2|_KLAYSGS...

SEN / CTL

Q32MQ0

Zinc finger protein 750

ZNF750

-1.49

0.8

0.0831

0.0253

transcription from RNA polymerase II promoter,epid...

core promoter sequence-specific DNA binding,transc...

nucleus,nucleolus,intracellular membrane-bounded o...

1

1

1

_EDIKENLELQAR_.3

SEN / CTL

Q9BZZ5

Apoptosis inhibitor 5

API5

-1.49

0.83

0.0899

0.0267

apoptotic process,negative regulation of apoptotic...

protein binding,fibroblast growth factor binding,p...

nucleus,nucleoplasm,spliceosomal complex,cytoplasm...

42

33

42

_NYGILADATEQVGQHK_.2|_NYGILADATEQVGQHK_.3|_DLFHIPP...

SEN / CTL

P13473

Lysosome-associated membrane glycoprotein 2

LAMP2

-1.54

0.71

0.0646

0.0216

platelet degranulation,protein import,regulation o...

protein binding,enzyme binding,protein domain spec...

extracellular space,lysosome,lysosomal membrane,la...

7

5

7

_IPLNDLFR_.2|_C[+57]NSLSTLEK_.2|_YLDFVFAVK_.2|_YLD...

SEN / CTL

P10644

cAMP-dependent protein kinase type I-alpha regulatory subunit

PRKAR1A

-1.54

0.91

0.101

0.0288

mesoderm formation,renal water homeostasis,regulat...

cAMP-dependent protein kinase inhibitor activity,p...

cytoplasm,cytosol,cAMP-dependent protein kinase co...

40

28

40

_SENEEFVEVGR_.2|_VLGPC[+57]SDILKR_.3|_VLGPC[+57]SD...

SEN / CTL

P62829

60S ribosomal protein L23

RPL23

-1.58

1.39

0.188

0.0466

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,protein binding...

nucleolus,cytoplasm,cytosol,ribosome,focal adhesio...

27

14

27

_EC[+57]ADLWPR_.2|_IASNAGSIA_.2|_GSAITGPVAK_.2|_NL...

SEN / CTL

P55083

Microfibril-associated glycoprotein 4

MFAP4

-1.59

2.61

0.0192

0.0109

cell adhesion,UV protection,regulation of collagen...

molecular_function,protein binding

microfibril,extracellular region,extracellular spa...

9

4

9

_GFYYSLK_.2|_FSTFDRDQDLFVQNC[+57]AALSSGAFWFR_.3|_F...

SEN / CTL

P27824

Calnexin

CANX

-1.6

1.18

0.143

0.038

antigen processing and presentation of peptide ant...

glycoprotein binding,calcium ion binding,protein b...

endoplasmic reticulum,endoplasmic reticulum lumen,...

93

59

93

_TDAPQPDVK_.2|_LNKPFLFDTK_.3|_LNKPFLFDTK_.2|_RPDAD...

SEN / CTL

Q96EL3

39S ribosomal protein L53, mitochondrial

MRPL53

-1.65

1.06

0.115

0.0316

mitochondrial translational elongation,mitochondri...

protein binding

mitochondrial inner membrane,mitochondrial large r...

16

8

16

_HDGSEPC[+57]VDVLFGDGHR_.4|_HDGSEPC[+57]VDVLFGDGHR...

SEN / CTL

P02765

Alpha-2-HS-glycoprotein

AHSG

-1.79

2.67

0.0408

0.0166

skeletal system development,ossification,platelet ...

endopeptidase inhibitor activity,cysteine-type end...

extracellular region,extracellular space,extracell...

28

15

28

_C[+57]DSSPDSAEDVR_.2|_C[+57]DSSPDSAEDVRK_.3|_C[+5...

SEN / CTL

Q9P2B4

CTTNBP2 N-terminal-like protein

CTTNBP2NL

-1.81

0.49

0.0232

0.0122

protein dephosphorylation,negative regulation of t...

protein binding,protein phosphatase 2A binding

cytoplasm,actin cytoskeleton

27

25

27

_NLANTANPR_.2|_KLSSQLEEER_.3|_KLSSQLEEER_.2|_NTVTQ...

SEN / CTL

Q15019

Septin-2

2-Sep

-1.91

0.95

0.0737

0.0234

regulation of L-glutamate transport,mitotic nuclea...

protein binding,GTP binding,enzyme regulator activ...

exocyst,condensed chromosome kinetochore,nucleus,n...

53

30

53

_DQILLEK_.2|_YLHDESGLNR_.3|_YLHDESGLNR_.2|_MQEMIAR...

SEN / CTL

Q14204

Cytoplasmic dynein 1 heavy chain 1

DYNC1H1

-1.97

0.21

0.00372

0.00334

G2/M transition of mitotic cell cycle,ER to Golgi ...

microtubule motor activity,protein binding,ATP bin...

centrosome,cytosol,cytoplasmic dynein complex,micr...

531

337

531

_NLESALR_.2|_AERPDVDEKR_.3|_IKETVDQVEELRR_.4|_IKET...

SEN / CTL

P02461

Collagen alpha-1(III) chain

COL3A1

-1.99

1.33

3.74e-12

2.63e-11

skeletal system development,cell-matrix adhesion,t...

integrin binding,extracellular matrix structural c...

extracellular region,collagen type III trimer,extr...

27

25

27

_NSIAYMDQASGNVKK_.3|_NSIAYMDQASGNVKK_.2|_LMGSNEGEF...

SEN / CTL

Q9C0D5

Protein TANC1

TANC1

-1.99

0.52

0.0216

0.0118

myoblast fusion,visual learning,dendritic spine ma...

postsynaptic density,cell junction,dendrite,neuron...

50

45

50

_LSLDDFPDNK_.2|_TSQHLGSGQSAVR_.3|_TSQHLGSGQSAVR_.2...

SEN / CTL

P55884

Eukaryotic translation initiation factor 3 subunit B

EIF3B

-2.13

0.87

0.0517

0.019

translational initiation,regulation of translation...

nucleotide binding,RNA binding,translation initiat...

nucleoplasm,cytoplasm,cytosol,eukaryotic translati...

83

51

83

_VTLM[+16]QLPTR_.2|_VTLMQLPTR_.2|_GFHC[+57]ESSAHWP...

SEN / CTL

Q9Y224

UPF0568 protein C14orf166

C14orf166

-2.34

0.64

0.0238

0.0124

transcription, DNA-templated,tRNA splicing, via en...

RNA polymerase II core binding,RNA binding,protein...

nucleus,nucleoplasm,cytoplasm,microtubule organizi...

36

22

36

_DVNC[+57]PFK_.2|_LTQDAVAK_.2|_YLRDVNC[+57]PFK_.3|...

SEN / CTL

O43474

Krueppel-like factor 4

KLF4

-2.34

1.35

0.0947

0.0275

negative regulation of transcription from RNA poly...

core promoter proximal region sequence-specific DN...

nuclear chromatin,nucleoplasm,nuclear euchromatin,...

2

2

2

_GSPDGSHPVVVAPYNGGPPR_.3|_ASLSAPGSEYGSPSVISVSK_.2

SEN / CTL

P02452

Collagen alpha-1(I) chain

COL1A1

-2.51

1.9

5.15e-22

1.48e-20

skeletal system development,blood vessel developme...

extracellular matrix structural constituent,protei...

extracellular region,collagen type I trimer,extrac...

55

47

55

_YHDRDVWKPEPC[+57]R_.4|_NSVAYMDQQTGNLKK_.3|_NSVAYM...

SEN / CTL

P31151

Q86SG5

Protein S100-A7;Protein S100-A7A

S100A7

S100A7A

-2.55

1.09

0.0554

0.0199

response to reactive oxygen species,angiogenesis,e...

calcium ion binding,protein binding,zinc ion bindi...

extracellular region,nucleus,cytoplasm,endoplasmic...

1

1

1

_SIIGMIDMFHK_.3

SEN / CTL

Q9NXG2

THUMP domain-containing protein 1

THUMPD1

-2.57

0.09

0.000433

0.000637

rRNA modification,tRNA modification

RNA binding,protein binding,poly(A) RNA binding

nucleoplasm

30

23

30

_TLGIEPEK_.2|_DPSQLNSK_.2|_APNKGTFQIVYK_.3|_LVHHIL...

SEN / CTL

P07478

P35030

Q8NHM4

Trypsin-2;Trypsin-3;Putative trypsin-6

PRSS2

PRSS3

PRSS3P2

-2.92

1.06

0.0415

0.0167

proteolysis,digestion,extracellular matrix disasse...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular space,extracell...

1

1

1

_VYNYVDWIK_.2

SEN / CTL

P08294

Extracellular superoxide dismutase [Cu-Zn]

SOD3

-2.96

0.9

0.0297

0.0141

response to reactive oxygen species,response to hy...

superoxide dismutase activity,copper ion binding,p...

extracellular region,extracellular space,nucleus,c...

14

10

14

_VTGVVLFR_.2|_AVVVHAGEDDLGR_.3|_AGLAASLAGPHSIVGR_....

SEN / CTL

Q9BY89

Uncharacterized protein KIAA1671

KIAA1671

-3.09

1.17

0.00133

0.00161

33

30

33

_RPEVDSPGETPSWAPQPK_.3|_VADGEAAAGGEWASR_.2|_VHSEAI...

SEN / CTL

P04818

Thymidylate synthase

TYMS

-3.26

1.89

0.096

0.0278

G1/S transition of mitotic cell cycle,regulation o...

nucleotide binding,mRNA binding,thymidylate syntha...

nucleus,nucleoplasm,nucleolus,cytoplasm,mitochondr...

33

19

33

_HFGAEYR_.2|_PVAGSELPR_.2|_IDDFKAEDFQIEGYNPHPTIK_....

SEN / CTL

P13984

General transcription factor IIF subunit 2

GTF2F2

-3.34

1.54

0.0643

0.0216

mRNA splicing, via spliceosome,transcription from ...

transcription factor activity, core RNA polymerase...

nucleus,nucleoplasm,transcription factor TFIIF com...

26

21

26

_PVANHQYNIEYERK_.4|_LQIEESSKPVR_.3|_NTWELKPEYR_.3|...

SEN / CTL

P80217

Interferon-induced 35 kDa protein

IFI35

-3.44

1.07

0.0305

0.0143

type I interferon signaling pathway

protein binding

nucleus,cytosol

15

12

15

_EHTINMEEC[+57]R_.3|_GHTQQDPEVPK_.3|_NGGGDVDVR_.2|...