Post-radiation SASP in renal epithelial cells (day 10)

[raw]
































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































Comparison

UniProtIds

Protein Description

Genes

Log2 Ratio

Std. Dev.

PValue

QValue

GO Biological Process

GO Molecular Process

GO Cellular Process

Ratios

Unique Peptides

Elution Groups

Elution Group

SEN / CTL

P54886

Delta-1-pyrroline-5-carboxylate synthase

ALDH18A1

2.91

1.06

0.0417

0.0171

glutamate metabolic process,proline biosynthetic p…

glutamate 5-kinase activity,glutamate-5-semialdehy…

cytoplasm,mitochondrion,mitochondrial inner membra…

3

48

83

MIDLIIPR.2|M[Oxi]IDLIIPR.2|LGSAVVTR.2|QALHSGQNQLK….

SEN / CTL

P42771


P42772

Cyclin-dependent kinase inhibitor 2A;Cyclin-dependent kinase 4 inhibitor B

CDKN2A


CDKN2B

2.74

0.54

0.0134

0.00676

G1/S transition of mitotic cell cycle,negative reg…

cyclin-dependent protein serine/threonine kinase i…

nucleus,cytoplasm,cytosol,senescence-associated he…

3

1

2

EGFLDTLVVLHR.3|EGFLDTLVVLHR.2

SEN / CTL

Q969X5

Endoplasmic reticulum-Golgi intermediate compartment protein 1

ERGIC1

2.67

0.95

0.00163

0.00116

ER to Golgi vesicle-mediated transport

protein binding

Golgi membrane,endoplasmic reticulum membrane,endo…

6

14

19

IIPAIWFR.2|LTSNPLASHDYILK.3|LTSNPLASHDYILK.2|IVPTV…

SEN / CTL

Q9Y277

Voltage-dependent anion-selective channel protein 3

VDAC3

2.2

0.99

0.0567

0.0224

anion transport,adenine transport,transmembrane tr…

nucleotide binding,voltage-gated anion channel act…

nucleus,mitochondrion,mitochondrial outer membrane…

3

18

27

LTLSALIDGK.2|ASGNLETK.2|LSQNNFALGYK.3|LSQNNFALGYK….

SEN / CTL

Q13045

Protein flightless-1 homolog

FLII

2.08

0.4

4.87e-7

8.71e-7

transcription, DNA-templated,regulation of transcr…

actin binding,protein binding

nucleoplasm,cytoplasm,microtubule organizing cente…

9

58

77

ADLTALFLPR.2|FVFLLDR.2|GLDIYVWR.2|AC[CAM]SAIHAVNLR…

SEN / CTL

O94826

Mitochondrial import receptor subunit TOM70

TOMM70A

2.08

1.1

0.0774

0.0289

protein targeting to mitochondrion,macroautophagy,…

protein binding,protein transmembrane transporter …

mitochondrion,mitochondrial outer membrane,mitocho…

3

29

43

ILLDQVEEAVADFDEC[CAM]IR.3|ILLDQVEEAVADFDEC[CAM]IR….

SEN / CTL

P21796

Voltage-dependent anion-selective channel protein 1

VDAC1

2.01

1.02

9.46e-18

7.98e-17

behavioral fear response,anion transport,mitochond…

protein binding,voltage-gated anion channel activi…

nucleus,mitochondrion,mitochondrial outer membrane…

48

31

53

LTLSALLDGK.2|YQIDPDAC[CAM]FSAK.2|YQIDPDAC[CAM]FSAK…

SEN / CTL

Q99988

Growth/differentiation factor 15

GDF15

1.96

0.87

0.00000167

0.00000264

signal transduction,transforming growth factor bet…

cytokine activity,transforming growth factor beta …

extracellular region,extracellular space,nucleus,c…

12

7

7

ASLEDLGWADWVLSPR.2|LKPDTVPAPC[CAM]C[CAM]VPASYNPMVL…

SEN / CTL

P07203

Glutathione peroxidase 1

GPX1

1.89

1.18

0.00659

0.00383

response to reactive oxygen species,temperature ho…

glutathione peroxidase activity,SH3 domain binding

cytoplasm,mitochondrion,mitochondrial matrix,cytos…

6

17

27

FLVGPDGVPLRR.3|YVRPGGGFEPNFMLFEK.3|YVRPGGGFEPNFM[O…

SEN / CTL

P48735

Isocitrate dehydrogenase [NADP], mitochondrial

IDH2

1.86

1.17

7.05e-9

1.88e-8

carbohydrate metabolic process,glyoxylate cycle,tr…

magnesium ion binding,isocitrate dehydrogenase (NA…

mitochondrion,mitochondrial inner membrane,mitocho…

27

38

63

IIWQFIK.2|VC[CAM]VETVESGAMTK.2|VC[CAM]VETVESGAM[Ox…

SEN / CTL

Q6DD88

Atlastin-3

ATL3

1.83

0.87

0.0627

0.0243

endoplasmic reticulum organization,Golgi organizat…

GTPase activity,protein binding,GTP binding,identi…

endoplasmic reticulum,endoplasmic reticulum membra…

3

31

45

GLLEYFK.2|DQHSFELDEK.3|DQHSFELDEK.2|IYQGEDLPHPK.3|…

SEN / CTL

Q9HCB6

Spondin-1

SPON1

1.72

0.71

3.72e-12

1.73e-11

cell adhesion,protein O-linked fucosylation

metal ion binding

proteinaceous extracellular matrix,extracellular s…

27

12

13

AQWPAWQPLNVR.2|AAPSAEFSVDR.2|VTLSAAPPSYFR.2|GFTLIA…

SEN / CTL

Q92882

Osteoclast-stimulating factor 1

OSTF1

1.7

1.26

0.124

0.0422

ossification,signal transduction

protein binding,SH3 domain binding

intracellular,cytoplasm,extracellular exosome

3

13

23

GYADIVQLLLAK.2|GYADIVQLLLAK.3|AGSTALYWAC[CAM]HGGHK…

SEN / CTL

Q9BPX5

Actin-related protein 2/3 complex subunit 5-like protein

ARPC5L

1.62

0.46

0.0233

0.0108

biological_process,Arp2/3 complex-mediated actin n…

molecular_function,actin binding

cytoplasm,Arp2/3 protein complex,focal adhesion,ex…

3

10

13

ALAVGGLGSIIR.2|RVDIDEFDENK.3|RVDIDEFDENK.2|GFEKPTE…

SEN / CTL

Q93050

V-type proton ATPase 116 kDa subunit a isoform 1

ATP6V0A1

1.58

0.66

0.069

0.0262

vacuolar acidification,insulin receptor signaling …

protein binding,proton-transporting ATPase activit…

vacuolar proton-transporting V-type ATPase, V0 dom…

3

20

24

LGFVAGVINR.2|RGTEHSGSTVPSILNR.4|FLPFSFEHIR.3|LGFVA…

SEN / CTL

P10909

Clusterin

CLU

1.57

0.9

2.98e-15

1.79e-14

cell morphogenesis,microglial cell activation,rele…

protein binding,ubiquitin protein ligase binding,c…

extracellular region,extracellular space,nucleus,c…

48

25

42

LFDSDPITVTVPVEVSR.2|LFDSDPITVTVPVEVSR.3|ASSIIDELFQ…

SEN / CTL

P08134

Rho-related GTP-binding protein RhoC

RHOC

1.57

0.34

0.000113

0.000112

cytokinesis,small GTPase mediated signal transduct…

signal transducer activity,protein binding,GTP bin…

cytosol,plasma membrane,cleavage furrow,extracellu…

6

5

7

ISAFGYLEC[CAM]SAK.2|ISAFGYLEC[CAM]SAK.3|EGVREVFEMA…

SEN / CTL

P45880

Voltage-dependent anion-selective channel protein 2

VDAC2

1.55

1.15

0.00054

0.000445

anion transport,negative regulation of protein pol…

nucleotide binding,voltage-gated anion channel act…

nucleus,mitochondrion,mitochondrial outer membrane…

18

21

28

YQLDPTASISAK.2|LTLSALVDGK.2|VNNSSLIGVGYTQTLRPGVK.3…

SEN / CTL

Q9P2J5

Leucine–tRNA ligase, cytoplasmic

LARS

1.51

0.33

0.0109

0.00572

tRNA aminoacylation for protein translation,leucyl…

aminoacyl-tRNA editing activity,leucine-tRNA ligas…

nucleus,cytoplasm,cytosol

3

78

124

WQFLTLR.2|KHFEANNGKLPDNK.4|LHLGHTFSLSK.3|LHLGHTFSL…

SEN / CTL

P11310

Medium-chain specific acyl-CoA dehydrogenase, mitochondrial

ACADM

1.47

0.43

0.0299

0.0132

fatty acid beta-oxidation,carnitine metabolic proc…

fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti…

nucleus,mitochondrion,mitochondrial matrix,axon,ex…

3

33

52

ANWYFLLAR.2|GIVFEDVKVPK.3|GIVFEDVKVPK.2|ELNMGQR.2|…

SEN / CTL

P14678


P63162

Small nuclear ribonucleoprotein-associated proteins B and B’;Small nuclear ribonucleoprotein-associated protein N

SNRPB


SNRPN

1.46

0.88

0.0873

0.0321

spliceosomal snRNP assembly,mRNA splicing, via spl…

protein binding,U2 snRNA binding,poly(A) RNA bindi…

nucleoplasm,spliceosomal complex,U5 snRNP,U7 snRNP…

3

1

1

VLGLVLLR.2

SEN / CTL

O95379

Tumor necrosis factor alpha-induced protein 8

TNFAIP8

1.45

0.2

0.00839

0.00465

apoptotic process,negative regulation of apoptotic…

protein binding,cysteine-type endopeptidase inhibi…

cytoplasm

3

6

10

SIATTLIDDTSSEVLDELYR.3|SIATTLIDDTSSEVLDELYR.2|EVAT…

SEN / CTL

P69905

Hemoglobin subunit alpha

HBA1

1.44

1.22

0.000519

0.000431

receptor-mediated endocytosis,positive regulation …

oxygen transporter activity,iron ion binding,prote…

extracellular region,cytosol,hemoglobin complex,me…

12

23

78

VGAHAGEYGAEALER.3|VGAHAGEYGAEALER.2|MFLSFPTTK.2|M[…

SEN / CTL

P06732

Creatine kinase M-type

CKM

1.43

0.29

0.0135

0.0068

creatine metabolic process,phosphorylation,phospho…

creatine kinase activity,protein binding,ATP bindi…

cytosol

3

5

6

GGDDLDPNYVLSSR.2|LGSSEVEQVQLVVDGVK.3|GQSIDDMIPAQK….

SEN / CTL

P17096

High mobility group protein HMG-I/HMG-Y

HMGA1

1.4

1.14

0.00953

0.00512

DNA unwinding involved in DNA replication,nucleoso…

transcriptional activator activity, RNA polymerase…

nucleus,nucleoplasm,transcription factor complex,c…

12

9

13

KLEKEEEEGISQESSEEEQ.3|KQPPVSPGTALVGSQKEPSEVPTPK.4|…

SEN / CTL

P21980

Protein-glutamine gamma-glutamyltransferase 2

TGM2

1.38

0.93

1e-20

1.23e-19

blood vessel remodeling,isopeptide cross-linking v…

protein-glutamine gamma-glutamyltransferase activi…

mitochondrion,endoplasmic reticulum,cytosol,focal …

90

46

73

SVPLC[CAM]ILYEK.2|RGQPFWLTLHFEGR.3|RGQPFWLTLHFEGR….

SEN / CTL

Q9H4B7

Tubulin beta-1 chain

TUBB1

1.37

0.46

0.036

0.0152

spindle assembly

GTPase activity,structural constituent of cytoskel…

cytoplasm,microtubule,extracellular exosome

3

21

38

NSSC[CAM]FVEWIPNNVK.2|NSSC[CAM]FVEWIPNNVK.3|IMNSFS…

SEN / CTL

Q13885

Tubulin beta-2A chain

TUBB2A

1.32

0.77

2.85e-15

1.75e-14

cytoskeleton organization,microtubule-based proces…

GTPase activity,structural constituent of cytoskel…

nucleus,cytoplasm,microtubule,extracellular exosom…

54

12

25

YLTVAAIFR.2|ESESC[CAM]DC[CAM]LQGFQLTHSLGGGTGSGMGTL…

SEN / CTL

P68104

Elongation factor 1-alpha 1

EEF1A1

1.31

0.72

2.02e-38

7.81e-37

transcription, DNA-templated,regulation of transcr…

tRNA binding,translation elongation factor activit…

extracellular space,nucleus,nucleolus,cytoplasm,cy…

132

52

144

EHALLAYTLGVK.3|EHALLAYTLGVK.2|IGGIGTVPVGR.2|YYVTII…

SEN / CTL

Q9NQH7

Probable Xaa-Pro aminopeptidase 3

XPNPEP3

1.31

1.6

0.106

0.0373

glomerular filtration,protein processing

aminopeptidase activity,metallopeptidase activity,…

mitochondrion,extracellular exosome

3

10

14

AILFVPR.2|GVQQLIQR.2|YC[CAM]PHHVGHYLGMDVHDTPDMPR.5…

SEN / CTL

Q71U36

Tubulin alpha-1A chain

TUBA1A

1.3

0.6

2.73e-49

1.84e-47

G2/M transition of mitotic cell cycle,cytoskeleton…

GTPase activity,structural molecule activity,struc…

nucleus,cytosol,microtubule,cytoplasmic microtubul…

135

45

112

AVFVDLEPTVIDEVR.2|AVFVDLEPTVIDEVR.3|LIGQIVSSITASLR…

SEN / CTL

P68371

Tubulin beta-4B chain

TUBB4B

1.28

0.7

4.16e-55

5.61e-53

G2/M transition of mitotic cell cycle,movement of …

double-stranded RNA binding,GTPase activity,struct…

nucleus,cytosol,cytoskeleton,microtubule,extracell…

201

42

123

YLTVAAVFR.2|NSSYFVEWIPNNVK.2|NSSYFVEWIPNNVK.3|SGPF…

SEN / CTL

P14618

Pyruvate kinase PKM

PKM

1.27

0.99

2.89e-39

1.3e-37

programmed cell death,canonical glycolysis,cell-ce…

magnesium ion binding,pyruvate kinase activity,pro…

nucleus,cytoplasm,mitochondrion,cytosol,plasma mem…

246

71

161

GDLGIEIPAEK.2|IYVDDGLISLQVK.2|IYVDDGLISLQVK.3|KGVN…

SEN / CTL

P27824

Calnexin

CANX

1.27

0.92

0.000253

0.000228

antigen processing and presentation of peptide ant…

glycoprotein binding,calcium ion binding,protein b…

endoplasmic reticulum,endoplasmic reticulum lumen,…

18

59

93

GTLSGWILSK.2|KIPNPDFFEDLEPFR.3|KIPNPDFFEDLEPFR.2|V…

SEN / CTL

Q14376

UDP-glucose 4-epimerase

GALE

1.27

0.48

0.0444

0.0182

galactose catabolic process

UDP-N-acetylglucosamine 4-epimerase activity,UDP-g…

cytosol,extracellular exosome

3

22

28

VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFR.4|VLVTGGAGYIG…

SEN / CTL

Q93008

Probable ubiquitin carboxyl-terminal hydrolase FAF-X

USP9X

1.26

1.28

0.0272

0.0122

negative regulation of transcription from RNA poly…

cysteine-type endopeptidase activity,thiol-depende…

cytoplasm,cytosol,membrane,growth cone

6

82

105

VVIQSNDDIASR.2|SGGLPLVLSMLTR.2|SGGLPLVLSM[Oxi]LTR….

SEN / CTL

Q9BUF5

Tubulin beta-6 chain

TUBB6

1.24

1.11

1.46e-11

5.89e-11

cytoskeleton organization,microtubule-based proces…

molecular_function,GTPase activity,structural cons…

nucleus,cytoplasm,microtubule,extracellular exosom…

72

25

55

YLTVATVFR.2|M[Oxi]ASTFIGNSTAIQELFKR.3|MASTFIGNSTAI…

SEN / CTL

P18065

Insulin-like growth factor-binding protein 2

IGFBP2

1.24

0.67

0.00000432

0.0000061

regulation of cell growth,signal transduction,fema…

receptor binding,insulin-like growth factor I bind…

extracellular region,extracellular space,apical pl…

18

11

14

TPC[CAM]QQELDQVLER.2|LEGEAC[CAM]GVYTPR.2|LAAC[CAM]…

SEN / CTL

P62280

40S ribosomal protein S11

RPS11

1.24

0.4

0.0275

0.0123

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,rRNA binding,po…

nucleoplasm,nucleolus,cytoplasm,cytosol,ribosome,f…

3

16

23

NMSVHLSPC[CAM]FR.3|NM[Oxi]SVHLSPC[CAM]FR.3|NMSVHLS…

SEN / CTL

P00387

NADH-cytochrome b5 reductase 3

CYB5R3

1.23

0.95

0.000206

0.000193

cholesterol biosynthetic process,blood circulation…

cytochrome-b5 reductase activity, acting on NAD(P)…

cytoplasm,mitochondrion,mitochondrial outer membra…

15

25

51

FALPSPQHILGLPVGQHIYLSAR.4|FALPSPQHILGLPVGQHIYLSAR….

SEN / CTL

Q12797

Aspartyl/asparaginyl beta-hydroxylase

ASPH

1.23

0.73

0.000537

0.000445

muscle contraction,peptidyl-amino acid modificatio…

peptide-aspartate beta-dioxygenase activity,struct…

endoplasmic reticulum,endoplasmic reticulum membra…

9

34

40

GLFLPEDENLREK.3|GAIETYQEVASLPDVPADLLK.3|GAIETYQEVA…

SEN / CTL

Q9H853

Putative tubulin-like protein alpha-4B

TUBA4B

1.22

0.44

0.036

0.0152

cytoskeleton organization,microtubule-based proces…

molecular_function,GTPase activity,structural cons…

cellular_component,cytoplasm,microtubule

3

1

2

QIFHPEQLITGK.3|QIFHPEQLITGK.2

SEN / CTL

P13807

Glycogen [starch] synthase, muscle

GYS1

1.21

0.42

0.0392

0.0162

glycogen biosynthetic process,heart development

glycogen (starch) synthase activity,protein bindin…

cytosol,membrane,inclusion body

3

25

31

LSDLLDWK.2|FSAMHEFQNLHAQSK.4|FSAMHEFQNLHAQSK.3|LSD…

SEN / CTL

P46940

Ras GTPase-activating-like protein IQGAP1

IQGAP1

1.2

0.69

1.67e-32

5.02e-31

regulation of cytokine production,signal transduct…

GTPase inhibitor activity,GTPase activator activit…

ruffle,nucleus,cytoplasm,cytosol,microtubule,actin…

120

128

200

NKYQELINDIAR.3|NKYQELINDIAR.2|IIGNLLYYR.2|LIVDVIR….

SEN / CTL

Q14204

Cytoplasmic dynein 1 heavy chain 1

DYNC1H1

1.2

0.95

8.71e-16

6.03e-15

G2/M transition of mitotic cell cycle,ER to Golgi …

microtubule motor activity,ATP binding,ATPase acti…

centrosome,cytosol,cytoplasmic dynein complex,micr…

81

337

531

FGNPLLVQDVESYDPVLNPVLNR.3|GNEIVLSAGSTPR.2|IFVFEPPP…

SEN / CTL

Q6NUK1

Calcium-binding mitochondrial carrier protein SCaMC-1

SLC25A24

1.2

0.61

0.00159

0.00114

mitochondrial transport,regulation of cell death,A…

ATP transmembrane transporter activity,calcium ion…

mitochondrion,mitochondrial inner membrane,integra…

6

28

40

QLLAGGIAGAVSR.2|QLLAGGIAGAVSR.3|TSTAPLDR.2|QTLGVTQ…

SEN / CTL

Q9BVC6

Transmembrane protein 109

TMEM109

1.2

0.65

0.0809

0.0301

ion transport,regulation of ion transmembrane tran…

molecular_function,voltage-gated ion channel activ…

nuclear outer membrane,integral component of membr…

3

5

6

EAPVDVLTQIGR.2|ASGAQLEAK.2|REAPVDVLTQIGR.3|REAPVDV…

SEN / CTL

P04066

Tissue alpha-L-fucosidase

FUCA1

1.19

0.66

6.94e-12

3.02e-11

fucose metabolic process,glycosaminoglycan catabol…

alpha-L-fucosidase activity

cytoplasm,lysosomal lumen,extracellular exosome

39

21

32

DGLIVPIFQER.2|WLSINGEAIYASKPWR.3|DLVGELGTALR.2|DVG…

SEN / CTL

P50851

Lipopolysaccharide-responsive and beige-like anchor protein

LRBA

1.17

1.09

0.00497

0.00298

biological_process

molecular_function

lysosome,endoplasmic reticulum,Golgi apparatus,pla…

12

75

87

VANEAEFILSR.2|LQATMETDDNIR.2|EAVEAQIR.2|EIFVDFAPFL…

SEN / CTL

P10145

Interleukin-8

CXCL8

1.16

0.53

0.0612

0.0238

angiogenesis,response to molecule of bacterial ori…

interleukin-8 receptor binding,protein binding,che…

extracellular region,extracellular space,intracell…

3

1

2

VIESGPHC[CAM]ANTEIIVK.3|VIESGPHC[CAM]ANTEIIVK.2

SEN / CTL

Q16787

Laminin subunit alpha-3

LAMA3

1.15

0.97

0.0118

0.00614

cell adhesion,epidermis development,extracellular …

receptor binding,structural molecule activity

extracellular region,basement membrane,laminin-5 c…

9

14

14

LLIDDQLLR.2|VPTQPHAPIPTFGQTIQTTVDR.3|SPQTYMDGLLHYV…

SEN / CTL

P07437

Tubulin beta chain

TUBB

1.14

0.56

1.33e-12

6.7e-12

G2/M transition of mitotic cell cycle,movement of …

GTPase activity,structural molecule activity,struc…

extracellular region,nucleus,nuclear envelope lume…

30

8

21

ALTVPELTQQVFDAK.2|ALTVPELTQQVFDAK.3|ISVYYNEATGGKYV…

SEN / CTL

Q14108

Lysosome membrane protein 2

SCARB2

1.14

0.29

2.72e-8

6.21e-8

protein targeting to lysosome,viral entry into hos…

virus receptor activity,protein binding,enzyme bin…

lysosomal membrane,focal adhesion,membrane,integra…

12

15

24

KLDDFVETGDIR.3|KLDDFVETGDIR.2|FVSAIEGMHPNQEDHETFVD…

SEN / CTL

Q9NY65

Tubulin alpha-8 chain

TUBA8

1.14

0.25

0.0139

0.00694

cytoskeleton organization,microtubule-based proces…

GTPase activity,structural constituent of cytoskel…

cytoplasm,microtubule

3

7

9

KLTDAC[CAM]SGLQGFLIFHSFGGGTGSGFTSLLMER.4|GHYTVGKES…

SEN / CTL

P12277

Creatine kinase B-type

CKB

1.13

0.65

1.76e-19

1.9e-18

creatine metabolic process,phosphorylation,substan…

creatine kinase activity,protein binding,ATP bindi…

extracellular space,cytoplasm,mitochondrion,cytoso…

63

33

80

VLTPELYAELR.2|VLTPELYAELR.3|HGGYKPSDEHKTDLNPDNLQGG…

SEN / CTL

P17655

Calpain-2 catalytic subunit

CAPN2

1.12

0.73

1.83e-21

2.47e-20

response to hypoxia,blastocyst development,proteol…

calcium-dependent cysteine-type endopeptidase acti…

chromatin,nucleus,cytoplasm,lysosome,endoplasmic r…

69

45

77

FADDQLIIDFDNFVR.2|FADDQLIIDFDNFVR.3|LFAQLAGEDAEISA…

SEN / CTL

Q9BVA1

Tubulin beta-2B chain

TUBB2B

1.12

0.24

0.0162

0.00794

neuron migration,cytoskeleton organization,microtu…

GTPase activity,structural constituent of cytoskel…

nucleus,cytoplasm,microtubule

3

2

2

INVYYNEATGNKYVPR.3|INVYYNEATGNK.2

SEN / CTL

A6NHL2

Tubulin alpha chain-like 3

TUBAL3

1.12

0.27

0.0171

0.00828

cytoskeleton organization,microtubule-based proces…

GTPase activity,structural constituent of cytoskel…

cytoplasm,microtubule

3

4

7

KLAEQC[CAM]GGLQGFLIFRSFGGGTGSGFTSLLMER.4|SLFHPEQLL…

SEN / CTL

O75915

PRA1 family protein 3

ARL6IP5

1.11

0.3

0.0246

0.0112

negative regulation of L-glutamate transport,intri…

molecular_function

endoplasmic reticulum,endoplasmic reticulum membra…

3

4

6

TPMGIVLDALEQQEEGINR.3|TPMGIVLDALEQQEEGINR.2|RTPMGI…

SEN / CTL

P30044

Peroxiredoxin-5, mitochondrial

PRDX5

1.09

0.61

6.09e-18

5.3e-17

response to reactive oxygen species,apoptotic proc…

RNA polymerase III regulatory region DNA binding,p…

extracellular space,nucleus,cytoplasm,mitochondrio…

48

19

35

THLPGFVEQAEALK.3|THLPGFVEQAEALK.2|THLPGFVEQAEALKAK…

SEN / CTL

O43324

Eukaryotic translation elongation factor 1 epsilon-1

EEF1E1

1.09

0.32

0.0239

0.011

translational elongation,tRNA aminoacylation for p…

translation elongation factor activity,glutathione…

nucleus,cytoplasm,cytosol,extracellular exosome

3

12

17

AIVQQWLEYR.2|WFC[CAM]HIQHYPGIR.4|WFC[CAM]HIQHYPGIR…

SEN / CTL

Q01813

ATP-dependent 6-phosphofructokinase, platelet type

PFKP

1.08

0.74

2.6e-11

1.02e-10

fructose 6-phosphate metabolic process,canonical g…

6-phosphofructokinase activity,ATP binding,protein…

nucleus,cytoplasm,cytosol,cell-cell adherens junct…

39

52

85

EWSGLLEELAR.2|LAIKLPDDQIPK.3|LAIKLPDDQIPK.2|NVIFQP…

SEN / CTL

P12236

ADP/ATP translocase 3

SLC25A6

1.08

1.68

0.148

0.0482

protein targeting to mitochondrion,apoptotic proce…

ATP:ADP antiporter activity,protein binding,adenin…

nucleus,mitochondrion,mitochondrial inner membrane…

9

8

15

DFLAGGIAAAISK.2|DFLAGGIAAAISK.3|KGADIMYTGTVDC[CAM]…

SEN / CTL

P39656

Dolichyl-diphosphooligosaccharide–protein glycosyltransferase 48 kDa subunit

DDOST

1.07

0.97

0.00142

0.00103

protein glycosylation,protein N-linked glycosylati…

oligosaccharyl transferase activity,dolichyl-dipho…

endoplasmic reticulum,endoplasmic reticulum membra…

9

20

32

NTLLIAGLQAR.2|TLVLLDNLNVR.2|WVFKEEGVLR.3|WVFKEEGVL…

SEN / CTL

P26640

Valine–tRNA ligase

VARS

1.06

0.46

0.00000469

0.00000649

tRNA aminoacylation for protein translation,valyl-…

aminoacyl-tRNA editing activity,valine-tRNA ligase…

mitochondrion,cytosol

12

72

116

LSAAVTEAFVR.2|SSAQDPQAVLGALGR.2|SSAQDPQAVLGALGR.3|…

SEN / CTL

P48047

ATP synthase subunit O, mitochondrial

ATP5O

1.05

0.51

0.0000294

0.0000331

ATP biosynthetic process,proton transport,mitochon…

transporter activity,protein binding,drug binding,…

nucleus,mitochondrion,mitochondrial inner membrane…

9

18

35

LVRPPVQVYGIEGR.3|LVRPPVQVYGIEGR.2|FSPLTTNLINLLAENG…

SEN / CTL

P02042


P02100


P68871


P69891


P69892

Hemoglobin subunit delta;Hemoglobin subunit epsilon;Hemoglobin subunit beta;Hemoglobin subunit gamma-1;Hemoglobin subunit gamma-2

HBD


HBE1


HBB


HBG1


HBG2

1.04

1.22

0.0278

0.0124

blood coagulation,oxygen transport;blood coagulati…

oxygen transporter activity,iron ion binding,prote…

cytosol,hemoglobin complex,blood microparticle;cyt…

6

1

2

LLVVYPWTQR.2|LLVVYPWTQR.3

SEN / CTL

Q99714

3-hydroxyacyl-CoA dehydrogenase type-2

HSD17B10

1.04

0.88

0.111

0.0387

lipid metabolic process,branched-chain amino acid …

3-hydroxyacyl-CoA dehydrogenase activity,protein b…

cytoplasm,mitochondrion,mitochondrial matrix,plasm…

6

26

51

GGIVGMTLPIAR.2|GGIVGM[Oxi]TLPIAR.2|DLAPIGIR.2|GQTH…

SEN / CTL

Q16527

Cysteine and glycine-rich protein 2

CSRP2

1.03

0.88

0.00375

0.00238

multicellular organism development,cell differenti…

molecular_function,zinc ion binding

nucleus,focal adhesion

9

10

14

GFGYGQGAGALVHAQ.2|GYGYGQGAGTLNMDRGER.3|C[CAM]C[CAM…

SEN / CTL

Q14894

Ketimine reductase mu-crystallin

CRYM

1.03

1

0.00619

0.00361

negative regulation of transcription from RNA poly…

transcription corepressor activity,protein homodim…

nucleus,cytoplasm,mitochondrion,peroxisomal matrix…

9

13

18

VPAFLSAAEVEEHLR.3|FADTVQGEVR.2|SLGMAVEDTVAAK.2|SLG…

SEN / CTL

P02511

Alpha-crystallin B chain

CRYAB

1.03

0.66

0.0213

0.00992

response to hypoxia,lens development in camera-typ…

structural constituent of eye lens,protein binding…

nucleus,nucleoplasm,cytoplasm,mitochondrion,Golgi …

6

25

40

FSVNLDVK.2|LFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLR.4|LF…

SEN / CTL

Q96DG6

Carboxymethylenebutenolidase homolog

CMBL

1.02

0.2

0.000115

0.000114

xenobiotic metabolic process

hydrolase activity

cytosol,extracellular exosome

6

19

23

NLIEWLNK.2|AVIVIQDIFGWQLPNTR.3|AVIVIQDIFGWQLPNTR.2…

SEN / CTL

O00299

Chloride intracellular channel protein 1

CLIC1

1

0.89

5e-9

1.39e-8

chloride transport,signal transduction,regulation …

voltage-gated ion channel activity,chloride channe…

extracellular space,nucleus,nuclear envelope,cytop…

63

24

42

LAALNPESNTAGLDIFAK.2|LAALNPESNTAGLDIFAK.3|GFTIPEAF…

SEN / CTL

Q15717

ELAV-like protein 1

ELAVL1

1

0.08

0.00231

0.00157

mRNA splicing, via spliceosome,multicellular organ…

nucleotide binding,RNA binding,double-stranded RNA…

nucleus,nucleoplasm,cytoplasm,cytosol,membrane,rib…

3

21

35

VLVDQTTGLSR.2|DANLYISGLPR.3|DANLYISGLPR.2|FGGPVHHQ…

SEN / CTL

P61586

Transforming protein RhoA

RHOA

0.97

0.76

0.00000196

0.00000302

transforming growth factor beta receptor signaling…

GTPase activity,protein binding,GTP binding,myosin…

endosome,endoplasmic reticulum membrane,cytosol,cy…

27

17

30

HFC[CAM]PNVPIILVGNKK.4|HFC[CAM]PNVPIILVGNKK.3|TC[C…

SEN / CTL

Q9H6S3

Epidermal growth factor receptor kinase substrate 8-like protein 2

EPS8L2

0.97

0.62

0.000495

0.000414

Rho protein signal transduction,regulation of Rho …

actin binding,cadherin binding involved in cell-ce…

cytoplasm,plasma membrane,cell-cell adherens junct…

9

30

35

VGPQVPLSEPGFR.2|LAINLLAK.2|ETQILNC[CAM]ALDDIEWFVAR…

SEN / CTL

P60903

Protein S100-A10

S100A10

0.96

0.46

2.7e-10

9.23e-10

membrane raft assembly,membrane budding,positive r…

calcium ion binding,protein binding,protein homodi…

extrinsic component of plasma membrane,extracellul…

24

12

32

FAGDKGYLTKEDLR.4|FAGDKGYLTKEDLR.3|VLMEKEFPGFLENQKD…

SEN / CTL

Q3ZCM7

Tubulin beta-8 chain

TUBB8

0.96

1.04

0.0000192

0.0000227

oocyte maturation,spindle assembly involved in fem…

molecular_function,GTPase activity,structural cons…

cytoplasm,microtubule,extracellular exosome,meioti…

21

4

13

LPTPTYGDLNHLVSATMSGVTTC[CAM]LR.3|EAESC[CAM]DC[CAM]…

SEN / CTL

P36543

V-type proton ATPase subunit E 1

ATP6V1E1

0.96

0.39

0.0459

0.0186

insulin receptor signaling pathway,ATP hydrolysis …

protein binding,hydrogen-exporting ATPase activity…

mitochondrion,lysosomal membrane,endosome,cytosol,…

3

16

22

ARDDLITDLLNEAK.3|ARDDLITDLLNEAK.2|VSNTLESR.2|IMEYY…

SEN / CTL

P04083

Annexin A1

ANXA1

0.95

0.47

9.2e-22

1.31e-20

DNA strand renaturation,neutrophil homeostasis,ada…

single-stranded DNA binding,single-stranded RNA bi…

cornified envelope,phagocytic cup,extracellular re…

75

38

69

GLGTDEDTLIEILASR.3|GLGTDEDTLIEILASR.2|GVDEATIIDILT…

SEN / CTL

P48307

Tissue factor pathway inhibitor 2

TFPI2

0.95

2.1

0.0805

0.03

blood coagulation,negative regulation of endopepti…

serine-type endopeptidase inhibitor activity,extra…

proteinaceous extracellular matrix,nucleus,extrace…

6

4

4

LQVSVDDQC[CAM]EGSTEK.2|TC[CAM]DAFTYTGC[CAM]GGNDNNF…

SEN / CTL

Q32MK0


Q86YV6


Q9H1R3

Myosin light chain kinase 3;Myosin light chain kinase family member 4;Myosin light chain kinase 2, skeletal/cardiac muscle

MYLK3


MYLK4


MYLK2

0.95

0.72

0.105

0.0371

regulation of vascular permeability involved in ac…

calmodulin-dependent protein kinase activity,myosi…

cytoplasm,cytosol,actin cytoskeleton;extracellular…

3

1

1

IIDFGLAR.2

SEN / CTL

P04406

Glyceraldehyde-3-phosphate dehydrogenase

GAPDH

0.94

0.83

1.67e-26

3.1e-25

microtubule cytoskeleton organization,gluconeogene…

glyceraldehyde-3-phosphate dehydrogenase (NAD+) (p…

nucleus,cytoplasm,lipid particle,cytosol,plasma me…

174

51

166

LISWYDNEFGYSNR.2|LISWYDNEFGYSNR.3|GALQNIIPASTGAAK….

SEN / CTL

P38646

Stress-70 protein, mitochondrial

HSPA9

0.94

1.21

0.000012

0.0000151

protein folding,protein export from nucleus,erythr…

protein binding,ATP binding,ubiquitin protein liga…

nucleolus,cytoplasm,mitochondrion,focal adhesion,e…

36

68

123

TTPSVVAFTADGER.2|TTPSVVAFTADGER.3|AQFEGIVTDLIR.2|A…

SEN / CTL

O60936

Nucleolar protein 3

NOL3

0.94

0.4

0.0636

0.0246

response to hypoxia,blood vessel remodeling,respon…

RNA binding,death receptor binding,calcium ion bin…

nucleolus,mitochondrion,cytosol,membrane,sarcoplas…

3

5

6

LVETLQADSGLLLDALLAR.3|LVETLQADSGLLLDALLAR.2|GEAAC[…

SEN / CTL

O15264


P45983


P45984


P53778


P53779


Q15759


Q16539

Mitogen-activated protein kinase 13;Mitogen-activated protein kinase 8;Mitogen-activated protein kinase 9;Mitogen-activated protein kinase 12;Mitogen-activated protein kinase 10;Mitogen-activated protein kinase 11;Mitogen-activated protein kinase 14

MAPK13


MAPK8


MAPK9


MAPK12


MAPK10


MAPK11


MAPK14

0.94

0.72

0.105

0.0371

MAPK cascade,transcription, DNA-templated,regulati…

protein serine/threonine kinase activity,MAP kinas…

cytosol;nucleus,nucleoplasm,mitochondrion,cytosol;…

3

1

1

ILDFGLAR.2

SEN / CTL

Q96TA1

Niban-like protein 1

FAM129B

0.93

0.5

2.15e-15

1.36e-14

negative regulation of apoptotic process,cell-cell…

cadherin binding involved in cell-cell adhesion

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pl…

45

38

58

FDVSSTSVFK.2|FQELIFEDFAR.2|HC[CAM]NNGIPEDSKVEGPAFT…

SEN / CTL

P40939

Trifunctional enzyme subunit alpha, mitochondrial

HADHA

0.92

0.8

3.87e-10

1.28e-9

fatty acid beta-oxidation,response to insulin,card…

fatty-acyl-CoA binding,3-hydroxyacyl-CoA dehydroge…

mitochondrion,mitochondrial inner membrane,mitocho…

33

68

128

LTAYAMTIPFVR.2|LTAYAMTIPFVR.3|LTAYAM[Oxi]TIPFVR.2|…

SEN / CTL

Q13509

Tubulin beta-3 chain

TUBB3

0.9

0.95

1.6e-8

4.04e-8

cytoskeleton organization,microtubule-based proces…

GTPase activity,structural constituent of cytoskel…

nucleus,cytoplasm,microtubule,axon,dendrite,neuron…

42

12

23

ISVYYNEASSHKYVPR.4|LHFFMPGFAPLTAR.3|LHFFMPGFAPLTAR…

SEN / CTL

P07741

Adenine phosphoribosyltransferase

APRT

0.9

1.18

0.0013

0.000948

adenine salvage,lactation,grooming behavior,cellul…

adenine binding,adenine phosphoribosyltransferase …

nucleoplasm,cytoplasm,cytosol,extracellular exosom…

15

17

29

GFLFGPSLAQELGLGC[CAM]VLIR.3|GFLFGPSLAQELGLGC[CAM]V…

SEN / CTL

P07355

Annexin A2

ANXA2

0.89

1.02

3.01e-28

6.26e-27

angiogenesis,membrane raft assembly,positive regul…

protease binding,calcium ion binding,protein bindi…

ruffle,basement membrane,extracellular space,nucle…

222

49

99

GLGTDEDSLIEIIC[CAM]SR.2|GLGTDEDSLIEIIC[CAM]SR.3|GV…

SEN / CTL

Q14240

Eukaryotic initiation factor 4A-II

EIF4A2

0.89

0.61

0.0693

0.0263

nuclear-transcribed mRNA poly(A) tail shortening,t…

translation initiation factor activity,ATP-depende…

cytosol,eukaryotic translation initiation factor 4…

3

18

29

KGVAINFVTEEDKR.4|KGVAINFVTEEDKR.3|KGVAINFVTEEDKR.2…

SEN / CTL

O00151

PDZ and LIM domain protein 1

PDLIM1

0.88

0.29

2.87e-19

2.87e-18

response to hypoxia,regulation of transcription, D…

transcription coactivator activity,zinc ion bindin…

transcription factor complex,cytoplasm,cytoskeleto…

39

27

50

IKGC[CAM]TDNLTLTVAR.3|IKGC[CAM]TDNLTLTVAR.2|C[CAM]…

SEN / CTL

P60709


P63261

Actin, cytoplasmic 1;Actin, cytoplasmic 2

ACTB


ACTG1

0.88

1.26

9.1e-19

8.47e-18

retina homeostasis,movement of cell or subcellular…

structural constituent of cytoskeleton,protein bin…

nuclear chromatin,extracellular space,nucleoplasm,…

282

34

122

SYELPDGQVITIGNER.2|SYELPDGQVITIGNER.3|VAPEEHPVLLTE…

SEN / CTL

Q6IAA8

Ragulator complex protein LAMTOR1

LAMTOR1

0.88

0.36

0.00102

0.000773

regulation of receptor recycling,endosome organiza…

protein binding,guanyl-nucleotide exchange factor …

lysosome,lysosomal membrane,Golgi apparatus,plasma…

6

9

17

TDEQALLSSILAK.2|IAAYAYSALSQIR.2|ALNGAEPNYHSLPSAR.4…

SEN / CTL

P04179

Superoxide dismutase [Mn], mitochondrial

SOD2

0.86

1.13

0.0000142

0.0000174

response to reactive oxygen species,response to su…

superoxide dismutase activity,manganese ion bindin…

mitochondrion,mitochondrial matrix,extracellular e…

54

23

42

AIWNVINWENVTER.2|AIWNVINWENVTER.3|GDVTAQIALQPALK.2…

SEN / CTL

P34059

N-acetylgalactosamine-6-sulfatase

GALNS

0.85

1.61

0.0673

0.0257

keratan sulfate catabolic process

N-acetylgalactosamine-4-sulfatase activity,sulfuri…

lysosomal lumen,extracellular exosome

9

12

17

YYEEFPINLK.2|AHFWTWTNSWENFR.3|AHFWTWTNSWENFR.2|AID…

SEN / CTL

P60866

40S ribosomal protein S20

RPS20

0.85

0.66

0.132

0.0444

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,poly(A) RNA bin…

nucleoplasm,cytoplasm,cytosol,membrane,cytosolic s…

3

5

10

LIDLHSPSEIVK.3|LIDLHSPSEIVK.2|DTGKTPVEPEVAIHR.4|DT…

SEN / CTL

P50552

Vasodilator-stimulated phosphoprotein

VASP

0.84

0.29

0.0000215

0.0000252

neural tube closure,axon guidance,actin polymeriza…

actin binding,protein binding,profilin binding,SH3…

cytoplasm,cytosol,plasma membrane,cell-cell adhere…

9

28

48

WLPAGTGPQAFSR.2|SSSSVTTSETQPC[CAM]TPSSSDYSDLQR.3|V…

SEN / CTL

Q9BVK6

Transmembrane emp24 domain-containing protein 9

TMED9

0.84

0.52

0.000425

0.000359

ER to Golgi vesicle-mediated transport,retrograde …

syntaxin binding

Golgi membrane,endoplasmic reticulum,endoplasmic r…

9

13

20

QLVEQVEQIQKEQNYQR.3|FSLFAGGMLR.2|FSLFAGGM[Oxi]LR.2…

SEN / CTL

O00748

Cocaine esterase

CES2

0.84

0.09

0.0035

0.00224

xenobiotic metabolic process,catabolic process

methylumbelliferyl-acetate deacetylase activity,ca…

extracellular space,endoplasmic reticulum,endoplas…

3

21

31

MIPGVVDGVFLPR.2|M[Oxi]IPGVVDGVFLPR.2|ADHGDELPFVFR….

SEN / CTL

P61026

Ras-related protein Rab-10

RAB10

0.83

0.37

0.00000813

0.0000107

Golgi to plasma membrane transport,small GTPase me…

GTPase activity,GTP binding,GDP binding,myosin V b…

Golgi membrane,endosome,endoplasmic reticulum memb…

12

17

24

AFLTLAEDILR.2|LLLIGDSGVGK.2|LQIWDTAGQER.2|LQIWDTAG…

SEN / CTL

P10606

Cytochrome c oxidase subunit 5B, mitochondrial

COX5B

0.83

0.69

0.0135

0.0068

mitochondrial electron transport, cytochrome c to …

cytochrome-c oxidase activity,protein binding,meta…

mitochondrion,mitochondrial inner membrane,mitocho…

6

10

16

KGLDPYNVLAPK.3|KGLDPYNVLAPK.2|GLDPYNVLAPK.2|EDPNLV…

SEN / CTL

P00568

Adenylate kinase isoenzyme 1

AK1

0.82

0.51

5.55e-8

1.2e-7

nucleoside diphosphate phosphorylation,ADP biosynt…

adenylate kinase activity,nucleoside diphosphate k…

outer dense fiber,cytoplasm,cytosol,plasma membran…

21

16

23

IIFVVGGPGSGK.2|GQLVPLETVLDMLR.3|GQLVPLETVLDMLR.2|G…

SEN / CTL

P12268

Inosine-5′-monophosphate dehydrogenase 2

IMPDH2

0.81

0.34

0.00000215

0.0000033

GMP biosynthetic process,GTP biosynthetic process,…

nucleotide binding,DNA binding,RNA binding,IMP deh…

nucleus,cytoplasm,peroxisomal membrane,cytosol,mem…

12

39

77

NLIDAGVDALR.2|GKLPIVNEDDELVAIIAR.3|GKLPIVNEDDELVAI…

SEN / CTL

Q9NP97

Dynein light chain roadblock-type 1

DYNLRB1

0.81

0.19

0.0000045

0.0000063

transport,microtubule-based movement,visual behavi…

microtubule motor activity,dynein intermediate cha…

cytoplasm,centrosome,cytoplasmic dynein complex,mi…

9

6

12

STVRDIDPQNDLTFLR.3|DIDPQNDLTFLR.2|DIDPQNDLTFLR.3|G…

SEN / CTL

P33176

Kinesin-1 heavy chain

KIF5B

0.81

0.8

0.00226

0.00154

microtubule-based movement,cytoplasm organization,…

microtubule motor activity,protein binding,ATP bin…

cytoplasm,microtubule organizing center,kinesin co…

12

140

283

GLEETVAK.2|LYLVDLAGSEK.2|FQGEDTVVIASKPYAFDR.3|FQGE…

SEN / CTL

O43639


P16333

Cytoplasmic protein NCK2;Cytoplasmic protein NCK1

NCK2


NCK1

0.81

0.29

0.0572

0.0226

immunological synapse formation,actin filament org…

SH3/SH2 adaptor activity,ARF guanyl-nucleotide exc…

cytoplasm,endoplasmic reticulum,trans-Golgi networ…

3

1

1

LWLLDDSK.2

SEN / CTL

P61247

40S ribosomal protein S3a

RPS3A

0.8

0.46

0.00000392

0.00000563

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,fo…

15

30

55

LFC[CAM]VGFTK.2|ADGYEPPVQESV.2|LIPDSIGKDIEK.3|LIPD…

SEN / CTL

P35232

Prohibitin

PHB

0.8

0.74

0.00000902

0.0000118

negative regulation of transcription from RNA poly…

RNA polymerase II transcription factor activity, s…

nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch…

30

36

61

FDAGELITQR.2|DLQNVNITLR.2|VLPSITTEILK.2|VLPSITTEIL…

SEN / CTL

Q96FQ6

Protein S100-A16

S100A16

0.8

0.65

0.000447

0.000376

response to calcium ion

calcium ion binding,protein binding,protein homodi…

nucleolus,cytoplasm,cytosol,plasma membrane,extrac…

12

8

13

AVIVLVENFYK.2|AVIVLVENFYK.3|ISFDEYWTLIGGITGPIAK.3|…

SEN / CTL

Q99829

Copine-1

CPNE1

0.8

0.27

0.00212

0.00145

transcription, DNA-templated,regulation of transcr…

phosphatidylserine binding,endopeptidase activity,…

nucleus,cytoplasm,cytosol,plasma membrane,membrane…

6

23

37

SDPFLEFFR.2|EALAQTVLAEVPTQLVSYFR.3|EALAQTVLAEVPTQL…

SEN / CTL

Q9Y490

Talin-1

TLN1

0.79

0.65

5.75e-26

9.71e-25

platelet degranulation,movement of cell or subcell…

integrin binding,structural constituent of cytoske…

ruffle,extracellular region,cytoplasm,microtubule …

225

186

355

GLAGAVSELLR.2|AVAEQIPLLVQGVR.2|AVAEQIPLLVQGVR.3|AV…

SEN / CTL

Q9Y6N5

Sulfide:quinone oxidoreductase, mitochondrial

SQRDL

0.79

0.67

2.71e-8

6.21e-8

sulfide oxidation, using sulfide:quinone oxidoredu…

quinone binding,sulfide:quinone oxidoreductase act…

mitochondrial inner membrane

30

39

63

YADALQEIIQER.2|TAAAVAAQSGILDR.2|TAAAVAAQSGILDR.3|H…

SEN / CTL

P62701

40S ribosomal protein S4, X isoform

RPS4X

0.79

0.55

0.000128

0.000126

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,protein binding…

nucleoplasm,cytosol,ribosome,polysome,focal adhesi…

12

30

47

LSNIFVIGK.2|LREC[CAM]LPLIIFLR.3|LREC[CAM]LPLIIFLR….

SEN / CTL

P67809

Nuclease-sensitive element-binding protein 1

YBX1

0.79

0.39

0.00161

0.00114

negative regulation of transcription from RNA poly…

RNA polymerase II core promoter proximal region se…

nucleus,nucleoplasm,U12-type spliceosomal complex,…

6

29

58

RPQYSNPPVQGEVMEGADNQGAGEQGRPVR.4|RPQYSNPPVQGEVM[Ox…

SEN / CTL

O00264

Membrane-associated progesterone receptor component 1

PGRMC1

0.79

0.63

0.00391

0.00244

steroid binding,heme binding

nucleolus,endoplasmic reticulum,endoplasmic reticu…

9

19

22

FYGPEGPYGVFAGR.2|IVRGDQPAASGDSDDDEPPPLPR.3|ILMAING…

SEN / CTL

Q16891

MICOS complex subunit MIC60

IMMT

0.78

0.77

0.00914

0.00497

biological_process,cristae formation,mitochondrial…

protein binding,poly(A) RNA binding

mitochondrion,mitochondrial inner membrane,membran…

12

79

130

VVSQYHELVVQAR.3|VVSQYHELVVQAR.2|LRGIEQAVQSHAVAEEEA…

SEN / CTL

P35080

Profilin-2

PFN2

0.78

0.35

0.0919

0.0334

negative regulation of epithelial cell migration,a…

adenyl-nucleotide exchange factor activity,actin m…

cytoplasm,cytoskeleton,terminal bouton,extracellul…

3

8

11

DREGFFTNGLTLGAK.3|DREGFFTNGLTLGAK.2|VLVFVM[Oxi]GK….

SEN / CTL

Q99536

Synaptic vesicle membrane protein VAT-1 homolog

VAT1

0.77

0.56

1.62e-8

4.04e-8

negative regulation of mitochondrial fusion,oxidat…

zinc ion binding,oxidoreductase activity

mitochondrial outer membrane,integral component of…

33

28

53

TWWNQFSVTALQLLQANR.3|LQSRPAAPPAPGPGQLTLR.3|LQSRPAA…

SEN / CTL

Q9BUT1

3-hydroxybutyrate dehydrogenase type 2

BDH2

0.77

0.37

0.000239

0.000218

fatty acid beta-oxidation,siderophore biosynthetic…

3-hydroxybutyrate dehydrogenase activity,oxidoredu…

cytoplasm,cytosol,extracellular exosome,mitochondr…

9

13

19

SVAADFIQQGIR.2|VIILTAAAQGIGQAAALAFAR.3|VIILTAAAQGI…

SEN / CTL

P68402

Platelet-activating factor acetylhydrolase IB subunit beta

PAFAH1B2

0.77

0.32

0.000712

0.000567

lipid metabolic process,spermatogenesis,brain deve…

1-alkyl-2-acetylglycerophosphocholine esterase act…

nucleolus,cytoplasm,cytosol,plasma membrane,extrac…

9

10

21

IIVLGLLPR.2|ELFSPLHALNFGIGGDTTR.3|ELFSPLHALNFGIGGD…

SEN / CTL

O60701

UDP-glucose 6-dehydrogenase

UGDH

0.77

0.8

0.00232

0.00157

gastrulation with mouth forming second,carbohydrat…

UDP-glucose 6-dehydrogenase activity,electron carr…

nucleus,nucleoplasm,cytosol,extracellular exosome

15

46

76

ILTTNTWSSELSK.2|VTVVDVNESR.2|IAILGFAFK.2|LAANAFLAQ…

SEN / CTL

P62913

60S ribosomal protein L11

RPL11

0.77

0.33

0.00279

0.00183

ribosomal large subunit assembly,nuclear-transcrib…

RNA binding,structural constituent of ribosome,pro…

nucleoplasm,nucleolus,cytoplasm,cytosol,membrane,c…

6

20

23

VLEQLTGQTPVFSK.2|VLEQLTGQTPVFSK.3|AEEILEK.2|HRISKE…

SEN / CTL

P23368

NAD-dependent malic enzyme, mitochondrial

ME2

0.77

1.16

0.0542

0.0215

malate metabolic process,oxidation-reduction proce…

malic enzyme activity,malate dehydrogenase (decarb…

mitochondrion,mitochondrial matrix,intracellular m…

12

35

55

VFTPGQGNNVYIFPGVALAVILC[CAM]NTR.3|LC[CAM]LYTAC[CAM…

SEN / CTL

O60749

Sorting nexin-2

SNX2

0.76

0.09

0.00304

0.00197

intracellular protein transport,endocytosis,vesicl…

epidermal growth factor receptor binding,insulin r…

cytoplasm,cytosol,cell-cell adherens junction,endo…

3

24

36

AVNTQALSGAGILR.2|AVNTQALSGAGILR.3|TVKHPTLLQDPDLR.4…

SEN / CTL

P49411

Elongation factor Tu, mitochondrial

TUFM

0.76

1.63

0.00817

0.00455

translational elongation,response to ethanol,mitoc…

translation elongation factor activity,GTPase acti…

mitochondrion,membrane,mitochondrial nucleoid,extr…

30

46

87

GITINAAHVEYSTAAR.3|GITINAAHVEYSTAAR.2|GITINAAHVEYS…

SEN / CTL

Q96HY6

DDRGK domain-containing protein 1

DDRGK1

0.76

0.39

0.00955

0.00512

regulation of intracellular estrogen receptor sign…

protein binding,ubiquitin-like protein ligase bind…

endoplasmic reticulum,endoplasmic reticulum membra…

6

12

18

VVLLEDLASQVGLR.2|VVLLEDLASQVGLR.3|FIYITPEELAAVANFI…

SEN / CTL

O60763

General vesicular transport factor p115

USO1

0.76

0.61

0.0234

0.0108

intracellular protein transport,ER to Golgi vesicl…

protein transporter activity,poly(A) RNA binding,c…

Golgi membrane,nucleolus,endoplasmic reticulum,Gol…

9

49

72

VTNLHLMLQLVR.3|VTNLHLMLQLVR.2|EVIRNDGVLLLQALTR.3|E…

SEN / CTL

Q92743

Serine protease HTRA1

HTRA1

0.76

0.67

0.119

0.041

regulation of cell growth,placenta development,pro…

serine-type endopeptidase activity,insulin-like gr…

extracellular region,extracellular space,cytosol,p…

6

2

2

IAPAVVHIELFR.3|SSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQR.3

SEN / CTL

Q96SI9

Spermatid perinuclear RNA-binding protein

STRBP

0.76

0.52

0.141

0.0465

multicellular organism development,spermatid devel…

DNA binding,double-stranded RNA binding,single-str…

nucleus,cytoplasm,microtubule cytoskeleton

3

24

25

SC[CAM]VIVLR.2|EDITHSAQHALR.3|RPFEDGLGDDKDPNKK.4|R…

SEN / CTL

P04004

Vitronectin

VTN

0.76

1.51

0.145

0.0477

receptor-mediated endocytosis,immune response,cell…

scavenger receptor activity,integrin binding,prote…

extracellular region,basement membrane,extracellul…

12

22

33

LIRDVWGIEGPIDAAFTR.3|DVWGIEGPIDAAFTR.2|DVWGIEGPIDA…

SEN / CTL

Q9BR76

Coronin-1B

CORO1B

0.75

0.61

0.00000154

0.00000247

cell migration,actin cytoskeleton organization,ruf…

protein binding,identical protein binding,actin fi…

stress fiber,cytoplasm,cytosol,actin filament,plas…

21

27

44

DADPILISLR.2|AGEAGKLEEVMQELR.3|AGEAGKLEEVMQELR.2|V…

SEN / CTL

Q6PCE3

Glucose 1,6-bisphosphate synthase

PGM2L1

0.75

0.18

0.000287

0.000255

glucose metabolic process,phosphorylation

intramolecular transferase activity, phosphotransf…

cytosol

6

15

17

DVPVYLFSR.2|FC[CAM]GTFAILHVR.3|GFVVGYDTR.2|VFGFKPP…

SEN / CTL

Q13418

Integrin-linked protein kinase

ILK

0.75

0.8

0.00387

0.00242

branching involved in ureteric bud morphogenesis,p…

protein serine/threonine kinase activity,signal tr…

stress fiber,nucleoplasm,cytoplasm,cytosol,plasma …

12

21

36

FDMIVPILEK.2|FDM[Oxi]IVPILEK.2|SAVVEMLIMR.2|GMAFLH…

SEN / CTL

P30042

ES1 protein homolog, mitochondrial

C21orf33

0.75

0.41

0.00763

0.00427

mitochondrion

6

22

42

VLKEFHQAGKPIGLC[CAM]C[CAM]IAPVLAAK.4|VLKEFHQAGKPIG…

SEN / CTL

P59190

Ras-related protein Rab-15

RAB15

0.75

0.45

0.0601

0.0235

small GTPase mediated signal transduction,protein …

protein binding,GTP binding

cytoplasm,plasma membrane,endosome membrane,perinu…

3

1

1

IQIWDTAGQER.2

SEN / CTL

P68366

Tubulin alpha-4A chain

TUBA4A

0.74

0.63

6.77e-13

3.52e-12

G2/M transition of mitotic cell cycle,platelet deg…

GTPase activity,structural constituent of cytoskel…

extracellular region,cytosol,microtubule,extracell…

42

16

28

LISQIVSSITASLR.2|LISQIVSSITASLR.3|AVFVDLEPTVIDEIR….

SEN / CTL

P52943

Cysteine-rich protein 2

CRIP2

0.74

0.62

1.15e-7

2.29e-7

positive regulation of cell proliferation,hemopoie…

zinc ion binding

cell cortex,extracellular matrix

21

12

18

ASSVTTFTGEPNTC[CAM]PR.2|GVNIGGAGSYIYEKPLAEGPQVTGPI…

SEN / CTL

P62826

GTP-binding nuclear protein Ran

RAN

0.74

0.41

0.00000596

0.00000812

ribosomal large subunit export from nucleus,riboso…

chromatin binding,transcription coactivator activi…

nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla…

15

19

35

GPIKFNVWDTAGQEK.3|GPIKFNVWDTAGQEK.2|LVLVGDGGTGK.2|…

SEN / CTL

P35998

26S protease regulatory subunit 7

PSMC2

0.74

0.56

0.000227

0.000208

MAPK cascade,protein polyubiquitination,osteoblast…

protein binding,ATP binding,ATPase activity,TBP-cl…

proteasome complex,cytoplasmic mRNA processing bod…

15

40

63

ALDEGDIALLK.2|KIEFSLPDLEGR.3|KIEFSLPDLEGR.2|SVC[CA…

SEN / CTL

P04350

Tubulin beta-4A chain

TUBB4A

0.73

0.39

0.000294

0.00026

G2/M transition of mitotic cell cycle,cytoskeleton…

GTPase activity,structural constituent of cytoskel…

nucleus,cytosol,microtubule,cilium,internode regio…

12

4

7

M[Oxi]AATFIGNSTAIQELFKR.3|MAATFIGNSTAIQELFKR.3|M[O…

SEN / CTL

Q8N1G4

Leucine-rich repeat-containing protein 47

LRRC47

0.73

0.62

0.00986

0.00526

phenylalanyl-tRNA aminoacylation

poly(A) RNA binding,phenylalanine-tRNA ligase acti…

phenylalanine-tRNA ligase complex

6

28

40

SILEYLR.2|DVRPYIVGAVVR.3|DVRPYIVGAVVR.2|AAGGQLPPR….

SEN / CTL

P68032

Actin, alpha cardiac muscle 1

ACTC1

0.72

0.62

1.2e-16

8.78e-16

apoptotic process,positive regulation of gene expr…

ATP binding,ATPase activity,myosin binding

extracellular space,cytoplasm,cytosol,actin filame…

81

12

42

EKLC[CAM]YVALDFENEM[Oxi]ATAASSSSLEK.3|MTQIMFETFNVP…

SEN / CTL

Q9UGI8

Testin

TES

0.72

0.66

0.0000286

0.0000324

negative regulation of cell proliferation,cell-cel…

protein binding,zinc ion binding,poly(A) RNA bindi…

nucleus,cytoplasm,plasma membrane,cell-cell adhere…

18

33

47

C[CAM]EGFELHFWR.3|LSMKEGDPAIYAER.3|KNVSINTVTYEWAPP…

SEN / CTL

P04632

Calpain small subunit 1

CAPNS1

0.72

1.04

0.000693

0.000557

proteolysis,positive regulation of cell proliferat…

calcium-dependent cysteine-type endopeptidase acti…

cytosol,plasma membrane,membrane,extracellular exo…

30

18

39

ILGGVISAISEAAAQYNPEPPPPR.4|ILGGVISAISEAAAQYNPEPPPP…

SEN / CTL

P62304

Small nuclear ribonucleoprotein E

SNRPE

0.72

0.47

0.136

0.0453

spliceosomal complex assembly,spliceosomal snRNP a…

RNA binding,protein binding

nucleus,nucleoplasm,spliceosomal complex,U5 snRNP,…

3

5

11

VMVQPINLIFR.2|VMVQPINLIFR.3|VM[Oxi]VQPINLIFR.3|VM[…

SEN / CTL

O75955

Flotillin-1

FLOT1

0.71

0.28

3.77e-7

6.84e-7

membrane raft assembly,positive regulation of cyto…

protease binding,protein binding,ionotropic glutam…

uropod,lysosomal membrane,endosome,early endosome,…

15

31

45

AAYDIEVNTR.2|MRGEAEAFAIGAR.3|MRGEAEAFAIGAR.2|HGVPI…

SEN / CTL

Q9NZM1

Myoferlin

MYOF

0.71

0.86

0.0000493

0.0000526

plasma membrane repair,muscle contraction,blood ci…

protein binding,phospholipid binding

nuclear envelope,plasma membrane,caveola,integral …

30

117

143

WVTFLLK.2|FGSHC[CAM]GIPEEYC[CAM]VSGVNTWR.3|ANVTVLD…

SEN / CTL

P49755

Transmembrane emp24 domain-containing protein 10

TMED10

0.71

0.37

0.00242

0.00162

kidney development,intracellular protein transport…

protein binding,syntaxin binding,protein complex b…

Golgi membrane,endoplasmic reticulum,endoplasmic r…

6

11

23

RLEDLSESIVNDFAYMK.3|RLEDLSESIVNDFAYM[Oxi]K.3|RLEDL…

SEN / CTL

Q15746

Myosin light chain kinase, smooth muscle

MYLK

0.71

0.98

0.0415

0.0171

protein phosphorylation,muscle contraction,smooth …

actin binding,myosin light chain kinase activity,c…

stress fiber,cytoplasm,cytosol,lamellipodium,cleav…

12

57

67

LIDFGLAR.2|LSSMAMISGLSGR.2|TSSSITLQAAR.2|TIRDLEVVE…

SEN / CTL

Q562R1

Beta-actin-like protein 2

ACTBL2

0.7

0.36

7.98e-10

2.48e-9

biological_process

molecular_function,ATP binding

extracellular space,cytoplasm,cytoskeleton,extrace…

24

9

17

VAPDEHPILLTEAPLNPK.3|VAPDEHPILLTEAPLNPK.4|KDLYANTV…

SEN / CTL

P51665

26S proteasome non-ATPase regulatory subunit 7

PSMD7

0.7

0.38

0.000209

0.000195

MAPK cascade,protein polyubiquitination,stimulator…

protein binding,protein homodimerization activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

12

15

25

LHKNDIAINELMK.3|VVGVLLGSWQK.2|VVVHPLVLLSVVDHFNR.4|…

SEN / CTL

P20340


Q9NRW1

Ras-related protein Rab-6A;Ras-related protein Rab-6B

RAB6A


RAB6B

0.7

0.58

0.000798

0.000626

protein targeting to Golgi,retrograde vesicle-medi…

GTPase activity,protein binding,GTP binding,protei…

Golgi membrane,endoplasmic reticulum membrane,Golg…

9

3

3

LQLWDTAGQER.2|LVFLGEQSVGK.2|FKLVFLGEQSVGK.3

SEN / CTL

O43399

Tumor protein D54

TPD52L2

0.69

0.35

6.5e-8

1.36e-7

poly(A) RNA binding

18

18

28

LGLSTLGELKQNLSR.3|LGLSTLGELK.2|TSAALSTVGSAISR.2|TS…

SEN / CTL

P21912

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SDHB

0.69

0.27

0.00167

0.00119

tricarboxylic acid cycle,succinate metabolic proce…

succinate dehydrogenase activity,protein binding,s…

nucleoplasm,mitochondrion,mitochondrial inner memb…

6

18

26

LQDPFSLYR.2|C[CAM]GPMVLDALIK.2|C[CAM]GPM[Oxi]VLDAL…

SEN / CTL

O76061

Stanniocalcin-2

STC2

0.69

1.41

0.0456

0.0186

cellular calcium ion homeostasis,response to oxida…

hormone activity,enzyme binding,heme binding,prote…

extracellular space,endoplasmic reticulum,Golgi ap…

6

2

2

HDLC[CAM]AAAQENTR.2|VIVEMIHFK.2

SEN / CTL

P50479

PDZ and LIM domain protein 4

PDLIM4

0.68

0.56

6.65e-8

1.38e-7

protein binding,zinc ion binding

27

14

19

VKPPEGYDVVAVYPNAK.3|GYFFLDER.2|DFSAPLTISR.2|AALAAL…

SEN / CTL

Q16555

Dihydropyrimidinase-related protein 2

DPYSL2

0.68

0.84

0.0000198

0.0000233

response to amphetamine,nucleobase-containing comp…

dihydropyrimidinase activity,protein binding,micro…

mitochondrion,cytosol,dendrite,growth cone,neurona…

45

34

71

QIGENLIVPGGVK.2|SSAEVIAQAR.2|IVLEDGTLHVTEGSGR.3|IV…

SEN / CTL

Q13404

Ubiquitin-conjugating enzyme E2 variant 1

UBE2V1

0.68

0.64

0.000973

0.00075

protein polyubiquitination,stimulatory C-type lect…

protein binding,ubiquitin protein ligase binding,u…

ubiquitin ligase complex,nucleus,cytoplasm,cytosol…

9

10

16

WTGMIIGPPR.2|WTGM[Oxi]IIGPPR.2|VVLQELR.2|IEC[CAM]G…

SEN / CTL

Q15435

Protein phosphatase 1 regulatory subunit 7

PPP1R7

0.68

0.22

0.0029

0.0019

chromosome segregation,biological_process,positive…

protein phosphatase type 1 regulator activity,enzy…

nucleus,chromosome,cytoplasm,extracellular exosome

6

25

37

IEGLQNLVNLR.2|AIENIDTLTNLESLFLGK.3|AIENIDTLTNLESLF…

SEN / CTL

Q00610

Clathrin heavy chain 1

CLTC

0.67

0.7

2.35e-28

5.29e-27

osteoblast differentiation,intracellular protein t…

double-stranded RNA binding,structural molecule ac…

spindle,cytosol,plasma membrane,focal adhesion,mem…

234

154

302

LLLPWLEAR.2|SVDPTLALSVYLR.2|VANVELYYR.2|QKWLLLTGIS…

SEN / CTL

P22314

Ubiquitin-like modifier-activating enzyme 1

UBA1

0.67

0.62

3.19e-15

1.87e-14

cellular response to DNA damage stimulus,protein u…

ubiquitin activating enzyme activity,ubiquitin-pro…

nucleus,cytoplasm,mitochondrion,cytosol,extracellu…

111

67

128

LQTSSVLVSGLR.2|LAGTQPLEVLEAVQR.3|LAGTQPLEVLEAVQR.2…

SEN / CTL

O75367

Core histone macro-H2A.1

H2AFY

0.67

0.35

1.08e-7

2.16e-7

negative regulation of transcription from RNA poly…

rDNA binding,RNA polymerase II regulatory region s…

nuclear chromosome,nuclear chromosome, telomeric r…

18

23

38

HILLAVANDEELNQLLK.3|HILLAVANDEELNQLLK.2|KGGKEFVEAV…

SEN / CTL

P0DMV8


P0DMV9

Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B

HSPA1A


HSPA1B

0.67

0.9

3.39e-7

6.32e-7

positive regulation of gene expression,regulation …

virus receptor activity,G-protein coupled receptor…

nucleoplasm,cytoplasm,mitochondrion,centriole,cyto…

90

60

132

TTPSYVAFTDTER.2|TTPSYVAFTDTER.3|IINEPTAAAIAYGLDR.3…

SEN / CTL

P27816

Microtubule-associated protein 4

MAP4

0.67

0.76

8.96e-7

0.00000152

mitotic spindle organization,neuron projection dev…

structural molecule activity,microtubule binding,p…

cytoplasm,microtubule,microtubule associated compl…

36

68

96

NVVLPTETEVAPAKDVTLLKETER.4|ATPMPSRPSTTPFIDKKPTSAKP…

SEN / CTL

O94979

Protein transport protein Sec31A

SEC31A

0.67

1.05

0.00148

0.00107

antigen processing and presentation of peptide ant…

protein binding,calcium-dependent protein binding

Golgi membrane,cytoplasm,endoplasmic reticulum,end…

18

51

78

NPAVLSAASFDGR.2|TTFEDLIQR.2|NVWSFLK.2|RPVGASFSFGGK…

SEN / CTL

P23246

Splicing factor, proline- and glutamine-rich

SFPQ

0.67

0.88

0.0082

0.00456

negative regulation of transcription from RNA poly…

nucleotide binding,transcription regulatory region…

chromatin,nucleus,nucleoplasm,cytoplasm,nuclear ma…

12

49

90

NLSPYVSNELLEEAFSQFGPIER.3|NLSPYVSNELLEEAFSQFGPIER….

SEN / CTL

P36578

60S ribosomal protein L4

RPL4

0.67

0.42

0.00882

0.00484

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion…

6

42

74

NIPGITLLNVSK.2|NIPGITLLNVSK.3|FC[CAM]IWTESAFR.2|KP…

SEN / CTL

P50914

60S ribosomal protein L14

RPL14

0.67

0.35

0.0132

0.00668

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pol…

cytoplasm,cytosol,cell-cell adherens junction,memb…

6

10

14

LVAIVDVIDQNR.2|LVAIVDVIDQNR.3|C[CAM]MQLTDFILK.2|C[…

SEN / CTL

P22087

rRNA 2′-O-methyltransferase fibrillarin

FBL

0.67

0.77

0.0789

0.0295

box C/D snoRNA 3′-end processing,osteoblast differ…

TFIID-class transcription factor binding,RNA bindi…

dense fibrillar component,granular component,nucle…

6

26

47

IVALNAHTFLR.3|IVALNAHTFLR.2|VSISEGDDKIEYR.3|VSISEG…

SEN / CTL

P25705

ATP synthase subunit alpha, mitochondrial

ATP5A1

0.66

0.68

2.17e-15

1.36e-14

negative regulation of endothelial cell proliferat…

protein binding,ATP binding,transmembrane transpor…

mitochondrion,mitochondrial inner membrane,mitocho…

87

55

105

TGAIVDVPVGEELLGR.2|TGAIVDVPVGEELLGR.3|EAYPGDVFYLHS…

SEN / CTL

Q14254

Flotillin-2

FLOT2

0.66

0.38

0.00177

0.00125

membrane raft assembly,cell adhesion,chemical syna…

protease binding,protein binding,ionotropic glutam…

uropod,acrosomal membrane,endosome,plasma membrane…

12

26

30

SAFSEEVNIK.2|TAEAQLAYELQGAR.2|MALVLEALPQIAAK.2|M[O…

SEN / CTL

Q02543

60S ribosomal protein L18a

RPL18A

0.66

0.67

0.0336

0.0144

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

cytosol,membrane,cytosolic large ribosomal subunit

6

17

25

EYRDLTTAGAVTQC[CAM]YR.3|DLTTAGAVTQC[CAM]YR.2|DLTTA…

SEN / CTL

Q9BZQ8

Protein Niban

FAM129A

0.65

0.41

0.000148

0.000143

negative regulation of protein phosphorylation,pos…

molecular_function,protein binding

cytoplasm,plasma membrane,membrane,extracellular e…

12

25

36

FSALLSDC[CAM]VR.2|EFPVYLWQPFFR.2|EFPVYLWQPFFR.3|QY…

SEN / CTL

P21291

Cysteine and glycine-rich protein 1

CSRP1

0.65

0.96

0.000216

0.0002

platelet aggregation

zinc ion binding,poly(A) RNA binding

nucleus,focal adhesion,extracellular exosome

21

16

31

NLDSTTVAVHGEEIYC[CAM]K.3|NLDSTTVAVHGEEIYC[CAM]K.2|…

SEN / CTL

O14950


P19105

Myosin regulatory light chain 12B;Myosin regulatory light chain 12A

MYL12B


MYL12A

0.65

0.46

0.038

0.0158

muscle contraction,regulation of cell shape;muscle…

calcium ion binding,myosin heavy chain binding;cal…

stress fiber,cytosol,brush border,myosin II comple…

27

18

38

GNFNYIEFTR.2|LNGTDPEDVIR.2|NAFAC[CAM]FDEEATGTIQEDY…

SEN / CTL

Q15149

Plectin

PLEC

0.64

0.91

9.66e-29

2.37e-27

hemidesmosome assembly,cell-cell adhesion

actin binding,protein binding,structural constitue…

cytoplasm,cytosol,plasma membrane,brush border,cel…

309

489

728

WQAVLAQTDVR.2|SQVEEELFSVR.2|VTLVQTLEIQR.2|IISLETYN…

SEN / CTL

P78417

Glutathione S-transferase omega-1

GSTO1

0.64

0.73

0.0000255

0.0000293

glutathione metabolic process,regulation of releas…

glutathione transferase activity,oxidoreductase ac…

cytoplasm,cytosol,extracellular exosome

18

28

41

VPSLVGSFIR.2|MILELFSK.2|M[Oxi]ILELFSK.2|GIRHEVININ…

SEN / CTL

Q9H082

Ras-related protein Rab-33B

RAB33B

0.64

0.46

0.0129

0.00659

protein targeting to Golgi,intra-Golgi vesicle-med…

GTPase activity,protein binding,GTP binding

Golgi membrane,Golgi apparatus,Golgi lumen,extrace…

6

4

5

IQLWDTAGQER.2|IKIQLWDTAGQER.3|IKIQLWDTAGQER.2|QHLL…

SEN / CTL

P31949

Protein S100-A11

S100A11

0.64

0.97

0.0172

0.00828

signal transduction,negative regulation of DNA rep…

calcium ion binding,protein homodimerization activ…

ruffle,extracellular space,nucleus,cytoplasm,cell-…

33

8

13

C[CAM]IESLIAVFQK.2|C[CAM]IESLIAVFQK.3|ISSPTETERC[C…

SEN / CTL

P25325

3-mercaptopyruvate sulfurtransferase

MPST

0.64

0.43

0.133

0.0446

kidney development,liver development,cyanate catab…

thiosulfate sulfurtransferase activity,3-mercaptop…

mitochondrion,cytosol,cell junction,neuron project…

3

17

26

ALVSAQWVAEALR.2|ALVSAQWVAEALR.3|ARPEDVISEGR.3|ARPE…

SEN / CTL

O15143

Actin-related protein 2/3 complex subunit 1B

ARPC1B

0.63

0.3

1.54e-11

6.1e-11

movement of cell or subcellular component,Arp2/3 c…

structural constituent of cytoskeleton,actin filam…

cytosol,Arp2/3 protein complex,focal adhesion,acti…

30

22

41

TWKPTLVILR.3|VHELKEHNGQVTGIDWAPESNR.4|VHELKEHNGQVT…

SEN / CTL

P60981

Destrin

DSTN

0.63

0.67

0.0000827

0.0000836

actin polymerization or depolymerization,actin fil…

protein binding,actin filament binding

actin cytoskeleton,cortical actin cytoskeleton,ext…

21

22

34

YALYDASFETK.2|AVIFC[CAM]LSADKK.3|AVIFC[CAM]LSADKK….

SEN / CTL

Q16774

Guanylate kinase

GUK1

0.63

0.33

0.00347

0.00222

purine nucleotide metabolic process,dGDP biosynthe…

guanylate kinase activity,ATP binding

cytosol

6

15

23

IC[CAM]VLDVDLQGVR.2|VAVQAVQAMNR.2|VAVQAVQAM[Oxi]NR…

SEN / CTL

P46777

60S ribosomal protein L5

RPL5

0.62

0.46

9.81e-7

0.00000166

ribosomal large subunit assembly,nuclear-transcrib…

RNA binding,structural constituent of ribosome,pro…

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion…

21

27

56

VGLTNYAAAYC[CAM]TGLLLAR.3|VGLTNYAAAYC[CAM]TGLLLAR….

SEN / CTL

Q16851

UTP–glucose-1-phosphate uridylyltransferase

UGP2

0.62

0.49

0.00000427

0.00000606

glycogen biosynthetic process,UDP-glucose metaboli…

UTP:glucose-1-phosphate uridylyltransferase activi…

nucleus,cytosol,extracellular exosome

24

37

59

GLPDNISSVLNK.2|EFPTVPLVK.2|SFENSLGINVPR.2|SFENSLGI…

SEN / CTL

Q9UPN3

Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5

MACF1

0.62

0.97

0.000347

0.000303

regulation of epithelial cell migration,Wnt signal…

actin binding,calcium ion binding,protein binding,…

cytoplasm,Golgi apparatus,cytoskeleton,microtubule…

18

251

298

ALLELVPWR.2|LVLDTVNEVSR.2|VIAQLEIR.2|C[CAM]DSFLHQS…

SEN / CTL

A5A3E0

POTE ankyrin domain family member F

POTEF

0.62

0.84

0.00182

0.00128

retina homeostasis

extracellular space,cell cortex,extracellular exos…

15

4

5

VAPEEHPVLLTEATLNPK.3|C[CAM]PEALFQPC[CAM]FLGMESC[CA…

SEN / CTL

P10253

Lysosomal alpha-glucosidase

GAA

0.62

1.07

0.00201

0.00139

maltose metabolic process,regulation of the force …

alpha-1,4-glucosidase activity,oligo-1,6-glucosida…

lysosome,lysosomal membrane,membrane,lysosomal lum…

18

34

49

GAYTQVIFLAR.2|QQPMALAVALTK.2|WTQLGAFYPFMR.2|WTQLGA…

SEN / CTL

O75396

Vesicle-trafficking protein SEC22b

SEC22B

0.62

0.53

0.0151

0.00746

ER to Golgi vesicle-mediated transport,retrograde …

SNARE binding,SNAP receptor activity,protein bindi…

Golgi membrane,endoplasmic reticulum membrane,endo…

9

15

21

VLLTMIAR.2|VLLTM[Oxi]IAR.2|NLGSINTELQDVQR.2|IMVANI…

SEN / CTL

Q9BUI4

DNA-directed RNA polymerase III subunit RPC3

POLR3C

0.62

0.2

0.0304

0.0133

regulation of transcription from RNA polymerase II…

DNA binding,DNA-directed RNA polymerase activity,p…

nucleus,nucleoplasm,DNA-directed RNA polymerase II…

3

15

17

SLPVGYNISK.2|VIAHDTGTSLDQVK.3|VIAHDTGTSLDQVK.2|SGD…

SEN / CTL

Q13492

Phosphatidylinositol-binding clathrin assembly protein

PICALM

0.62

0.41

0.127

0.043

protein complex assembly,receptor-mediated endocyt…

protein binding,1-phosphatidylinositol binding,cla…

nucleus,Golgi apparatus,clathrin-coated pit,cell-c…

3

26

37

ATTLSNAVSSLASTGLSLTK.3|ATTLSNAVSSLASTGLSLTK.2|EKQA…

SEN / CTL

Q14914

Prostaglandin reductase 1

PTGR1

0.61

0.25

7.18e-12

3.08e-11

leukotriene metabolic process,prostaglandin metabo…

zinc ion binding,2-alkenal reductase [NAD(P)] acti…

cytoplasm,extracellular exosome

27

22

35

MEAFVVYR.2|IAIC[CAM]GAISTYNR.2|LGFDVVFNYK.2|HFVGYP…

SEN / CTL

P16152

Carbonyl reductase [NADPH] 1

CBR1

0.61

0.36

9.94e-10

2.98e-9

drug metabolic process,cyclooxygenase pathway,epit…

carbonyl reductase (NADPH) activity,oxidoreductase…

cytosol,extracellular exosome,extracellular vesicl…

30

26

43

LFSGDVVLTAR.2|FHQLDIDDLQSIR.3|FHQLDIDDLQSIR.2|DVC[…

SEN / CTL

P07585

Decorin

DCN

0.61

0.48

1.45e-9

4.21e-9

kidney development,placenta development,negative r…

protein kinase inhibitor activity,protein binding,…

extracellular region,collagen type VI trimer,extra…

42

22

33

NLHALILVNNK.3|NLHALILVNNK.2|VSPGAFTPLVKLER.3|KVTFN…

SEN / CTL

P62136

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

PPP1CA

0.61

0.42

6.01e-7

0.00000105

glycogen metabolic process,regulation of glycogen …

phosphoprotein phosphatase activity,protein serine…

protein phosphatase type 1 complex,nucleus,nucleop…

24

29

46

IKYPENFFLLR.3|AHQVVEDGYEFFAKR.3|AHQVVEDGYEFFAKR.4|…

SEN / CTL

P35754

Glutaredoxin-1

GLRX

0.61

0.35

9.98e-7

0.00000167

nucleobase-containing small molecule interconversi…

electron carrier activity,glutathione disulfide ox…

nucleus,mitochondrion,cytosol,extracellular exosom…

18

7

11

AQEILSQLPIK.2|RAQEILSQLPIK.3|RAQEILSQLPIK.2|QGLLEF…

SEN / CTL

P62424

60S ribosomal protein L7a

RPL7A

0.61

0.65

0.000181

0.000172

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,nucleolus,cytoplasm,cytosol,cell-cell adhe…

15

31

43

AQLVVIAHDVDPIELVVFLPALC[CAM]R.3|AQLVVIAHDVDPIELVVF…

SEN / CTL

Q9BQE3

Tubulin alpha-1C chain

TUBA1C

0.61

0.23

0.000991

0.000756

cytoskeleton organization,microtubule-based proces…

GTPase activity,structural molecule activity,struc…

nucleus,cytoplasm,microtubule,vesicle

6

3

10

AVC[CAM]MLSNTTAVAEAWAR.3|AVC[CAM]MLSNTTAVAEAWAR.2|…

SEN / CTL

P36957

Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial

DLST

0.61

0.96

0.00125

0.00092

generation of precursor metabolites and energy,tri…

dihydrolipoyllysine-residue succinyltransferase ac…

nucleus,mitochondrial matrix,membrane,myelin sheat…

18

27

40

LGFMSAFVK.2|LGFM[Oxi]SAFVK.2|GLVVPVIR.2|TPAFAESVTE…

SEN / CTL

O43790


P78385


Q14533

Keratin, type II cuticular Hb6;Keratin, type II cuticular Hb3;Keratin, type II cuticular Hb1

KRT86


KRT83


KRT81

0.61

2.27

0.00462

0.00279

;aging,epidermis development,hair cycle;

structural molecule activity,protein binding;struc…

extracellular space,keratin filament,extracellular…

18

6

6

LGLDIEIATYR.2|DVDC[CAM]AYLR.2|ATAENEFVALKK.3|FAAFI…

SEN / CTL

P40121

Macrophage-capping protein

CAPG

0.59

0.8

0.0000674

0.0000703

protein complex assembly,barbed-end actin filament…

actin binding,protein binding,protein domain speci…

nucleus,nucleoplasm,nucleolus,cytoplasm,centriole,…

33

22

39

QAALQVAEGFISR.2|QAALQVAEGFISR.3|VADSSPFALELLISDDC[…

SEN / CTL

P0CG39

POTE ankyrin domain family member J

POTEJ

0.59

0.12

0.0138

0.00687

retina homeostasis

extracellular space,extracellular exosome

3

2

3

LC[CAM]YVALDFEQEMAMVASSSSLEK.3|LC[CAM]YVALDFEQEMAM…

SEN / CTL

Q96BW5

Phosphotriesterase-related protein

PTER

0.59

1.58

0.0454

0.0185

catabolic process,epithelial cell differentiation

molecular_function,zinc ion binding,hydrolase acti…

extracellular exosome

36

18

21

VQTVLGLVEPSKLGR.3|AMSVEQLTDVLMNEILHGADGTSIK.3|ILQE…

SEN / CTL

Q92542

Nicastrin

NCSTN

0.59

0.83

0.0714

0.027

myeloid cell homeostasis,proteolysis,membrane prot…

endopeptidase activity,protein binding

lysosomal membrane,endoplasmic reticulum,Golgi app…

6

10

12

LLYGFLIK.2|ALADVATVLGR.2|APDVTTLPR.2|ADVLFIAPR.2|S…

SEN / CTL

Q09666

Neuroblast differentiation-associated protein AHNAK

AHNAK

0.58

0.75

1.22e-32

4.11e-31

regulation of RNA splicing,protein oligomerization…

protein binding,S100 protein binding,poly(A) RNA b…

nucleus,cytoplasm,lysosomal membrane,cytosol,plasm…

447

433

666

ISMPDLDLNLKGPK.3|ISMPDLDLNLKGPK.2|ISIPDVDLDLKGPK.3…

SEN / CTL

P17987

T-complex protein 1 subunit alpha

TCP1

0.58

0.32

2.56e-10

8.86e-10

protein folding,tubulin complex assembly,binding o…

protein binding,ATP binding,ubiquitin protein liga…

pericentriolar material,acrosomal vesicle,zona pel…

48

42

75

EQLAIAEFAR.2|TSASIILR.2|IAC[CAM]LDFSLQK.2|IC[CAM]D…

SEN / CTL

Q9Y678

Coatomer subunit gamma-1

COPG1

0.58

0.39

0.0000403

0.0000438

intracellular protein transport,ER to Golgi vesicl…

structural molecule activity

Golgi membrane,endoplasmic reticulum membrane,Golg…

15

60

99

TLEEAVGNIVK.2|SIATLAITTLLK.2|SIATLAITTLLK.3|FGAQNE…

SEN / CTL

Q9Y6U3

Adseverin

SCIN

0.58

0.93

0.00386

0.00242

negative regulation of cell proliferation,calcium …

phosphatidylserine binding,actin binding,calcium i…

cytoplasm,cytoskeleton,brush border,cell cortex,pr…

12

34

43

LYMVSDASGSMR.2|GASQEEEKGAEYVASVLK.3|NTQIQVLPEGGETP…

SEN / CTL

P15289

Arylsulfatase A

ARSA

0.57

0.26

3.6e-8

7.98e-8

glycosphingolipid metabolic process,post-translati…

arylsulfatase activity,cerebroside-sulfatase activ…

lysosome,endoplasmic reticulum lumen,lysosomal lum…

18

9

16

GGLPLEEVTVAEVLAAR.2|GGLPLEEVTVAEVLAAR.3|QSLFFYPSYP…

SEN / CTL

O00154

Cytosolic acyl coenzyme A thioester hydrolase

ACOT7

0.57

0.3

0.00000171

0.00000269

coenzyme A biosynthetic process,long-chain fatty-a…

fatty-acyl-CoA binding,protein binding,palmitoyl-C…

nucleoplasm,cytoplasm,mitochondrion,cytosol,extrac…

18

22

42

ATLWYVPLSLK.2|MIEEAGAIISTR.2|MIEEAGAIISTR.3|M[Oxi]…

SEN / CTL

P54136

Arginine–tRNA ligase, cytoplasmic

RARS

0.57

0.74

0.00000909

0.0000119

tRNA aminoacylation for protein translation,arginy…

tRNA binding,arginine-tRNA ligase activity,protein…

nucleoplasm,cytoplasm,mitochondrion,cytosol,cell-c…

27

61

93

IVFVPGC[CAM]SIPLTIVK.2|IVFVPGC[CAM]SIPLTIVK.3|LMDL…

SEN / CTL

O75348

V-type proton ATPase subunit G 1

ATP6V1G1

0.57

0.36

0.0000729

0.0000751

insulin receptor signaling pathway,regulation of m…

protein binding,hydrogen-exporting ATPase activity…

lysosomal membrane,cytosol,plasma membrane,vacuola…

9

8

13

MTILQTYFR.2|M[Oxi]TILQTYFR.2|QNRDEVLDNLLAFVC[CAM]D…

SEN / CTL

P62140

Serine/threonine-protein phosphatase PP1-beta catalytic subunit

PPP1CB

0.57

0.31

0.0115

0.00598

G2/M transition of mitotic cell cycle,glycogen met…

protein binding,phosphatase activity,myosin phosph…

protein phosphatase type 1 complex,nucleus,nucleop…

6

11

14

IVQMTEAEVR.2|IVQM[Oxi]TEAEVR.2|FLNRHDLDLIC[CAM]R.3…

SEN / CTL

P22307

Non-specific lipid-transfer protein

SCP2

0.57

0.96

0.0341

0.0146

bile acid biosynthetic process,peroxisome organiza…

fatty-acyl-CoA binding,receptor binding,protein bi…

nucleoplasm,cytoplasm,mitochondrion,peroxisome,per…

6

34

57

IGGIFAFK.2|EATWVVDVK.2|DYPDLAEEAGKK.3|DYPDLAEEAGKK…

SEN / CTL

P55084

Trifunctional enzyme subunit beta, mitochondrial

HADHB

0.56

0.41

0.0000173

0.0000207

fatty acid beta-oxidation,cardiolipin acyl-chain r…

3-hydroxyacyl-CoA dehydrogenase activity,acetyl-Co…

mitochondrion,mitochondrial envelope,mitochondrial…

15

41

75

LAAAFAVSR.2|FNNWGGSLSLGHPFGATGC[CAM]R.3|FNNWGGSLSL…

SEN / CTL

P50991

T-complex protein 1 subunit delta

CCT4

0.56

0.79

0.0000697

0.0000723

protein folding,binding of sperm to zona pellucida…

ATP binding,poly(A) RNA binding,unfolded protein b…

zona pellucida receptor complex,nucleoplasm,cytopl…

51

44

86

VIDPATATSVDLRDIK.3|ALIAGGGAPEIELALR.2|ALIAGGGAPEIE…

SEN / CTL

P28482

Mitogen-activated protein kinase 1

MAPK1

0.56

0.28

0.000168

0.000161

MAPK cascade,activation of MAPK activity,MAPK impo…

phosphotyrosine binding,DNA binding,protein serine…

nucleus,nucleoplasm,cytoplasm,mitochondrion,early …

12

27

46

LKELIFEETAR.3|LKELIFEETAR.2|VADPDHDHTGFLTEYVATR.4|…

SEN / CTL

P36542

ATP synthase subunit gamma, mitochondrial

ATP5C1

0.56

1.45

0.00446

0.0027

oxidative phosphorylation,ATP biosynthetic process…

transmembrane transporter activity,poly(A) RNA bin…

mitochondrial proton-transporting ATP synthase com…

15

21

34

IYGLGSLALYEK.2|IYGLGSLALYEK.3|EVMLVGIGDKIR.3|THSDQ…

SEN / CTL

P22392

Nucleoside diphosphate kinase B

NME2

0.56

0.55

0.0864

0.0319

negative regulation of myeloid leukocyte different…

DNA binding,transcription factor activity, sequenc…

ruffle,nucleus,cytoplasm,cytosol,intermediate fila…

18

19

36

GDFC[CAM]IQVGR.2|SC[CAM]AHDWVYE.2|SAEKEISLWFKPEELV…

SEN / CTL

Q14764

Major vault protein

MVP

0.55

0.75

7.9e-15

4.54e-14

protein transport,negative regulation of signaling…

protein binding,protein kinase binding,protein pho…

nucleus,nuclear pore,cytoplasm,cytoskeleton,membra…

168

78

128

SFFLQPGEQLEQGIQDVYVLSEQQGLLLR.3|SFFLQPGEQLEQGIQDVY…

SEN / CTL

Q7KZF4

Staphylococcal nuclease domain-containing protein 1

SND1

0.55

0.55

0.0000272

0.0000309

osteoblast differentiation,transcription, DNA-temp…

transcription cofactor activity,nuclease activity,…

nucleus,cytoplasm,mitochondrion,cell-cell adherens…

39

71

115

QFLPFLQR.2|ETC[CAM]LITFLLAGIEC[CAM]PR.3|ETC[CAM]LI…

SEN / CTL

P62879

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

GNB2

0.55

0.26

0.00112

0.000834

protein folding,G-protein coupled receptor signali…

GTPase activity,signal transducer activity,calcium…

extracellular space,lysosomal membrane,cytosol,pla…

9

15

25

TFVSGAC[CAM]DASIK.2|KAC[CAM]GDSTLTQITAGLDPVGR.3|KA…

SEN / CTL

P08670

Vimentin

VIM

0.54

1.17

2.04e-19

2.12e-18

movement of cell or subcellular component,positive…

glycoprotein binding,double-stranded RNA binding,s…

cytoplasm,peroxisome,cytosol,cytoskeleton,intermed…

336

92

187

ILLAELEQLKGQGK.3|ILLAELEQLKGQGK.2|ISLPLPNFSSLNLR.2…

SEN / CTL

P51452

Dual specificity protein phosphatase 3

DUSP3

0.54

0.33

0.0000113

0.0000145

inactivation of MAPK activity,in utero embryonic d…

protein tyrosine phosphatase activity,protein tyro…

immunological synapse,nucleus,nucleoplasm,cytoplas…

12

10

15

LGITHVLNAAEGR.3|LGITHVLNAAEGR.2|SPTLVIAYLMMR.2|SPT…

SEN / CTL

P04843

Dolichyl-diphosphooligosaccharide–protein glycosyltransferase subunit 1

RPN1

0.54

1.21

0.000817

0.00064

cellular protein modification process,protein N-li…

protein binding,poly(A) RNA binding,dolichyl-dipho…

endoplasmic reticulum membrane,rough endoplasmic r…

21

48

79

ALTSEIALLQSR.2|ALTSEIALLQSR.3|FFTVKLPVALDPGAK.3|ID…

SEN / CTL

Q13596

Sorting nexin-1

SNX1

0.54

0.23

0.000969

0.00075

intracellular protein transport,vesicle organizati…

epidermal growth factor receptor binding,insulin r…

cytoplasm,Golgi apparatus,cytosol,cell-cell adhere…

6

24

29

YWEAFLPEAK.2|AVGTQTLSGAGLLK.2|VKVGKEDSSSAEFLEK.4|V…

SEN / CTL

O14936

Peripheral plasma membrane protein CASK

CASK

0.54

0.8

0.00694

0.00396

negative regulation of cell-matrix adhesion,protei…

guanylate kinase activity,protein serine/threonine…

basement membrane,nuclear lamina,nucleolus,cytopla…

9

32

43

ITVYEALNHPWLK.3|ITVYEALNHPWLK.2|IHEQGLIAILDVEPQALK…

SEN / CTL

P63167


Q96FJ2

Dynein light chain 1, cytoplasmic;Dynein light chain 2, cytoplasmic

DYNLL1


DYNLL2

0.54

0.19

0.0255

0.0116

G2/M transition of mitotic cell cycle,transcriptio…

motor activity,protein binding;motor activity,cyto…

kinetochore,nucleus,cytoplasm,mitochondrion,centro…

3

1

2

YNPTWHC[CAM]IVGR.3|YNPTWHC[CAM]IVGR.2

SEN / CTL

P10301

Ras-related protein R-Ras

RRAS

0.54

0.69

0.146

0.0479

leukocyte differentiation,Ras protein signal trans…

GTPase activity,protein binding,GTP binding,GDP bi…

intracellular,plasma membrane,focal adhesion,extra…

9

13

15

LVVVGGGGVGK.2|LNVDEAFEQLVR.2|SEASAFGASHHVAYFEASAK….

SEN / CTL

P30085

UMP-CMP kinase

CMPK1

0.53

0.5

0.00000106

0.00000176

nucleoside diphosphate phosphorylation,’de novo’ p…

cytidylate kinase activity,nucleoside diphosphate …

nucleus,cytoplasm,cytosol,extracellular exosome

30

19

38

FLIDGFPR.2|IVPVEITISLLKR.3|IVPVEITISLLKR.2|SVDEVFD…

SEN / CTL

Q2TAA2

Isoamyl acetate-hydrolyzing esterase 1 homolog

IAH1

0.53

0.27

0.00058

0.000474

lipid catabolic process

hydrolase activity

extracellular exosome

9

7

10

VSSLPLLLPYWR.2|DVAEAKPELSLLGDGDH.3|DVAEAKPELSLLGDG…

SEN / CTL

Q9UEY8

Gamma-adducin

ADD3

0.53

0.47

0.00233

0.00157

cytoskeleton organization,transmembrane transport

actin binding,structural constituent of cytoskelet…

condensed nuclear chromosome,nucleoplasm,cytoplasm…

9

31

36

GLSFSEATASNLVK.2|VGEIEFEGLMR.2|YFDRINENDPEYIRER.4|…

SEN / CTL

Q06323

Proteasome activator complex subunit 1

PSME1

0.52

0.65

0.00000115

0.00000189

MAPK cascade,protein polyubiquitination,stimulator…

endopeptidase activator activity

proteasome complex,nucleoplasm,cytoplasm,cytosol,p…

42

26

39

IEDGNNFGVAVQEK.2|TENLLGSYFPK.2|IVVLLQR.2|QLVHELDEA…

SEN / CTL

Q99439

Calponin-2

CNN2

0.52

0.47

0.00000192

0.00000298

cytoskeleton organization,actomyosin structure org…

actin binding,calmodulin binding,cadherin binding …

stress fiber,cytoskeleton,cell-cell junction,cell-…

24

17

33

TWIEGLTGLSIGPDFQK.2|TWIEGLTGLSIGPDFQK.3|GLKDGTILC[…

SEN / CTL

A6NGU5


P19440


P36268

Putative gamma-glutamyltranspeptidase 3;Gamma-glutamyltranspeptidase 1;Inactive gamma-glutamyltranspeptidase 2

GGT3P


GGT1


GGT2

0.52

0.48

0.00154

0.00111

proteolysis,glutathione metabolic process,glutathi…

gamma-glutamyltransferase activity,glutathione hyd…

integral component of membrane,anchored component …

9

3

3

LFQPSIQLAR.2|NIDQAVTAALETR.2|FVDVTEVVR.2

SEN / CTL

Q14344

Guanine nucleotide-binding protein subunit alpha-13

GNA13

0.52

0.26

0.00418

0.00256

patterning of blood vessels,in utero embryonic dev…

GTPase activity,signal transducer activity,protein…

nucleus,cytoplasm,heterotrimeric G-protein complex…

6

19

25

ILLLGAGESGK.2|VFLQYLPAIR.2|IIHGQDFDQR.3|IIHGQDFDQR…

SEN / CTL

P36776

Lon protease homolog, mitochondrial

LONP1

0.52

1.23

0.00683

0.00392

mitochondrial genome maintenance,response to hypox…

single-stranded DNA binding,single-stranded RNA bi…

nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch…

12

52

82

ILC[CAM]FYGPPGVGK.2|LSSDVLTLLIK.2|ILEFIAVSQLR.2|IL…

SEN / CTL

P20674

Cytochrome c oxidase subunit 5A, mitochondrial

COX5A

0.52

0.42

0.0179

0.00856

mitochondrial electron transport, cytochrome c to …

cytochrome-c oxidase activity,electron carrier act…

mitochondrial inner membrane,mitochondrial respira…

6

11

21

WVTYFNKPDIDAWELRK.4|WVTYFNKPDIDAWELRK.3|WVTYFNKPDI…

SEN / CTL

P31040

Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SDHA

0.52

0.59

0.0987

0.0354

tricarboxylic acid cycle,succinate metabolic proce…

protein binding,succinate dehydrogenase (ubiquinon…

mitochondrion,mitochondrial inner membrane,mitocho…

9

38

71

LGANSLLDLVVFGR.2|LGANSLLDLVVFGR.3|TYFSC[CAM]TSAHTS…

SEN / CTL

P32119

Peroxiredoxin-2

PRDX2

0.51

0.52

9.74e-10

2.98e-9

response to reactive oxygen species,response to ox…

thioredoxin peroxidase activity,antioxidant activi…

cytoplasm,cytosol,extracellular exosome

57

24

40

GLFIIDGK.2|LSEDYGVLKTDEGIAYR.3|KEGGLGPLNIPLLADVTR….

SEN / CTL

P07339

Cathepsin D

CTSD

0.51

0.81

0.00000927

0.000012

proteolysis,autophagy,antigen processing and prese…

aspartic-type endopeptidase activity,cysteine-type…

extracellular region,extracellular space,lysosome,…

42

30

62

VSTLPAITLK.2|FDGILGMAYPR.2|FDGILGM[Oxi]AYPR.2|QVFG…

SEN / CTL

P21281

V-type proton ATPase subunit B, brain isoform

ATP6V1B2

0.51

0.47

0.0000187

0.0000222

insulin receptor signaling pathway,ATP hydrolysis …

ATP binding,hydrogen ion transmembrane transporter…

ruffle,lysosomal membrane,cytosol,plasma membrane,…

24

28

43

IYPEEMIQTGISAIDGMNSIAR.3|TVFETLDIGWQLLR.2|TVFETLDI…

SEN / CTL

O43776

Asparagine–tRNA ligase, cytoplasmic

NARS

0.51

0.79

0.0017

0.0012

tRNA aminoacylation for protein translation,aspara…

nucleic acid binding,asparagine-tRNA ligase activi…

cytoplasm,mitochondrion,cytosol,extracellular exos…

21

33

60

FLTWILNR.2|IFDSEEILAGYKR.3|IFDSEEILAGYKR.2|NLMFLVL…

SEN / CTL

Q8NHP8

Putative phospholipase B-like 2

PLBD2

0.51

1.72

0.0502

0.0201

lipid catabolic process

hydrolase activity

lysosomal lumen,extracellular exosome

15

15

20

YNDFLHDPLSLC[CAM]K.3|YNDFLHDPLSLC[CAM]K.2|LASDGATW…

SEN / CTL

Q9Y2Q5

Ragulator complex protein LAMTOR2

LAMTOR2

0.51

0.17

0.0511

0.0204

MAPK cascade,activation of MAPKK activity,cell cyc…

protein binding,guanyl-nucleotide exchange factor …

lysosomal membrane,late endosome,endosome membrane…

3

9

12

FILMDC[CAM]MEGR.2|ETVGFGMLK.2|VTAAIASNIWAAYDR.3|VT…

SEN / CTL

Q9NR28

Diablo homolog, mitochondrial

DIABLO

0.51

0.98

0.0878

0.0322

apoptotic process,activation of cysteine-type endo…

protein binding

mitochondrion,mitochondrial intermembrane space,cy…

12

12

19

AVYTLTSLYR.2|LQVEEVHQLSR.3|LQVEEVHQLSR.2|TQEEGEER….

SEN / CTL

P62266

40S ribosomal protein S23

RPS23

0.51

0.35

0.124

0.0422

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,protein binding…

nucleoplasm,nucleolus,cytoplasm,cytosol,ribosome,m…

3

11

14

VANVSLLALYK.2|AHLGTALK.2|KGHAVGDIPGVR.3|KGHAVGDIPG…

SEN / CTL

Q92599

Septin-8

8-Sep

0.51

0.58

0.134

0.0448

protein binding,GTP binding

cytoplasm,cytoskeleton,myelin sheath

9

17

23

VNIIPIIAK.2|LRPQTYDLQESNVQLK.3|LRPQTYDLQESNVQLK.2|…

SEN / CTL

P07384

Calpain-1 catalytic subunit

CAPN1

0.5

0.4

1.78e-8

4.36e-8

proteolysis,positive regulation of cell proliferat…

calcium-dependent cysteine-type endopeptidase acti…

cytoplasm,mitochondrion,lysosome,cytosol,plasma me…

54

51

72

EFTRLEIC[CAM]NLTPDALK.3|LYELIITR.2|DFFLANASR.2|YLG…

SEN / CTL

P35580

Myosin-10

MYH10

0.5

0.76

0.00000281

0.0000042

mitotic cytokinesis,in utero embryonic development…

microfilament motor activity,actin binding,protein…

stress fiber,nucleus,cytoplasm,mitochondrion,spind…

60

183

307

AGKLDPHLVLDQLR.3|AGKLDPHLVLDQLR.2|LDPHLVLDQLR.2|LD…

SEN / CTL

Q9BUL8

Programmed cell death protein 10

PDCD10

0.5

0.15

0.000656

0.00053

angiogenesis,positive regulation of cell prolifera…

protein binding,protein kinase binding,protein hom…

Golgi membrane,cytoplasm,Golgi apparatus,cytosol,p…

6

12

17

VNLSAAQTLR.2|SVEVNFTESLLR.2|ELLDTVNNVFKK.3|ELLDTVN…

SEN / CTL

O00232

26S proteasome non-ATPase regulatory subunit 12

PSMD12

0.5

0.73

0.00249

0.00165

MAPK cascade,protein polyubiquitination,stimulator…

proteasome complex,nucleoplasm,cytoplasm,cytosol,p…

15

37

54

IYVEIER.2|LFTTMELMR.2|LQEVIETLLSLEK.2|LQEVIETLLSLE…

SEN / CTL

P15880

40S ribosomal protein S2

RPS2

0.5

0.37

0.0319

0.0139

nuclear-transcribed mRNA catabolic process, nonsen…

mRNA binding,structural constituent of ribosome,pr…

nucleus,nucleoplasm,cytoplasm,cytosol,cell-cell ad…

6

20

34

TYSYLTPDLWK.2|KLLMMAGIDDC[CAM]YTSAR.3|KLLMM[Oxi]AG…

SEN / CTL

Q9NRX4

14 kDa phosphohistidine phosphatase

PHPT1

0.5

0.38

0.0368

0.0154

protein dephosphorylation,positive regulation of i…

phosphoprotein phosphatase activity,phosphohistidi…

cytosol,extracellular exosome

9

8

18

AKYPDYEVTWANDGY.2|IHVYGYSMAYGPAQHAISTEK.4|IHVYGYSM…

SEN / CTL

P08727

Keratin, type I cytoskeletal 19

KRT19

0.49

0.6

6.17e-11

2.35e-10

Notch signaling pathway,viral process,response to …

structural constituent of cytoskeleton,protein bin…

intermediate filament,plasma membrane,dystrophin-a…

90

47

93

IVLQIDNAR.2|DAEAWFTSR.2|VLDELTLAR.2|FGAQLAHIQALISG…

SEN / CTL

Q14315

Filamin-C

FLNC

0.49

1.01

0.0000027

0.00000408

cell junction assembly,muscle fiber development

protein binding,cytoskeletal protein binding,ankyr…

cytoplasm,cytosol,cytoskeleton,plasma membrane,foc…

36

144

206

YGGDEIPYSPFR.2|VAVGQEQAFSVNTR.2|GVAGVPAEFSIWTR.2|G…

SEN / CTL

P53618

Coatomer subunit beta

COPB1

0.49

0.34

0.0000114

0.0000145

intracellular protein transport,ER to Golgi vesicl…

structural molecule activity,protein binding

Golgi membrane,cytoplasm,endoplasmic reticulum mem…

15

73

120

LKEAELLEPLMPAIR.3|LKEAELLEPLM[Oxi]PAIR.3|VLQDLVMDI…

SEN / CTL

P11142

Heat shock cognate 71 kDa protein

HSPA8

0.49

0.89

0.000244

0.000221

mRNA splicing, via spliceosome,transcription, DNA-…

G-protein coupled receptor binding,phosphatidylser…

Prp19 complex,extracellular space,intracellular,nu…

144

54

126

SQIHDIVLVGGSTR.3|SQIHDIVLVGGSTR.2|QATKDAGTIAGLNVLR…

SEN / CTL

Q92878

DNA repair protein RAD50

RAD50

0.49

0.13

0.119

0.041

regulation of mitotic recombination,telomere maint…

DNA binding,double-stranded telomeric DNA binding,…

nuclear chromosome, telomeric region,nuclear chrom…

3

75

89

VLASLIIR.2|TTELVNK.2|LEENIDNIKR.3|GYEEEIIHFK.3|NHN…

SEN / CTL

P19367

Hexokinase-1

HK1

0.48

0.48

1.05e-10

3.95e-10

cellular glucose homeostasis,glycolytic process,gl…

glucokinase activity,hexokinase activity,ATP bindi…

mitochondrion,mitochondrial outer membrane,cytosol…

63

46

62

SANLVAATLGAILNR.2|SANLVAATLGAILNR.3|TTVGVDGSLYK.2|…

SEN / CTL

Q15181

Inorganic pyrophosphatase

PPA1

0.48

0.43

8.74e-7

0.00000149

tRNA aminoacylation for protein translation,phosph…

magnesium ion binding,inorganic diphosphatase acti…

cytoplasm,cytosol,extracellular exosome

45

30

65

AAPFSLEYR.2|LKPGYLEATVDWFRR.3|LKPGYLEATVDWFRR.4|YV…

SEN / CTL

Q9NQR4

Omega-amidase NIT2

NIT2

0.48

0.37

0.00000133

0.00000217

oxaloacetate metabolic process,asparagine metaboli…

omega-amidase activity

cytoplasm,mitochondrion,centrosome,extracellular e…

30

28

39

FAELAQIYAQR.2|FAELAQIYAQR.3|VGLGIC[CAM]YDMR.2|IVSL…

SEN / CTL

P61204


P84077

ADP-ribosylation factor 3;ADP-ribosylation factor 1

ARF3


ARF1

0.48

0.47

0.00435

0.00265

phosphatidylinositol biosynthetic process,retrogra…

GTPase activity,GTP binding;magnesium ion binding,…

Golgi membrane,perinuclear region of cytoplasm,ext…

9

3

10

ILMVGLDAAGK.2|ILM[Oxi]VGLDAAGK.2|NISFTVWDVGGQDKIRP…

SEN / CTL

P49591

Serine–tRNA ligase, cytoplasmic

SARS

0.48

1.29

0.0303

0.0133

translation,tRNA aminoacylation for protein transl…

RNA binding,serine-tRNA ligase activity,ATP bindin…

cytoplasm,cytosol,extracellular exosome

21

41

63

VLDLDLFR.2|LLIDEAILK.2|KLDLEAWFPGSGAFR.3|KLDLEAWFP…

SEN / CTL

Q9UNF0

Protein kinase C and casein kinase substrate in neurons protein 2

PACSIN2

0.48

1.21

0.0599

0.0235

actin cytoskeleton organization,regulation of endo…

transporter activity,protein binding,cytoskeletal …

nucleoplasm,cytoplasm,early endosome,cytosol,cytos…

21

22

29

AYAQQLTEWAR.2|AIYHDLEQSIR.3|AIYHDLEQSIR.2|HLDLSNVA…

SEN / CTL

P06730

Eukaryotic translation initiation factor 4E

EIF4E

0.48

0.51

0.0968

0.0347

G1/S transition of mitotic cell cycle,nuclear-tran…

RNA cap binding,translation initiation factor acti…

cytoplasmic mRNA processing body,cytoplasm,cytosol…

6

10

12

WLITLNK.2|IAIWTTEC[CAM]ENR.2|EAVTHIGR.2|TWQANLR.2|…

SEN / CTL

P41250

Glycine–tRNA ligase

GARS

0.47

0.39

3.07e-8

6.98e-8

tRNA aminoacylation for protein translation,glycyl…

bis(5′-nucleosyl)-tetraphosphatase (asymmetrical) …

nucleoplasm,cytoplasm,mitochondrial matrix,cytosol…

27

46

82

LLEFNQGKLPFAAAQIGNSFR.3|TFFSFPAVVAPFK.2|TFFSFPAVVA…

SEN / CTL

Q9UJZ1

Stomatin-like protein 2, mitochondrial

STOML2

0.47

0.28

0.000399

0.000341

mitochondrial calcium ion transport,cellular calci…

receptor binding,protein binding,GTPase binding,ca…

mitochondrial inner membrane,mitochondrial interme…

12

28

44

ILEPGLNILIPVLDR.2|ILEPGLNILIPVLDR.3|ESLNASIVDAINQA…

SEN / CTL

P49773

Histidine triad nucleotide-binding protein 1

HINT1

0.47

0.74

0.00212

0.00145

transcription, DNA-templated,regulation of transcr…

nucleotide binding,protein kinase C binding,hydrol…

histone deacetylase complex,nucleus,cytoplasm,cyto…

21

13

35

AQVARPGGDTIFGK.3|AQVARPGGDTIFGK.2|IIFEDDRC[CAM]LAF…

SEN / CTL

P62491


Q15907

Ras-related protein Rab-11A;Ras-related protein Rab-11B

RAB11A


RAB11B

0.47

0.26

0.00249

0.00165

cytokinesis,renal water homeostasis,mitotic metaph…

GTPase activity,protein binding,GTP binding,microt…

spindle pole,mitochondrion,multivesicular body,Gol…

9

3

4

STIGVEFATR.2|VVLIGDSGVGK.2|GAVGALLVYDIAK.2|GAVGALL…

SEN / CTL

P31930

Cytochrome b-c1 complex subunit 1, mitochondrial

UQCRC1

0.47

0.97

0.00665

0.00384

oxidative phosphorylation,mitochondrial electron t…

metalloendopeptidase activity,ubiquinol-cytochrome…

mitochondrion,mitochondrial inner membrane,mitocho…

9

36

66

IAEVDASVVR.2|ADLTEYLSTHYKAPR.4|ADLTEYLSTHYKAPR.3|N…

SEN / CTL

P35579

Myosin-9

MYH9

0.46

0.86

1.51e-19

1.69e-18

meiotic spindle organization,cytokinesis,angiogene…

microfilament motor activity,motor activity,actin …

stress fiber,ruffle,uropod,nucleus,cytoplasm,spind…

609

240

477

LQQELDDLLVDLDHQR.3|LQQELDDLLVDLDHQR.2|VSHLLGINVTDF…

SEN / CTL

Q14847

LIM and SH3 domain protein 1

LASP1

0.46

0.37

3.66e-7

6.72e-7

ion transport,positive regulation of signal transd…

SH3/SH2 adaptor activity,protein binding,zinc ion …

cytoplasm,cell-cell adherens junction,focal adhesi…

36

20

35

GKGFSVVADTPELQR.3|RPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGG…

SEN / CTL

P06756

Integrin alpha-V

ITGAV

0.46

0.5

0.0011

0.000827

angiogenesis,antigen processing and presentation o…

virus receptor activity,fibronectin binding,protea…

plasma membrane,integral component of plasma membr…

30

49

56

ILAC[CAM]APLYHWR.3|IYIGDDNPLTLIVK.2|GATDIDKNGYPDLI…

SEN / CTL

Q5JTV8

Torsin-1A-interacting protein 1

TOR1AIP1

0.46

0.35

0.00274

0.0018

positive regulation of ATPase activity,protein loc…

ATPase activator activity,lamin binding,cytoskelet…

nucleus,nuclear inner membrane,integral component …

9

21

26

SQPAILLLTAAR.2|SIQEAPVSEDLVIR.2|ISHLVLPVQPENALKR.4…

SEN / CTL

Q9ULV4

Coronin-1C

CORO1C

0.46

0.88

0.00447

0.0027

neural crest cell migration,regulation of protein …

protein binding,Rac GTPase binding,actin filament …

cytoplasm,focal adhesion,actin cytoskeleton,latera…

27

36

54

VTWDSSFC[CAM]AVNPR.2|NADPILISLK.2|AIFLADGNVFTTGFSR…

SEN / CTL

P62495

Eukaryotic peptide chain release factor subunit 1

ETF1

0.46

0.42

0.00519

0.0031

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,translation release factor activity,pr…

cytoplasm,cytosol,nucleus

9

35

53

LSVLGAITSVQQR.2|LSVLGAITSVQQR.3|GFGGIGGILR.2|FTVDL…

SEN / CTL

Q9UHL4

Dipeptidyl peptidase 2

DPP7

0.46

1.04

0.0412

0.017

proteolysis

serine-type carboxypeptidase activity,serine-type …

lysosome,Golgi apparatus,cytosol,cytoplasmic, memb…

15

18

27

GHTELLTVEQALADFAELLR.3|DVTADFEGQSPK.2|KLEATIIGEWVK…

SEN / CTL

P29218

Inositol monophosphatase 1

IMPA1

0.46

1.3

0.0658

0.0252

inositol metabolic process,inositol biosynthetic p…

magnesium ion binding,inositol monophosphate 1-pho…

cytoplasm,cytosol,extracellular exosome

9

16

22

LFC[CAM]IPVHGIR.3|LFC[CAM]IPVHGIR.2|EIQVIPLQRDDED….

SEN / CTL

P62333

26S protease regulatory subunit 10B

PSMC6

0.45

0.35

0.0000027

0.00000408

MAPK cascade,protein polyubiquitination,stimulator…

protein binding,ATP binding,ATPase activity,TBP-cl…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

21

28

44

ELREVIELPLTNPELFQR.3|VVSSSIVDKYIGESAR.3|HGEIDYEAIV…

SEN / CTL

Q99460

26S proteasome non-ATPase regulatory subunit 1

PSMD1

0.45

0.38

0.00000279

0.00000418

MAPK cascade,protein polyubiquitination,stimulator…

enzyme regulator activity,endopeptidase activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

30

60

102

QAIGIALETR.2|VSTAVLSITAK.2|AAVESLGFILFR.2|AAVESLGF…

SEN / CTL

P30041

Peroxiredoxin-6

PRDX6

0.45

0.7

0.000261

0.000235

response to reactive oxygen species,lipid cataboli…

glutathione peroxidase activity,protein binding,hy…

extracellular space,cytoplasm,lysosome,cytosol,cel…

45

31

62

NFDEILR.2|FHDFLGDSWGILFSHPR.3|FHDFLGDSWGILFSHPR.4|…

SEN / CTL

Q92597

Protein NDRG1

NDRG1

0.45

0.73

0.00586

0.00345

negative regulation of cell proliferation,response…

protein binding,microtubule binding,Rab GTPase bin…

nucleus,cytoplasm,centrosome,cytosol,microtubule,p…

15

18

49

SIIGMGTGAGAYILTR.2|SIIGMGTGAGAYILTR.3|SIIGM[Oxi]GT…

SEN / CTL

Q9UHD8

Septin-9

9-Sep

0.45

1.55

0.0268

0.0121

cell cycle,protein heterooligomerization,cell divi…

GTPase activity,protein binding,GTP binding,cadher…

stress fiber,cytoplasm,microtubule,cell-cell adher…

30

46

76

YLQEEVNINR.2|STLINTLFK.2|ADTLTLEER.2|RTELSIDISSK.2…

SEN / CTL

Q15019

Septin-2

2-Sep

0.44

0.37

4.25e-14

2.25e-13

regulation of L-glutamate transport,mitotic nuclea…

protein binding,GTP binding,enzyme regulator activ…

exocyst,condensed chromosome kinetochore,nucleus,n…

57

30

53

STLINSLFLTDLYPER.2|STLINSLFLTDLYPER.3|TIISYIDEQFER…

SEN / CTL

P49368

T-complex protein 1 subunit gamma

CCT3

0.44

0.69

1.41e-7

2.74e-7

protein folding,binding of sperm to zona pellucida…

protein binding,ATP binding,protein binding involv…

zona pellucida receptor complex,cytoplasm,cytosol,…

72

49

102

TAVETAVLLLR.2|IVLLDSSLEYK.2|AVAQALEVIPR.2|ELGIWEPL…

SEN / CTL

P46782

40S ribosomal protein S5

RPS5

0.44

0.36

0.000311

0.000274

ribosomal small subunit assembly,nuclear-transcrib…

RNA binding,mRNA binding,structural constituent of…

nucleoplasm,cytosol,focal adhesion,membrane,cytoso…

12

15

20

TIAEC[CAM]LADELINAAK.2|TIAEC[CAM]LADELINAAK.3|VNQA…

SEN / CTL

Q9C0C2

182 kDa tankyrase-1-binding protein

TNKS1BP1

0.44

0.58

0.00373

0.00238

nuclear-transcribed mRNA poly(A) tail shortening,D…

enzyme binding,ankyrin binding,cadherin binding in…

nucleus,nucleoplasm,nuclear telomeric heterochroma…

21

62

73

FAATTVEEILAK.2|SQEADVQDWEFR.2|EMEEELVPTGSEPGDTR.2|…

SEN / CTL

O75340

Programmed cell death protein 6

PDCD6

0.44

0.69

0.0177

0.0085

angiogenesis,positive regulation of endothelial ce…

calcium-dependent cysteine-type endopeptidase acti…

nucleus,cytoplasm,endosome,endoplasmic reticulum,e…

9

13

19

AGVNFSEFTGVWK.2|LSDQFHDILIR.3|LSDQFHDILIR.2|SIISMF…

SEN / CTL

Q07812

Apoptosis regulator BAX

BAX

0.44

0.46

0.0185

0.00884

ovarian follicle development,neuron migration,T ce…

protein binding,lipid binding,channel activity,ide…

nucleus,nuclear envelope,cytoplasm,mitochondrion,m…

9

8

14

TGALLLQGFIQDR.2|IGDELDSNMELQR.2|IGDELDSNM[Oxi]ELQR…

SEN / CTL

P63010

AP-2 complex subunit beta

AP2B1

0.43

0.43

1.01e-11

4.2e-11

ventricular septum development,intracellular prote…

signal sequence binding,protein binding,protein tr…

trans-Golgi network,cytosol,plasma membrane,membra…

42

43

83

IQPGNPNYTLSLK.2|LASQANIAQVLAELKEYATEVDVDFVR.4|LASQ…

SEN / CTL

P46821

Microtubule-associated protein 1B

MAP1B

0.43

0.51

3.6e-9

1.01e-8

microtubule bundle formation,cellular process,dend…

structural molecule activity,protein binding,micro…

photoreceptor outer segment,cytoplasm,cytosol,micr…

63

110

158

TPEEGGYSYDISEK.2|AIGNIELGIR.2|SVNFSLTPNEIK.2|TPEDG…

SEN / CTL

P26373

60S ribosomal protein L13

RPL13

0.43

0.49

0.00861

0.00475

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,cytosol,membrane,cytosolic large ribosomal…

9

22

35

TIGISVDPR.2|GFSLEELR.2|KGDSSAEELKLATQLTGPVMPVR.4|K…

SEN / CTL

O60506

Heterogeneous nuclear ribonucleoprotein Q

SYNCRIP

0.43

0.77

0.0147

0.00728

mRNA splicing, via spliceosome,osteoblast differen…

nucleotide binding,RNA binding,poly(A) binding,pol…

nucleus,nucleoplasm,endoplasmic reticulum,membrane…

33

48

77

GYAFVTFC[CAM]TK.2|DLFEDELVPLFEK.2|DLFEDELVPLFEK.3|…

SEN / CTL

O76054


Q9UDX4

SEC14-like protein 2;SEC14-like protein 3

SEC14L2


SEC14L3

0.43

0.1

0.0154

0.00758

transcription, DNA-templated,transport,regulation …

transporter activity,phospholipid binding,vitamin …

nucleus,cytoplasm,integral component of membrane,e…

3

1

1

FRENVQDVLPALPNPDDYFLLR.3

SEN / CTL

P49748

Very long-chain specific acyl-CoA dehydrogenase, mitochondrial

ACADVL

0.43

1.03

0.0233

0.0108

temperature homeostasis,fatty acid beta-oxidation,…

fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti…

nucleus,nucleolus,cytoplasm,mitochondrion,mitochon…

12

44

76

ITAFVVER.2|GIVNEQFLLQR.2|GIVNEQFLLQR.3|IFEGTNDILR….

SEN / CTL

Q99426

Tubulin-folding cofactor B

TBCB

0.43

0.52

0.0297

0.0132

nervous system development,cell differentiation

protein binding

nucleoplasm,cytoplasm,microtubule,microtubule cyto…

6

20

26

RGTVMYVGLTDFKPGYWIGVR.4|YTISQEAYDQRQDTVR.3|SLTIAEF…

SEN / CTL

Q04917

14-3-3 protein eta

YWHAH

0.43

0.53

0.0587

0.0231

regulation of sodium ion transport,glucocorticoid …

actin binding,insulin-like growth factor receptor …

cytoplasm,mitochondrion,cytosol,plasma membrane,in…

18

18

35

AVTELNEPLSNEDRNLLSVAYK.3|LAEQAERYDDMASAMK.3|LAEQAE…

SEN / CTL

Q15366

Poly(rC)-binding protein 2

PCBP2

0.43

1.07

0.0928

0.0336

mRNA splicing, via spliceosome,gene expression,mRN…

RNA binding,protein binding,enzyme binding,ubiquit…

nucleus,nucleoplasm,cytoplasm,cytosol,focal adhesi…

24

23

57

AITIAGIPQSIIEC[CAM]VK.2|AITIAGIPQSIIEC[CAM]VK.3|II…

SEN / CTL

P18124

60S ribosomal protein L7

RPL7

0.42

0.36

0.0007

0.000561

nuclear-transcribed mRNA catabolic process, nonsen…

DNA binding,RNA binding,mRNA binding,structural co…

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion…

12

24

42

IALTDNALIAR.2|IVEPYIAWGYPNLK.2|IVEPYIAWGYPNLK.3|FK…

SEN / CTL

Q7Z304

MAM domain-containing protein 2

MAMDC2

0.42

0.2

0.0852

0.0315

proteinaceous extracellular matrix,endoplasmic ret…

3

1

1

AGDHTTGLGYYLLANTK.3

SEN / CTL

P32969

60S ribosomal protein L9

RPL9

0.42

1.02

0.131

0.0443

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,nucleolus,cytoplasm,cytosol,ribosome,focal…

6

15

30

FLDGIYVSEK.2|DFNHINVELSLLGK.3|DFNHINVELSLLGK.2|GTV…

SEN / CTL

P02545

Prelamin-A/C

LMNA

0.41

1.29

1.28e-9

3.75e-9

mitotic nuclear envelope disassembly,mitotic nucle…

structural molecule activity,protein binding

nucleus,nuclear envelope,lamin filament,nucleoplas…

144

85

142

VAVEEVDEEGKFVR.3|VAVEEVDEEGKFVR.2|LADALQELR.2|EAAL…

SEN / CTL

P08865

40S ribosomal protein SA

RPSA

0.41

0.34

0.0000149

0.000018

ribosomal small subunit assembly,nuclear-transcrib…

virus receptor activity,structural constituent of …

nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr…

21

21

46

AIVAIENPADVSVISSR.2|AIVAIENPADVSVISSR.3|FTPGTFTNQI…

SEN / CTL

Q58FF8

Putative heat shock protein HSP 90-beta 2

HSP90AB2P

0.41

0.25

0.00195

0.00135

protein folding,response to stress,biological_proc…

molecular_function,ATP binding,unfolded protein bi…

cytoplasm,extracellular exosome

9

2

6

HSQFLGYPITLYLEKER.4|HSQFLGYPITLYLEKER.3|HSQFLGYPIT…

SEN / CTL

Q92973

Transportin-1

TNPO1

0.41

0.32

0.00394

0.00244

protein import into nucleus, docking,protein impor…

protein binding,nuclear localization sequence bind…

nucleus,cytoplasm,cytosol,nuclear membrane,nuclear…

9

43

65

TLLENTAITIGR.2|QSSFALLGDLTK.2|ALVMLLEVR.2|ATVGILIT…

SEN / CTL

Q99733

Nucleosome assembly protein 1-like 4

NAP1L4

0.41

0.26

0.00988

0.00526

nucleosome assembly

poly(A) RNA binding,unfolded protein binding

nucleus,cytoplasm

9

18

26

GIPEFWFTIFR.2|YAALYQPLFDK.2|NVDMLSELVQEYDEPILK.3|N…

SEN / CTL

Q01082

Spectrin beta chain, non-erythrocytic 1

SPTBN1

0.4

0.61

3.37e-23

5.35e-22

MAPK cascade,mitotic cytokinesis,ER to Golgi vesic…

actin binding,Ras guanyl-nucleotide exchange facto…

nucleolus,cytoplasm,cytosol,cell-cell adherens jun…

294

217

362

SQNIVTDSSSLSAEAIR.3|SQNIVTDSSSLSAEAIR.2|LTTLELLEVR…

SEN / CTL

P23381

Tryptophan–tRNA ligase, cytoplasmic

WARS

0.4

0.54

3.96e-7

7.13e-7

angiogenesis,translation,tRNA aminoacylation for p…

tryptophan-tRNA ligase activity,protein binding,AT…

nucleus,cytoplasm,cytosol,extracellular exosome

36

36

61

GIFGFTDSDC[CAM]IGK.2|ALIEVLQPLIAEHQAR.3|ALIEVLQPLI…

SEN / CTL

P47755

F-actin-capping protein subunit alpha-2

CAPZA2

0.4

0.27

0.0000359

0.0000393

protein complex assembly,movement of cell or subce…

actin binding

extracellular region,cytosol,brush border,F-actin …

15

16

29

FTITPSTTQVVGILK.2|FTITPSTTQVVGILK.3|EATDPRPC[CAM]E…

SEN / CTL

Q14651

Plastin-1

PLS1

0.4

0.36

0.000737

0.000582

intestinal D-glucose absorption,regulation of micr…

structural constituent of cytoskeleton,calcium ion…

cytoplasm,actin filament,brush border,actin filame…

15

37

50

SISTSLPVLDLIDAIAPNAVR.3|SISTSLPVLDLIDAIAPNAVR.2|MI…

SEN / CTL

Q14203

Dynactin subunit 1

DCTN1

0.4

1.54

0.0101

0.00536

G2/M transition of mitotic cell cycle,ER to Golgi …

motor activity,protein binding,microtubule binding…

kinetochore,spindle pole,nuclear envelope,cytoplas…

24

74

109

WVGVILDEAK.2|VTFSC[CAM]AAGFGQR.2|VTFSC[CAM]AAGFGQR…

SEN / CTL

P07900

Heat shock protein HSP 90-alpha

HSP90AA1

0.4

0.8

0.144

0.0473

G2/M transition of mitotic cell cycle,neuron migra…

nucleotide binding,glycoprotein binding,UTP bindin…

extracellular region,nucleus,nucleoplasm,cytoplasm…

105

69

151

ALLFVPR.2|NPDDITNEEYGEFYK.2|NPDDITNEEYGEFYK.3|ELIS…

SEN / CTL

P59998

Actin-related protein 2/3 complex subunit 4

ARPC4

0.39

0.34

0.0000102

0.0000131

actin filament polymerization,Arp2/3 complex-media…

structural constituent of cytoskeleton,protein bin…

cytosol,Arp2/3 protein complex,cell projection,ext…

21

12

18

VLIEGSINSVR.2|AENFFILR.2|IVAEEFLK.2|ELLLQPVTISR.2|…

SEN / CTL

Q96IU4

Alpha/beta hydrolase domain-containing protein 14B

ABHD14B

0.39

0.29

0.0000103

0.0000132

positive regulation of transcription from RNA poly…

protein binding,hydrolase activity

nucleus,nucleolus,cytoplasm,cytosol,extracellular …

18

9

14

FSVLLLHGIR.2|FSSETWQNLGTLHR.3|FSSETWQNLGTLHR.2|AVA…

SEN / CTL

Q16181

Septin-7

7-Sep

0.39

0.46

0.0000127

0.0000158

cytokinesis,mitotic nuclear division,regulation of…

structural molecule activity,protein binding,GTP b…

condensed chromosome kinetochore,stress fiber,nucl…

27

39

59

VNIIPLIAK.2|THMQDLKDVTNNVHYENYR.4|STLINSLFLTDLYSPE…

SEN / CTL

Q08257

Quinone oxidoreductase

CRYZ

0.39

1.08

0.000225

0.000208

visual perception,xenobiotic catabolic process,pro…

mRNA 3′-UTR binding,NADPH:quinone reductase activi…

cytoplasm,cytosol,extracellular exosome

48

32

52

VFEFGGPEVLK.2|VHAC[CAM]GVNPVETYIR.3|VHAC[CAM]GVNPV…

SEN / CTL

Q92499

ATP-dependent RNA helicase DDX1

DDX1

0.39

0.21

0.00198

0.00137

spliceosomal complex assembly,double-strand break …

DNA binding,chromatin binding,transcription cofact…

nucleus,nucleoplasm,cytoplasm,cytoplasmic stress g…

9

56

98

ELLIIGGVAAR.2|FLIC[CAM]TDVAAR.2|FLVLDEADGLLSQGYSDF…

SEN / CTL

O95394

Phosphoacetylglucosamine mutase

PGM3

0.39

0.04

0.006

0.00353

carbohydrate metabolic process,glucosamine metabol…

magnesium ion binding,phosphoacetylglucosamine mut…

cellular_component,cytosol

3

32

47

MGLLAVLR.2|AFVELTK.2|AFVELTK.1|AEHLDHVMFR.3|AEHLDH…

SEN / CTL

P24821

Tenascin

TNC

0.39

1

0.0181

0.00865

osteoblast differentiation,cell adhesion,negative …

syndecan binding

extracellular region,basement membrane,interstitia…

18

77

105

VSIYGVIR.2|ITAQGQYELR.2|TAHISGLPPSTDFIVYLSGLAPSIR….

SEN / CTL

O43813

LanC-like protein 1

LANCL1

0.39

0.38

0.112

0.0389

G-protein coupled receptor signaling pathway

catalytic activity,G-protein coupled receptor acti…

cytoplasm,extracellular exosome,integral component…

9

22

31

SLAEGYFDAAGR.2|ARFPAFEL.2|IPQSHIQQIC[CAM]ETILTSGEN…

SEN / CTL

Q9BSJ8

Extended synaptotagmin-1

ESYT1

0.38

0.62

7.91e-7

0.00000137

lipid transport

lipid binding,metal ion binding

plasma membrane,membrane,integral component of end…

39

52

75

LTLWYYSEER.2|LTTVLNSGFLDEWLTLEDVPSGR.3|VQLDLAETDLS…

SEN / CTL

P83731

60S ribosomal protein L24

RPL24

0.38

0.19

0.000203

0.00019

ribosomal large subunit assembly,nuclear-transcrib…

RNA binding,structural constituent of ribosome,pro…

cytoplasm,cytosol,cell-cell adherens junction,memb…

9

10

16

QINWTVLYR.2|AITGASLADIMAK.2|AITGASLADIMAK.3|AITGAS…

SEN / CTL

Q16658

Fascin

FSCN1

0.38

0.53

0.000228

0.000208

cell-cell junction assembly,cell proliferation,ana…

actin binding,drug binding,protein binding, bridgi…

stress fiber,ruffle,podosome,cytoplasm,cytosol,cyt…

48

44

69

YLTAEAFGFK.2|NASC[CAM]YFDIEWR.2|VGKDELFALEQSC[CAM]…

SEN / CTL

P0DJI9

Serum amyloid A-2 protein

SAA2

0.38

0.35

0.123

0.042

acute-phase response,positive chemotaxis,cell chem…

chemoattractant activity

extracellular space,high-density lipoprotein parti…

3

2

3

RGPGGAWAAEVISNAR.3|RGPGGAWAAEVISNAR.2|GPGGAWAAEVIS…

SEN / CTL

P40227

T-complex protein 1 subunit zeta

CCT6A

0.37

0.71

0.00000155

0.00000247

protein folding,positive regulation of telomere ma…

protein binding,ATP binding,protein binding involv…

cytoplasm,cytosol,chaperonin-containing T-complex,…

63

42

77

ALQFLEEVKVSR.3|VLAQNSGFDLQETLVK.3|VLAQNSGFDLQETLVK…

SEN / CTL

Q96HE7

ERO1-like protein alpha

ERO1L

0.37

0.53

0.000861

0.000672

response to reactive oxygen species,protein foldin…

protein disulfide isomerase activity,protein disul…

endoplasmic reticulum,endoplasmic reticulum lumen,…

21

31

49

LLESDYFR.2|LGAVDESLSEETQK.2|YSEEANNLIEEC[CAM]EQAER…

SEN / CTL

Q15691

Microtubule-associated protein RP/EB family member 1

MAPRE1

0.37

0.38

0.00185

0.00129

G2/M transition of mitotic cell cycle,sister chrom…

protein binding,protein C-terminus binding,identic…

cytoplasm,Golgi apparatus,centrosome,cytosol,micro…

18

24

48

FFDANYDGKDYDPVAAR.3|FFDANYDGKDYDPVAAR.2|NIELIC[CAM…

SEN / CTL

P61158

Actin-related protein 3

ACTR3

0.37

0.47

0.0121

0.00623

movement of cell or subcellular component,establis…

structural constituent of cytoskeleton,ATP binding…

cytosol,Arp2/3 protein complex,brush border,cell-c…

48

34

61

LKLSEELSGGR.2|LKPKPIDVQVITHHMQR.5|LKPKPIDVQVITHHMQ…

SEN / CTL

Q5TZA2

Rootletin

CROCC

0.37

0.08

0.0167

0.00816

cell cycle,protein localization,centriole-centriol…

actin binding,structural molecule activity,protein…

photoreceptor inner segment,cytoplasm,centrosome,c…

3

10

11

LALLEEAR.2|HSLATISLEMER.3|HSLATISLEMER.2|AEVAEALTK…

SEN / CTL

P60842

Eukaryotic initiation factor 4A-I

EIF4A1

0.37

1.1

0.0422

0.0173

nuclear-transcribed mRNA poly(A) tail shortening,t…

RNA cap binding,double-stranded RNA binding,mRNA b…

cytoplasm,cytosol,membrane,eukaryotic translation …

51

39

86

VLITTDLLAR.2|AEVQKLQMEAPHIIVGTPGR.4|GIYAYGFEKPSAIQ…

SEN / CTL

Q15233

Non-POU domain-containing octamer-binding protein

NONO

0.37

0.66

0.0664

0.0254

mRNA splicing, via spliceosome,DNA repair,DNA reco…

nucleotide binding,transcription regulatory region…

nucleus,nucleoplasm,nucleolus,membrane,nuclear mat…

12

43

99

NLPQYVSNELLEEAFSVFGQVER.3|FAC[CAM]HSASLTVR.3|FAC[C…

SEN / CTL

Q02878

60S ribosomal protein L6

RPL6

0.37

0.54

0.0681

0.0259

ribosomal large subunit assembly,nuclear-transcrib…

DNA binding,RNA binding,structural constituent of …

nucleus,cytosol,cell-cell adherens junction,focal …

12

30

42

AIPQLQGYLR.2|IKAIPQLQGYLR.3|HQEGEIFDTEKEKYEITEQR.4…

SEN / CTL

O75369

Filamin-B

FLNB

0.36

0.59

1.12e-17

9.14e-17

keratinocyte development,epithelial cell morphogen…

actin binding,protein binding,poly(A) RNA binding,…

stress fiber,cytoplasm,cytosol,plasma membrane,bru…

252

210

349

LIALLEVLSQK.2|SPFTVGVAAPLDLSK.2|SPFTVGVAAPLDLSK.3|…

SEN / CTL

Q9NQC3

Reticulon-4

RTN4

0.36

0.48

0.0000649

0.0000684

apoptotic process,axonal fasciculation,cerebral co…

protein binding,poly(A) RNA binding,cadherin bindi…

intracellular,nuclear envelope,endoplasmic reticul…

21

18

28

KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR.4|KPAAGLSAAPVPT…

SEN / CTL

Q9NVA2

Septin-11

11-Sep

0.36

0.53

0.00027

0.000242

cell cycle,protein heterooligomerization,cell divi…

protein binding,GTP binding

stress fiber,cytoplasm,cell junction,axon,dendriti…

18

27

44

STLMDTLFNTKFESDPATHNEPGVR.4|STLMDTLFNTKFESDPATHNEP…

SEN / CTL

Q9Y5K6

CD2-associated protein

CD2AP

0.36

0.46

0.00967

0.00517

protein complex assembly,substrate-dependent cell …

vascular endothelial growth factor receptor bindin…

ruffle,nucleolus,cytoplasm,plasma membrane,cell-ce…

12

47

57

SVDFDSLTVR.2|LGLFPSNFVK.2|ANTTAFLTPLEIK.2|ISTYGLPA…

SEN / CTL

P17980

26S protease regulatory subunit 6A

PSMC3

0.36

0.91

0.0377

0.0157

MAPK cascade,protein polyubiquitination,blastocyst…

transcription coactivator activity,transcription c…

proteasome complex,cytoplasmic mRNA processing bod…

15

35

62

VIAATNRVDILDPALLR.3|VIAATNRVDILDPALLR.2|LLDSEIK.2|…

SEN / CTL

P62314

Small nuclear ribonucleoprotein Sm D1

SNRPD1

0.36

0.42

0.0728

0.0274

spliceosomal complex assembly,spliceosomal snRNP a…

RNA binding,protein binding,poly(A) RNA binding,U1…

commitment complex,nucleus,nucleoplasm,U5 snRNP,U1…

9

6

13

NREPVQLETLSIR.3|NREPVQLETLSIR.2|YFILPDSLPLDTLLVDVE…

SEN / CTL

Q14157

Ubiquitin-associated protein 2-like

UBAP2L

0.36

0.09

0.146

0.0479

binding of sperm to zona pellucida,hematopoietic s…

protein binding,poly(A) RNA binding

PcG protein complex,Ada2/Gcn5/Ada3 transcription a…

3

28

45

IDLAVLLGK.2|QRPQATAEQIR.3|QRPQATAEQIR.2|GFGDVGEAK….

SEN / CTL

P27487

Dipeptidyl peptidase 4

DPP4

0.35

0.48

0.000361

0.000314

behavioral fear response,response to hypoxia,prote…

virus receptor activity,protease binding,serine-ty…

lysosomal membrane,plasma membrane,focal adhesion,…

21

34

42

ISLQWLR.2|LNWATYLASTENIIVASFDGR.3|HSYTASYDIYDLNKR….

SEN / CTL

O75874

Isocitrate dehydrogenase [NADP] cytoplasmic

IDH1

0.35

0.5

0.00409

0.00252

glyoxylate cycle,tricarboxylic acid cycle,isocitra…

magnesium ion binding,isocitrate dehydrogenase (NA…

cytoplasm,mitochondrion,peroxisome,peroxisomal mat…

30

28

53

GWPLYLSTK.2|IIWELIK.2|LVSGWVKPIIIGR.3|LVSGWVKPIIIG…

SEN / CTL

P42224

Signal transducer and activator of transcription 1-alpha/beta

STAT1

0.35

0.53

0.00936

0.00505

negative regulation of transcription from RNA poly…

RNA polymerase II core promoter proximal region se…

nuclear chromatin,nucleus,nucleoplasm,nucleolus,cy…

9

47

63

ELSAVTFPDIIR.2|NLSFFLTPPC[CAM]AR.2|FHDLLSQLDDQYSR….

SEN / CTL

Q9Y265

RuvB-like 1

RUVBL1

0.35

0.39

0.0102

0.00539

box C/D snoRNP assembly,DNA repair,DNA recombinati…

DNA helicase activity,protein binding,ATP binding,…

Swr1 complex,nucleus,nucleoplasm,cytoplasm,Golgi a…

12

35

55

EAC[CAM]GVIVELIK.2|YSVQLLTPANLLAK.2|YSVQLLTPANLLAK…

SEN / CTL

Q6NZI2

Polymerase I and transcript release factor

PTRF

0.35

0.74

0.0359

0.0152

regulation of transcription, DNA-templated,transcr…

protein binding,rRNA primary transcript binding,po…

nucleus,nucleoplasm,cytoplasm,mitochondrion,endopl…

21

15

23

VMIYQDEVKLPAK.3|VM[Oxi]IYQDEVKLPAK.3|VMIYQDEVKLPAK…

SEN / CTL

P47756

F-actin-capping protein subunit beta

CAPZB

0.34

0.35

0.00000466

0.00000649

movement of cell or subcellular component,cytoskel…

actin binding,actin filament binding,cadherin bind…

cytosol,cytoskeleton,actin filament,cell-cell adhe…

36

22

40

STLNEIYFGK.2|LVEDMENKIR.3|SGSGTMNLGGSLTR.2|SGSGTM[…

SEN / CTL

Q14103

Heterogeneous nuclear ribonucleoprotein D0

HNRNPD

0.34

0.49

0.00716

0.00405

mRNA splicing, via spliceosome,liver development,t…

nucleotide binding,AT DNA binding,chromatin bindin…

nucleus,nucleoplasm,cytosol,intracellular ribonucl…

21

25

51

FGEVVDC[CAM]TLK.2|IFVGGLSPDTPEEK.2|IFVGGLSPDTPEEK….

SEN / CTL

P63244

Guanine nucleotide-binding protein subunit beta-2-like 1

GNB2L1

0.34

0.58

0.00748

0.00421

positive regulation of protein phosphorylation,apo…

protein kinase C binding,receptor binding,protein …

phagocytic cup,nucleus,cytoplasm,mitochondrion,cyt…

24

30

51

VWQVTIGTR.2|LWDLTTGTTTR.2|YWLC[CAM]AATGPSIK.2|YWLC…

SEN / CTL

O00487

26S proteasome non-ATPase regulatory subunit 14

PSMD14

0.34

0.34

0.00808

0.00451

MAPK cascade,protein polyubiquitination,double-str…

protein binding,metallopeptidase activity,metal io…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

12

12

25

AVAVVVDPIQSVK.2|AVAVVVDPIQSVK.3|LINANMMVLGHEPR.3|L…

SEN / CTL

P30153

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

PPP2R1A

0.33

0.47

0.000203

0.00019

G2/M transition of mitotic cell cycle,nuclear-tran…

antigen binding,protein serine/threonine phosphata…

protein phosphatase type 2A complex,chromosome, ce…

42

41

75

QLSQSLLPAIVELAEDAKWR.3|TSAC[CAM]GLFSVC[CAM]YPR.2|A…

SEN / CTL

Q9UKK3

Poly [ADP-ribose] polymerase 4

PARP4

0.33

1.1

0.00259

0.00171

DNA repair,cellular protein modification process,p…

DNA binding,NAD+ ADP-ribosyltransferase activity,p…

nucleus,cytoplasm,spindle microtubule,membrane,int…

18

45

55

LGNVRPLLHGSPVQNIVGILC[CAM]R.4|QLLGLQPISTVSPLHR.3|S…

SEN / CTL

P26006

Integrin alpha-3

ITGA3

0.33

0.54

0.00389

0.00243

neuron migration,cell-matrix adhesion,integrin-med…

glycoprotein binding,fibronectin binding,protease …

plasma membrane,focal adhesion,integrin complex,ex…

33

26

39

YLLLAGAPR.2|VNGWATLFLR.2|EAGNPGSLFGYSVALHR.3|EAGNP…

SEN / CTL

P50995

Annexin A11

ANXA11

0.33

0.54

0.00518

0.00309

phagocytosis,cell cycle,cell division,response to …

calcium ion binding,protein binding,calcium-depend…

nuclear envelope,nucleoplasm,cytoplasm,spindle,mem…

21

29

45

SETDLLDIR.2|EAIKGVGTDEAC[CAM]LIEILASR.3|TPVLFDIYEI…

SEN / CTL

P40261

Nicotinamide N-methyltransferase

NNMT

0.33

0.34

0.0148

0.00735

response to organonitrogen compound,animal organ r…

nicotinamide N-methyltransferase activity,pyridine…

cytosol

15

13

20

C[CAM]DVTQSQPLGAVPLPPADC[CAM]VLSTLC[CAM]LDAAC[CAM]…

SEN / CTL

O00754

Lysosomal alpha-mannosidase

MAN2B1

0.33

0.41

0.0168

0.00818

mannose metabolic process,cellular protein modific…

alpha-mannosidase activity,zinc ion binding,carboh…

extracellular space,lysosomal lumen,extracellular …

27

32

45

DLFSTFTITR.2|LQETTLVANQLR.2|FQVIVYNPLGR.2|ELVDYFLN…

SEN / CTL

P11279

Lysosome-associated membrane glycoprotein 1

LAMP1

0.33

0.83

0.0234

0.0108

autophagy,granzyme-mediated apoptotic signaling pa…

virus receptor activity,protein binding,enzyme bin…

cytoplasm,lysosome,lysosomal membrane,late endosom…

24

9

13

FFLQGIQLNTILPDARDPAFK.3|FFLQGIQLNTILPDARDPAFK.4|AL…

SEN / CTL

P09104

Gamma-enolase

ENO2

0.33

0.68

0.0289

0.0128

gluconeogenesis,canonical glycolysis

magnesium ion binding,phosphopyruvate hydratase ac…

phosphopyruvate hydratase complex,photoreceptor in…

39

20

33

VNQIGSVTEAIQAC[CAM]K.2|VNQIGSVTEAIQAC[CAM]K.3|LAMQ…

SEN / CTL

Q02218

2-oxoglutarate dehydrogenase, mitochondrial

OGDH

0.33

1.34

0.0333

0.0143

generation of precursor metabolites and energy,gly…

oxoglutarate dehydrogenase (succinyl-transferring)…

mitochondrion,mitochondrial matrix,mitochondrial m…

9

77

124

QILLPFR.2|SWDIFFR.2|DMVGQVAITR.2|DM[Oxi]VGQVAITR.2…

SEN / CTL

Q9UHA4

Ragulator complex protein LAMTOR3

LAMTOR3

0.33

0.46

0.0458

0.0186

MAPK cascade,activation of MAPKK activity,cell cyc…

protein binding,kinase activator activity,guanyl-n…

lysosomal membrane,focal adhesion,endosome membran…

6

5

12

ELAPLFEELR.2|VANDNAPEHALRPGFLSTFALATDQGSK.4|VANDNA…

SEN / CTL

O95782

AP-2 complex subunit alpha-1

AP2A1

0.33

0.6

0.13

0.0439

intracellular protein transport,Golgi to endosome …

protein binding,protein C-terminus binding,protein…

cytosol,plasma membrane,membrane,basolateral plasm…

15

46

65

LVEC[CAM]LETVLNK.2|HLC[CAM]ELLAQQF.2|TC[CAM]VSLAVS…

SEN / CTL

Q01518

Adenylyl cyclase-associated protein 1

CAP1

0.32

0.63

3.7e-7

6.75e-7

cell morphogenesis,ameboidal-type cell migration,r…

actin binding,adenylate cyclase binding

plasma membrane,focal adhesion,cortical actin cyto…

63

51

99

C[CAM]VNTTLQIK.2|NSLDC[CAM]EIVSAK.2|LSDLLAPISEQIKE…

SEN / CTL

P00558

Phosphoglycerate kinase 1

PGK1

0.32

0.66

0.00000103

0.00000171

gluconeogenesis,phosphorylation,epithelial cell di…

phosphoglycerate kinase activity,ATP binding

cytosol,membrane,membrane raft,extracellular exoso…

162

59

126

AC[CAM]ANPAAGSVILLENLR.3|AC[CAM]ANPAAGSVILLENLR.2|…

SEN / CTL

O60784

Target of Myb protein 1

TOM1

0.32

0.18

0.0169

0.00818

intracellular protein transport,endocytosis,protei…

protein binding,clathrin binding

cytoplasm,endosome,early endosome,cytosol,membrane…

6

20

27

LRSELEMVSGNVR.3|LRSELEMVSGNVR.2|VLNLIQSWADAFR.2|VL…

SEN / CTL

O43504

Ragulator complex protein LAMTOR5

LAMTOR5

0.32

0.12

0.0622

0.0241

cell cycle arrest,regulation of cell size,response…

protein binding,guanyl-nucleotide exchange factor …

lysosome,lysosomal membrane,cytosol,Ragulator comp…

3

4

6

GTLSDEHAGVISVLAQQAAK.3|GTLSDEHAGVISVLAQQAAK.2|HDGI…

SEN / CTL

Q9Y3C8

Ubiquitin-fold modifier-conjugating enzyme 1

UFC1

0.32

0.7

0.104

0.0368

response to endoplasmic reticulum stress,protein u…

protein binding,UFM1 transferase activity

cytoplasm,extracellular exosome

6

5

8

IC[CAM]LTDHFKPLWAR.3|IC[CAM]LTDHFKPLWAR.4|C[CAM]WY…

SEN / CTL

Q13753

Laminin subunit gamma-2

LAMC2

0.32

1.05

0.139

0.046

cell adhesion,positive regulation of cell prolifer…

heparin binding

extracellular region,laminin-2 complex,extracellul…

27

14

15

LDPVYFVAPAK.2|GGRHPSAHDVILEGAGLR.4|AQGGDGVVPDTELEG…

SEN / CTL

Q8WUM4

Programmed cell death 6-interacting protein

PDCD6IP

0.31

0.35

0.00000287

0.00000425

cell separation after cytokinesis,apoptotic proces…

protein binding,proteinase activated receptor bind…

immunological synapse,cytoplasm,microtubule organi…

54

63

96

FYNELTEILVR.2|LANQAADYFGDAFK.2|FIQQTYPSGGEEQAQYC[C…

SEN / CTL

O15144

Actin-related protein 2/3 complex subunit 2

ARPC2

0.31

0.66

0.0000326

0.000036

movement of cell or subcellular component,positive…

structural constituent of cytoskeleton,protein bin…

cytoplasm,endosome,Golgi apparatus,cytosol,Arp2/3 …

33

36

60

ASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPR.5|ASHTAPQ…

SEN / CTL

P20073

Annexin A7

ANXA7

0.31

0.31

0.0000905

0.0000908

cellular calcium ion homeostasis,autophagy,hemosta…

integrin binding,calcium ion binding,protein bindi…

nucleus,nuclear envelope,endoplasmic reticulum mem…

30

23

33

VLIEILC[CAM]TR.2|EFSGYVESGLK.2|GFGTDEQAIVDVVANR.3|…

SEN / CTL

P13674

Prolyl 4-hydroxylase subunit alpha-1

P4HA1

0.31

0.37

0.00379

0.0024

peptidyl-proline hydroxylation to 4-hydroxy-L-prol…

procollagen-proline 4-dioxygenase activity,iron io…

mitochondrion,endoplasmic reticulum,endoplasmic re…

24

32

47

LTSTATKDPEGFVGHPVNAFK.4|LTSTATKDPEGFVGHPVNAFK.3|SA…

SEN / CTL

P04080

Cystatin-B

CSTB

0.31

0.35

0.0175

0.00842

adult locomotory behavior,negative regulation of p…

protease binding,endopeptidase inhibitor activity,…

extracellular space,nucleolus,cytoplasm,extracellu…

15

8

11

VHVGDEDFVHLR.3|VHVGDEDFVHLR.2|VFQSLPHENKPLTLSNYQTN…

SEN / CTL

P61019

Ras-related protein Rab-2A

RAB2A

0.31

0.75

0.0276

0.0124

Golgi organization,small GTPase mediated signal tr…

GTPase activity,protein binding,GTP binding,GDP bi…

Golgi membrane,nucleus,lysosomal membrane,endoplas…

12

17

32

LQIWDTAGQESFR.2|LQIWDTAGQESFR.3|GAAGALLVYDITRR.3|G…

SEN / CTL

P28838

Cytosol aminopeptidase

LAP3

0.31

0.46

0.109

0.038

proteolysis

aminopeptidase activity,metalloexopeptidase activi…

nucleus,nucleoplasm,cytoplasm,mitochondrion,trans-…

15

44

80

GITFDSGGISIK.2|TLIEFLLR.2|LNLPINIIGLAPLC[CAM]ENMPS…

SEN / CTL

P30048

Thioredoxin-dependent peroxide reductase, mitochondrial

PRDX3

0.3

0.26

0.00000162

0.00000258

response to reactive oxygen species,maternal place…

protein binding,protein C-terminus binding,thiored…

cytoplasm,mitochondrion,mitochondrial matrix,early…

30

19

41

GLFIIDPNGVIK.2|DYGVLLEGSGLALR.2|DYGVLLEGSGLALR.3|H…

SEN / CTL

P78371

T-complex protein 1 subunit beta

CCT2

0.3

0.66

0.0000336

0.0000369

protein folding,binding of sperm to zona pellucida…

protein binding,ATP binding,ubiquitin protein liga…

zona pellucida receptor complex,cytoplasm,cytosol,…

54

49

108

LAVEAVLR.2|LTSFIGAIAIGDLVK.2|LTSFIGAIAIGDLVK.3|GAT…

SEN / CTL

O95336

6-phosphogluconolactonase

PGLS

0.3

0.3

0.00062

0.000503

carbohydrate metabolic process,pentose-phosphate s…

6-phosphogluconolactonase activity

cytosol,extracellular exosome

33

19

31

TVIFVATGEGK.2|LC[CAM]WFLDEAAAR.2|WTLGFC[CAM]DER.2|…

SEN / CTL

Q13200

26S proteasome non-ATPase regulatory subunit 2

PSMD2

0.3

0.95

0.00604

0.00354

MAPK cascade,protein polyubiquitination,stimulator…

protein binding,enzyme regulator activity,endopept…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

27

63

112

LNILDTLSK.2|MLVTFDEELRPLPVSVR.3|M[Oxi]LVTFDEELRPLP…

SEN / CTL

Q9NYL9

Tropomodulin-3

TMOD3

0.3

0.44

0.0645

0.0248

muscle contraction,actin filament organization,myo…

actin binding,tropomyosin binding,cadherin binding…

striated muscle thin filament,cell-cell junction,c…

6

22

36

ILPVFDEPPNPTNVEESLKR.3|FGYQFTQQGPR.2|QKPVQTFTEEK.3…

SEN / CTL

P06576

ATP synthase subunit beta, mitochondrial

ATP5B

0.29

0.44

5.75e-8

1.22e-7

angiogenesis,osteoblast differentiation,generation…

transporter activity,protein binding,ATP binding,t…

nucleus,mitochondrion,mitochondrial proton-transpo…

120

47

115

AIAELGIYPAVDPLDSTSR.2|AIAELGIYPAVDPLDSTSR.3|AHGGYS…

SEN / CTL

P31939

Bifunctional purine biosynthesis protein PURH

ATIC

0.29

0.3

0.00000689

0.00000921

brainstem development,nucleobase-containing compou…

IMP cyclohydrolase activity,phosphoribosylaminoimi…

mitochondrion,cytosol,cell-cell adherens junction,…

27

53

87

LDFNLIR.2|TVASPGVTVEEAVEQIDIGGVTLLR.3|TVASPGVTVEEA…

SEN / CTL

Q04446

1,4-alpha-glucan-branching enzyme

GBE1

0.29

0.46

0.000997

0.000759

glycogen metabolic process,glycogen biosynthetic p…

1,4-alpha-glucan branching enzyme activity,hydrola…

cytosol,extracellular exosome

42

32

48

LITHGLGGEGYLNFM[Oxi]GNEFGHPEWLDFPR.4|LITHGLGGEGYLN…

SEN / CTL

P62263

40S ribosomal protein S14

RPS14

0.29

0.43

0.00126

0.000928

ribosomal small subunit assembly,negative regulati…

RNA binding,structural constituent of ribosome,pro…

nucleoplasm,nucleolus,cytoplasm,mitochondrion,cyto…

15

15

31

IGRIEDVTPIPSDSTR.3|IGRIEDVTPIPSDSTR.2|VKADRDESSPYA…

SEN / CTL

P50990

T-complex protein 1 subunit theta

CCT8

0.29

1.33

0.065

0.025

protein folding,binding of sperm to zona pellucida…

protein binding,ATP binding,ATPase activity, coupl…

zona pellucida receptor complex,nucleoplasm,cytopl…

60

59

110

FAEAFEAIPR.2|LATNAAVTVLR.2|DIDEVSSLLR.2|AIADTGANVV…

SEN / CTL

Q15642

Cdc42-interacting protein 4

TRIP10

0.29

0.49

0.1

0.0358

endocytosis,cell communication,signal transduction…

ARF guanyl-nucleotide exchange factor activity,GTP…

phagocytic cup,nucleoplasm,cytoplasm,lysosome,tran…

6

25

32

ELVAENLSVR.2|LGAGYGLLSEAELEVVPIIAK.3|LGAGYGLLSEAEL…

SEN / CTL

Q9NQW7

Xaa-Pro aminopeptidase 1

XPNPEP1

0.28

0.27

0.0000279

0.0000317

proteolysis,bradykinin catabolic process

aminopeptidase activity,manganese ion binding,prot…

cytoplasm,extracellular exosome

21

33

49

VGVDPLIIPTDYWK.2|QEALEWLIR.2|MGLKDTPTQEDWLVSVLPEGS…

SEN / CTL

P53621

Coatomer subunit alpha

COPA

0.28

0.46

0.000979

0.000751

intracellular protein transport,ER to Golgi vesicl…

hormone activity,structural molecule activity

Golgi membrane,extracellular space,cytoplasm,endop…

30

92

167

SSGLTAVWVAR.2|VTTVTEIGKDVIGLR.3|VTTVTEIGKDVIGLR.2|…

SEN / CTL

P62829

60S ribosomal protein L23

RPL23

0.28

0.43

0.00405

0.0025

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,poly(A) RNA bin…

nucleolus,cytoplasm,cytosol,ribosome,focal adhesio…

12

14

27

NLYIISVK.2|ISLGLPVGAVINC[CAM]ADNTGAK.2|ISLGLPVGAVI…

SEN / CTL

Q99798

Aconitate hydratase, mitochondrial

ACO2

0.28

0.61

0.00891

0.00488

generation of precursor metabolites and energy,tri…

aconitate hydratase activity,iron ion binding,3 ir…

nucleus,mitochondrion,mitochondrial matrix,myelin …

42

75

142

VAGILTVK.2|NAVTQEFGPVPDTAR.2|NAVTQEFGPVPDTAR.3|WVV…

SEN / CTL

Q16698

2,4-dienoyl-CoA reductase, mitochondrial

DECR1

0.28

0.13

0.0263

0.0119

fatty acid beta-oxidation,protein homotetramerizat…

2,4-dienoyl-CoA reductase (NADPH) activity,oxidore…

nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch…

3

26

42

VAGHPNIVINNAAGNFISPTER.3|VAGHPNIVINNAAGNFISPTER.4|…

SEN / CTL

P32321

Deoxycytidylate deaminase

DCTD

0.28

0.34

0.134

0.0448

pyrimidine nucleotide metabolic process,nucleotide…

dCMP deaminase activity,protein binding,zinc ion b…

cytosol,extracellular exosome

9

11

17

LIIQAGIK.2|LLFNMAGVTFR.2|LLFNMAGVTFR.3|LLFNM[Oxi]A…

SEN / CTL

P26641

Elongation factor 1-gamma

EEF1G

0.27

0.37

0.000342

0.0003

translational elongation,glutathione metabolic pro…

translation elongation factor activity,glutathione…

nucleus,cytoplasm,cytosol,cell-cell adherens junct…

30

36

59

ILGLLDAYLK.2|ALIAAQYSGAQVR.2|ALIAAQYSGAQVR.3|STFVL…

SEN / CTL

Q13751

Laminin subunit beta-3

LAMB3

0.27

0.73

0.0476

0.0192

cell adhesion,epidermis development,extracellular …

structural molecule activity,protein binding,prote…

extracellular region,laminin-5 complex

6

11

11

AHAVEGQVEDVVGNLR.3|C[CAM]LC[CAM]LPNVVGPK.2|C[CAM]D…

SEN / CTL

P23526

Adenosylhomocysteinase

AHCY

0.27

0.37

0.118

0.0407

sulfur amino acid metabolic process,response to hy…

adenosylhomocysteinase activity,protein binding,ad…

nucleus,cytoplasm,cytosol,melanosome,neuron projec…

30

34

62

VADIGLAAWGR.2|VAVVAGYGDVGKGC[CAM]AQALR.3|IILLAEGR….

SEN / CTL

P15144

Aminopeptidase N

ANPEP

0.26

0.74

0.0000786

0.0000801

angiogenesis,proteolysis,cell differentiation,pept…

virus receptor activity,aminopeptidase activity,re…

extracellular space,lysosomal membrane,endoplasmic…

102

60

99

ELWILNR.2|YRLPNTLKPDSYR.4|YRLPNTLKPDSYR.3|QQQDYWLI…

SEN / CTL

P08238

Heat shock protein HSP 90-beta

HSP90AB1

0.26

0.85

0.00498

0.00298

placenta development,protein folding,response to u…

glycoprotein binding,UTP binding,CTP binding,doubl…

nucleoplasm,cytoplasm,mitochondrion,lysosomal memb…

186

84

175

GVVDSEDLPLNISR.2|GVVDSEDLPLNISR.3|ELISNASDALDKIR.3…

SEN / CTL

O15145

Actin-related protein 2/3 complex subunit 3

ARPC3

0.26

1.66

0.0925

0.0336

movement of cell or subcellular component,Arp2/3 c…

structural constituent of cytoskeleton,protein bin…

cytosol,Arp2/3 protein complex,focal adhesion,acti…

18

16

27

AYLQQLR.2|PAYHSSLMDPDTKLIGNMALLPIR.4|ETKDTDIVDEAIY…

SEN / CTL

P05787

Keratin, type II cytoskeletal 8

KRT8

0.26

1.01

0.138

0.0458

viral process,tumor necrosis factor-mediated signa…

structural molecule activity,protein binding,prote…

nucleus,nucleoplasm,cytoplasm,intermediate filamen…

105

65

157

LALDIEIATYR.2|LSELEAALQR.2|ASLEAAIADAEQRGELAIKDANA…

SEN / CTL

Q13813

Spectrin alpha chain, non-erythrocytic 1

SPTAN1

0.25

0.68

2.5e-9

7.1e-9

MAPK cascade,ER to Golgi vesicle-mediated transpor…

actin binding,Ras guanyl-nucleotide exchange facto…

cytosol,cell-cell adherens junction,spectrin,micro…

225

282

447

ETENVKSSEEIESAFR.3|LQQLFRDVEDEETWIR.3|FLSDFRDLMSWI…

SEN / CTL

P55072

Transitional endoplasmic reticulum ATPase

VCP

0.25

0.44

0.0000123

0.0000153

DNA repair,double-strand break repair,NADH metabol…

protein binding,ATP binding,lipid binding,ATPase a…

proteasome complex,nucleus,nucleoplasm,cytoplasm,e…

201

94

187

ELQELVQYPVEHPDKFLK.4|ELQELVQYPVEHPDKFLK.3|LDQLIYIP…

SEN / CTL

Q96KP4

Cytosolic non-specific dipeptidase

CNDP2

0.25

0.75

0.0000304

0.0000339

sulfur amino acid metabolic process,proteolysis,gl…

carboxypeptidase activity,zinc ion binding,metallo…

nucleoplasm,cytoplasm,cytosol,extracellular exosom…

114

44

84

TVFGVEPDLTR.2|WVAIQSVSAWPEK.2|WVAIQSVSAWPEK.3|EGGS…

SEN / CTL

P13639

Elongation factor 2

EEF2

0.25

1.02

0.0000858

0.0000865

hematopoietic progenitor cell differentiation,resp…

p53 binding,translation elongation factor activity…

nucleus,cytoplasm,cytosol,plasma membrane,cell-cel…

144

84

183

VFSGLVSTGLK.2|EGIPALDNFLDKL.2|AYLPVNESFGFTADLR.3|A…

SEN / CTL

Q15365

Poly(rC)-binding protein 1

PCBP1

0.25

0.35

0.000236

0.000215

mRNA splicing, via spliceosome,gene expression,vir…

RNA polymerase II transcription factor activity, s…

nucleoplasm,cytoplasm,cell-cell adherens junction,…

30

15

49

AITIAGVPQSVTEC[CAM]VK.2|AITIAGVPQSVTEC[CAM]VK.3|II…

SEN / CTL

P50452

Serpin B8

SERPINB8

0.25

0.01

0.00246

0.00164

negative regulation of endopeptidase activity

serine-type endopeptidase inhibitor activity,prote…

extracellular space,cytosol,extracellular exosome

3

13

14

ISEVLDAGTVDPLTK.2|RLGMIDAFDEAK.3|TGTQYLLR.2|LEESYD…

SEN / CTL

Q00688

Peptidyl-prolyl cis-trans isomerase FKBP3

FKBP3

0.25

0.3

0.00346

0.00222

protein peptidyl-prolyl isomerization,chaperone-me…

peptidyl-prolyl cis-trans isomerase activity,recep…

nucleus,endoplasmic reticulum membrane

27

19

30

AWTVEQLRSEQLPK.3|ARLEIEPEWAYGK.3|ARLEIEPEWAYGK.2|V…

SEN / CTL

P06396

Gelsolin

GSN

0.25

1.24

0.0316

0.0138

phagocytosis, engulfment,positive regulation of ge…

actin binding,calcium ion binding,protein binding,…

podosome,extracellular region,extracellular space,…

51

53

102

QTQVSVLPEGGETPLFK.2|QTQVSVLPEGGETPLFK.3|FDLVPVPTNL…

SEN / CTL

P21333

Filamin-A

FLNA

0.25

1.06

0.0438

0.0179

platelet degranulation,adenylate cyclase-inhibitin…

G-protein coupled receptor binding,glycoprotein bi…

extracellular region,nucleus,nucleolus,cytoplasm,c…

453

207

388

YGGDEIPFSPYR.2|EATTEFSVDAR.2|FGGEHVPNSPFQVTALAGDQP…

SEN / CTL

Q9NZA1

Chloride intracellular channel protein 5

CLIC5

0.25

0.46

0.0547

0.0217

diet induced thermogenesis,transport,chloride tran…

voltage-gated ion channel activity,chloride channe…

Golgi apparatus,microtubule organizing center,cell…

15

13

16

FLDGDELTLADC[CAM]NLLPK.2|FLDGDELTLADC[CAM]NLLPK.3|…

SEN / CTL

P30837

Aldehyde dehydrogenase X, mitochondrial

ALDH1B1

0.25

0.41

0.059

0.0231

carbohydrate metabolic process,ethanol catabolic p…

aldehyde dehydrogenase (NAD) activity

nucleoplasm,mitochondrion,mitochondrial matrix,int…

21

31

51

YGLAAAVFTR.2|LAPALATGNTVVMK.2|LAPALATGNTVVM[Oxi]K….

SEN / CTL

P05023

Sodium/potassium-transporting ATPase subunit alpha-1

ATP1A1

0.24

0.77

0.000106

0.000105

regulation of the force of heart contraction,regul…

sodium:potassium-exchanging ATPase activity,protei…

endosome,endoplasmic reticulum,Golgi apparatus,pla…

39

62

112

IISANGC[CAM]KVDNSSLTGESEPQTR.3|AVAGDASESALLK.2|AVA…

SEN / CTL

P48444

Coatomer subunit delta

ARCN1

0.24

0.28

0.000164

0.000158

intracellular protein transport,ER to Golgi vesicl…

poly(A) RNA binding

Golgi membrane,cytoplasm,endoplasmic reticulum mem…

21

40

66

VLLAAAVC[CAM]TK.2|LYMVLITTK.2|LFTAESLIGLKNPEK.3|LF…

SEN / CTL

P30740

Leukocyte elastase inhibitor

SERPINB1

0.24

0.37

0.000384

0.000331

negative regulation of endopeptidase activity

serine-type endopeptidase inhibitor activity

extracellular space,cytoplasm,membrane,extracellul…

30

24

41

LGVQDLFNSSK.2|TFHFNTVEEVHSR.4|TFHFNTVEEVHSR.3|TYNF…

SEN / CTL

O43242

26S proteasome non-ATPase regulatory subunit 3

PSMD3

0.24

0.29

0.00124

0.00092

MAPK cascade,protein polyubiquitination,stimulator…

protein binding,enzyme regulator activity

proteasome complex,nucleus,nucleoplasm,cytoplasm,c…

18

43

64

VYEFLDKLDVVR.3|VYEFLDKLDVVR.2|HDADGQATLLNLLLR.3|HD…

SEN / CTL

Q13561

Dynactin subunit 2

DCTN2

0.24

0.37

0.00765

0.00428

G2/M transition of mitotic cell cycle,ER to Golgi …

motor activity,protein binding,spectrin binding

kinetochore,cytoplasm,centrosome,cytosol,dynactin …

36

28

43

LLLQLEATK.2|WSPIASTLPELVQR.2|LLGPDAAINLTDPDGALAKR….

SEN / CTL

P49588

Alanine–tRNA ligase, cytoplasmic

AARS

0.24

0.27

0.00864

0.00476

hair follicle development,tRNA modification,tRNA a…

tRNA binding,aminoacyl-tRNA editing activity,alani…

cytoplasm,cytosol,membrane,extracellular exosome,m…

18

62

112

NVGC[CAM]LQEALQLATSFAQLR.3|NVGC[CAM]LQEALQLATSFAQL…

SEN / CTL

P61421

V-type proton ATPase subunit d 1

ATP6V0D1

0.24

0.95

0.0111

0.00581

vacuolar transport,vacuolar acidification,brain de…

protein binding,hydrogen-exporting ATPase activity…

lysosomal membrane,early endosome,synaptic vesicle…

18

16

21

LYPEGLAQLAR.2|LYPEGLAQLAR.3|AKIDNYIPIF.2|NIVWIAEC[…

SEN / CTL

P38606

V-type proton ATPase catalytic subunit A

ATP6V1A

0.23

0.43

8.21e-7

0.00000141

transport,insulin receptor signaling pathway,ATP h…

ATP binding,proton-transporting ATPase activity, r…

mitochondrion,lysosomal membrane,cytosol,plasma me…

42

53

91

QVRPVTEKLPANHPLLTGQR.4|AKEILQEEEDLAEIVQLVGK.3|AKEI…

SEN / CTL

P54819

Adenylate kinase 2, mitochondrial

AK2

0.23

0.35

0.000712

0.000567

ADP biosynthetic process,nucleobase-containing sma…

adenylate kinase activity,ATP binding

mitochondrial inner membrane,mitochondrial interme…

39

28

55

NGFLLDGFPR.2|GIHSAIDASQTPDVVFASILAAFSK.3|GIHSAIDAS…

SEN / CTL

P29692

Elongation factor 1-delta

EEF1D

0.23

0.39

0.0171

0.00828

transcription, DNA-templated,regulation of transcr…

DNA binding,translation elongation factor activity…

nucleus,nucleolus,cytoplasm,cytosol,eukaryotic tra…

18

24

46

LVPVGYGIR.2|SIQLDGLVWGASK.2|SIQLDGLVWGASK.3|IASLEV…

SEN / CTL

O00622

Protein CYR61

CYR61

0.23

1.11

0.052

0.0207

regulation of cell growth,osteoblast differentiati…

integrin binding,insulin-like growth factor bindin…

proteinaceous extracellular matrix,extracellular m…

36

17

20

GLEC[CAM]NFGASSTALK.2|C[CAM]APGVGLVR.2|HQC[CAM]TC[…

SEN / CTL

Q9Y230

RuvB-like 2

RUVBL2

0.23

0.76

0.0856

0.0317

box C/D snoRNP assembly,DNA repair,DNA recombinati…

RNA polymerase II core promoter sequence-specific …

Swr1 complex,intracellular,nucleus,nucleoplasm,nuc…

24

42

67

GLGLDDALEPR.2|IGLETSLR.2|ALESDMAPVLIMATNR.3|ALESDM…

SEN / CTL

P21589

5′-nucleotidase

NT5E

0.23

0.56

0.0889

0.0326

purine nucleotide catabolic process,AMP catabolic …

nucleotide binding,5′-nucleotidase activity,metal …

cytoplasm,plasma membrane,cell surface,membrane,an…

30

28

42

TIVYLDGSSQSC[CAM]R.2|EVPAGKYPFIVTSDDGR.3|VLPVGDEVV…

SEN / CTL

Q9UL46

Proteasome activator complex subunit 2

PSME2

0.23

0.96

0.102

0.0363

MAPK cascade,protein polyubiquitination,stimulator…

endopeptidase activator activity

proteasome complex,nucleoplasm,cytoplasm,cytosol,p…

36

23

36

QNLFQEAEEFLYR.2|QNLFQEAEEFLYR.3|ALVHERDEAAYGELR.4|…

SEN / CTL

P13489

Ribonuclease inhibitor

RNH1

0.23

0.7

0.131

0.0443

mRNA catabolic process,negative regulation of cata…

protein binding,ribonuclease inhibitor activity

nucleoplasm,cytoplasm,angiogenin-PRI complex,extra…

84

31

55

VNPALAELNLR.2|VNPALAELNLR.3|WAELLPLLQQC[CAM]QVVR.2…

SEN / CTL

P01024

Complement C3

C3

0.22

0.59

1.18e-7

2.33e-7

positive regulation of type IIa hypersensitivity,p…

serine-type endopeptidase activity,endopeptidase i…

extracellular region,extracellular space,plasma me…

153

130

202

LVAYYTLIGASGQR.3|LVAYYTLIGASGQR.2|QVREPGQDLVVLPLSI…

SEN / CTL

Q93052

Lipoma-preferred partner

LPP

0.22

0.69

0.0246

0.0113

cell adhesion,biological_process

protein binding,zinc ion binding

nucleus,cytoplasm,plasma membrane,focal adhesion

21

28

50

KTYITDPVSAPC[CAM]APPLQPK.3|METTHSFGNPSISVSTQQPPKK….

SEN / CTL

Q99832

T-complex protein 1 subunit eta

CCT7

0.22

0.75

0.152

0.0493

protein folding,binding of sperm to zona pellucida…

protein binding,ATP binding,identical protein bind…

zona pellucida receptor complex,cytoplasm,mitochon…

30

48

102

INALTAASEAAC[CAM]LIVSVDETIKNPR.3|INALTAASEAAC[CAM]…

SEN / CTL

P55268

Laminin subunit beta-2

LAMB2

0.21

0.49

0.00996

0.00529

cell adhesion,axon guidance,neuromuscular junction…

integrin binding,structural molecule activity

extracellular region,basement membrane,basal lamin…

15

53

60

SLADVDAILAR.2|TGGSAQPETPYSGPGLLIDSLVLLPR.3|GAVADTR…

SEN / CTL

P62888

60S ribosomal protein L30

RPL30

0.21

0.24

0.011

0.00574

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,cytoplasm,cytosol,focal adhesion,membrane,…

12

10

19

VC[CAM]TLAIIDPGDSDIIR.2|VC[CAM]TLAIIDPGDSDIIR.3|LV…

SEN / CTL

Q13011

Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial

ECH1

0.21

0.35

0.0302

0.0133

fatty acid beta-oxidation,fatty acid catabolic pro…

receptor binding,isomerase activity

mitochondrion,peroxisome,membrane,extracellular ex…

24

26

53

YQETFNVIER.2|VIGNQSLVNELAFTAR.2|VIGNQSLVNELAFTAR.3…

SEN / CTL

Q9H0E2

Toll-interacting protein

TOLLIP

0.21

0.77

0.036

0.0152

autophagy,inflammatory response,signal transductio…

signal transducer activity,interleukin-1, Type I r…

cytoplasm,cytosol,nuclear body,interleukin-18 rece…

9

10

12

GPVYIGELPQDFLR.2|LNITVVQAK.2|IAWTHITIPESLR.3|IAWTH…

SEN / CTL

O43390

Heterogeneous nuclear ribonucleoprotein R

HNRNPR

0.21

0.69

0.0887

0.0325

mRNA splicing, via spliceosome,mRNA processing,cir…

nucleotide binding,RNA binding,mRNA 3′-UTR binding…

nucleoplasm,spliceosomal complex,endoplasmic retic…

12

33

51

GYAFITFC[CAM]GK.2|NLATTVTEEILEK.2|NLATTVTEEILEK.3|…

SEN / CTL

Q8N2S1

Latent-transforming growth factor beta-binding protein 4

LTBP4

0.21

0.36

0.0947

0.0341

regulation of cell growth,protein folding,transmem…

transforming growth factor beta-activated receptor…

extracellular region,proteinaceous extracellular m…

15

10

11

GGYTC[CAM]VC[CAM]PDGFLLDSSR.2|IQQC[CAM]PGTETAEYQSL…

SEN / CTL

Q14554

Protein disulfide-isomerase A5

PDIA5

0.21

1.25

0.104

0.037

protein folding,response to endoplasmic reticulum …

protein disulfide isomerase activity,oxidoreductas…

endoplasmic reticulum lumen,endoplasmic reticulum …

6

26

32

GFPTIC[CAM]YFEK.2|FHISEFPTLK.3|FHISEFPTLK.2|VIPHFT…

SEN / CTL

O94760

N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

DDAH1

0.21

0.36

0.132

0.0444

citrulline metabolic process,regulation of systemi…

catalytic activity,dimethylargininase activity,ami…

mitochondrion,cytosol,extracellular exosome

9

21

37

QHQLYVGVLGSK.3|QHQLYVGVLGSK.2|GAEILADTFKDYAVSTVPVA…

SEN / CTL

P26885

Peptidyl-prolyl cis-trans isomerase FKBP2

FKBP2

0.2

0.22

0.0124

0.0064

protein peptidyl-prolyl isomerization,chaperone-me…

peptidyl-prolyl cis-trans isomerase activity,FK506…

endoplasmic reticulum,endoplasmic reticulum membra…

12

13

21

LVIPSELGYGER.2|GAPPKIPGGATLVFEVELLKIER.4|KLVIPSELG…

SEN / CTL

P21399

Cytoplasmic aconitate hydratase

ACO1

0.2

0.68

0.0194

0.00914

tricarboxylic acid cycle,citrate metabolic process…

RNA binding,aconitate hydratase activity,protein b…

cytoplasm,mitochondrion,endoplasmic reticulum,Golg…

54

42

66

VLLEAAIR.2|FVEFFGPGVAQLSIADR.2|FVEFFGPGVAQLSIADR.3…

SEN / CTL

P42766

60S ribosomal protein L35

RPL35

0.2

0.22

0.0478

0.0193

nuclear-transcribed mRNA catabolic process, nonsen…

mRNA binding,structural constituent of ribosome,po…

nucleolus,cytoplasm,cytosol,membrane,cytosolic lar…

6

8

10

QLDDLKVELSQLR.3|QLDDLKVELSQLR.2|KYKPLDLRPK.3|RLNKH…

SEN / CTL

Q9NR45

Sialic acid synthase

NANS

0.2

0.31

0.0604

0.0236

lipopolysaccharide biosynthetic process

N-acylneuraminate cytidylyltransferase activity,N-…

cytoplasm,cytosol,extracellular exosome

6

23

39

GSDHSASLEPGELAELVR.3|GSDHSASLEPGELAELVR.2|PLELELC[…

SEN / CTL

P46783

40S ribosomal protein S10

RPS10

0.2

0.39

0.1

0.0358

ribosomal small subunit assembly,nuclear-transcrib…

structural constituent of ribosome,protein binding…

nucleoplasm,nucleolus,cytosol,ribosome,focal adhes…

6

15

25

IAIYELLFK.2|KAEAGAGSATEFQFR.3|KAEAGAGSATEFQFR.2|HP…

SEN / CTL

P11216

Glycogen phosphorylase, brain form

PYGB

0.19

0.76

0.0000333

0.0000367

glycogen catabolic process

protein binding,glycogen phosphorylase activity,py…

cytoplasm,membrane,extracellular exosome

42

65

111

VIFLENYR.2|VLYPNDNFFEGK.2|LAAC[CAM]FLDSMATLGLAAYGY…

SEN / CTL

O15460

Prolyl 4-hydroxylase subunit alpha-2

P4HA2

0.19

0.33

0.00877

0.00482

peptidyl-proline hydroxylation,oxidation-reduction…

procollagen-proline 4-dioxygenase activity,iron io…

nucleus,cytoplasm,endoplasmic reticulum,endoplasmi…

18

21

24

SSWLEEDDDPVVAR.2|YYDVMSDEEIER.2|KGTAVFWYNLLR.3|SAA…

SEN / CTL

P09525

Annexin A4

ANXA4

0.19

0.73

0.0112

0.00586

regulation of transcription from RNA polymerase II…

phospholipase inhibitor activity,calcium ion bindi…

nucleus,cytoplasm,plasma membrane,cell surface,ves…

96

45

70

GLGTDEDAIISVLAYR.2|GLGTDEDAIISVLAYR.3|GAGTDEGC[CAM…

SEN / CTL

P48643

T-complex protein 1 subunit epsilon

CCT5

0.19

0.61

0.122

0.0419

protein folding,binding of sperm to zona pellucida…

protein binding,ATP binding,G-protein beta-subunit…

zona pellucida receptor complex,nucleolus,cytoplas…

45

49

103

AVTIFIR.2|WVGGPEIELIAIATGGR.2|WVGGPEIELIAIATGGR.3|…

SEN / CTL

P46781

40S ribosomal protein S9

RPS9

0.19

0.42

0.129

0.0438

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,protein binding…

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,ri…

9

19

26

QVVNIPSFIVR.2|QVVNIPSFIVR.3|KQVVNIPSFIVR.3|KQVVNIP…

SEN / CTL

P04899

Guanine nucleotide-binding protein G(i) subunit alpha-2

GNAI2

0.18

0.41

8.03e-8

1.63e-7

activation of MAPKK activity,adenosine receptor si…

G-protein coupled receptor binding,GTPase activity…

nucleoplasm,cytoplasm,centrosome,cytosol,heterotri…

33

27

44

IAQSDYIPTQQDVLR.2|IAQSDYIPTQQDVLR.3|AMGNLQIDFADPSR…

SEN / CTL

P31948

Stress-induced-phosphoprotein 1

STIP1

0.18

0.31

0.000798

0.000626

response to stress

protein C-terminus binding,Hsp70 protein binding,p…

nucleus,Golgi apparatus,myelin sheath,protein comp…

30

71

131

TLLSDPTYRELIEQLR.3|LMDVGLIAIR.2|LM[Oxi]DVGLIAIR.2|…

SEN / CTL

P37802

Transgelin-2

TAGLN2

0.18

0.56

0.0395

0.0163

epithelial cell differentiation,cell-cell adhesion

cadherin binding involved in cell-cell adhesion

cell-cell adherens junction,vesicle,extracellular …

84

26

53

QYDADLEQILIQWITTQC[CAM]R.3|QYDADLEQILIQWITTQC[CAM]…

SEN / CTL

O60888

Protein CutA

CUTA

0.17

0.21

0.00126

0.000923

protein localization,response to metal ion

copper ion binding,enzyme binding

membrane,extracellular exosome

21

7

14

TQSSLVPALTDFVR.2|TQSSLVPALTDFVR.3|LAAC[CAM]VNLIPQI…

SEN / CTL

P61160

Actin-related protein 2

ACTR2

0.17

0.51

0.00678

0.00391

movement of cell or subcellular component,establis…

structural constituent of cytoskeleton,ATP binding…

cytoplasm,cytosol,Arp2/3 protein complex,focal adh…

54

23

52

VGNIEIKDLMVGDEASELR.3|GYAFNHSADFETVR.3|GYAFNHSADFE…

SEN / CTL

P62241

40S ribosomal protein S8

RPS8

0.17

0.44

0.00947

0.00509

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,poly(A) RNA bin…

nucleus,nucleoplasm,cytoplasm,cytosol,focal adhesi…

21

23

39

ELEFYLR.2|IIDVVYNASNNELVR.3|IIDVVYNASNNELVR.2|ISSL…

SEN / CTL

P17936

Insulin-like growth factor-binding protein 3

IGFBP3

0.17

0.41

0.033

0.0143

regulation of cell growth,osteoblast differentiati…

fibronectin binding,protein binding,insulin-like g…

extracellular region,extracellular space,nucleus,i…

9

10

13

C[CAM]QPSPDEARPLQALLDGR.3|FLNVLSPR.2|EMEDTLNHLK.3|…

SEN / CTL

Q14192

Four and a half LIM domains protein 2

FHL2

0.17

0.75

0.0579

0.0228

negative regulation of transcription from RNA poly…

transcription coactivator activity,protein binding…

nucleus,nucleoplasm,focal adhesion,actin cytoskele…

21

26

39

GFLTERDDILC[CAM]PDC[CAM]GKDI.3|SFIPKDNQNFC[CAM]VPC…

SEN / CTL

P50502

Hsc70-interacting protein

ST13

0.16

0.42

0.00415

0.00255

protein folding,protein homooligomerization,negati…

protein domain specific binding,Hsp70 protein bind…

cytoplasm,cytosol,protein complex,extracellular ex…

18

19

33

AIDLFTDAIK.2|AIDLFTDAIKLNPR.3|VAAIEALNDGELQK.2|AIE…

SEN / CTL

Q9UNH7

Sorting nexin-6

SNX6

0.16

0.67

0.0364

0.0153

intracellular protein transport,endocytosis,negati…

protein binding,dynactin binding,phosphatidylinosi…

intracellular,nucleus,cytoplasm,cytosol,cytoplasmi…

9

25

36

NLVELAELELK.2|SADGVIVSGVKDVDDFFEHER.4|SADGVIVSGVKD…

SEN / CTL

P54920

Alpha-soluble NSF attachment protein

NAPA

0.16

0.31

0.0894

0.0327

intracellular protein transport,ER to Golgi vesicl…

soluble NSF attachment protein activity,protein bi…

Golgi membrane,vacuolar membrane,cytosol,membrane,…

18

24

43

IEEAC[CAM]EIYAR.2|LAVQKYEELFPAFSDSR.3|LAVQKYEELFPA…

SEN / CTL

O95861

3′(2′),5′-bisphosphate nucleotidase 1

BPNT1

0.16

0.36

0.109

0.0383

nucleobase-containing compound metabolic process,n…

magnesium ion binding,3′(2′),5′-bisphosphate nucle…

cytoplasm,cytosol,extracellular exosome

15

19

27

RVIAEGDLGIVEK.3|RVIAEGDLGIVEK.2|LAQMSIC[CAM]SSLAR….

SEN / CTL

P17931

Galectin-3

LGALS3

0.15

0.33

0.00106

0.000802

monocyte chemotaxis,mRNA processing,RNA splicing,n…

protein binding,IgE binding,carbohydrate binding,c…

immunological synapse,extracellular space,nucleus,…

21

12

19

IALDFQR.2|MLITILGTVKPNANR.3|M[Oxi]LITILGTVKPNANR.3…

SEN / CTL

Q02952

A-kinase anchor protein 12

AKAP12

0.15

1.01

0.00685

0.00393

protein targeting,G-protein coupled receptor signa…

adenylate cyclase binding,protein kinase A binding

cytoplasm,cytoskeleton,plasma membrane,focal adhes…

81

84

109

VKEESQLPGTGGPEDVLQPVQR.3|LVQNIIQTAVDQFVR.2|LVQNIIQ…

SEN / CTL

Q9UNM6

26S proteasome non-ATPase regulatory subunit 13

PSMD13

0.15

0.72

0.11

0.0383

MAPK cascade,protein polyubiquitination,stimulator…

structural molecule activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

18

35

52

FLGC[CAM]VDIKDLPVSEQQER.3|ITVNEVELLVMK.2|ITVNEVELL…

SEN / CTL

P14868

Aspartate–tRNA ligase, cytoplasmic

DARS

0.15

1.07

0.115

0.0399

translation,tRNA aminoacylation for protein transl…

aminoacylase activity,aspartate-tRNA ligase activi…

cytoplasm,cytosol,membrane,extracellular exosome

24

43

70

IYVISLAEPR.2|IGSC[CAM]TQQDVELHVQK.3|IGSC[CAM]TQQDV…

SEN / CTL

P40926

Malate dehydrogenase, mitochondrial

MDH2

0.15

0.41

0.122

0.0419

gluconeogenesis,tricarboxylic acid cycle,oxaloacet…

L-malate dehydrogenase activity,protein self-assoc…

nucleus,nucleoplasm,mitochondrion,mitochondrial in…

93

31

62

SQETEC[CAM]TYFSTPLLLGK.2|SQETEC[CAM]TYFSTPLLLGK.3|…

SEN / CTL

Q9NYU2

UDP-glucose:glycoprotein glucosyltransferase 1

UGGT1

0.15

0.71

0.123

0.0421

protein N-linked glycosylation via asparagine,endo…

UDP-glucose:glycoprotein glucosyltransferase activ…

endoplasmic reticulum,endoplasmic reticulum lumen,…

12

68

110

LGIEGLSLHNVLK.3|LGIEGLSLHNVLK.2|ILETTTFFQR.2|IVPEW…

SEN / CTL

P52907

F-actin-capping protein subunit alpha-1

CAPZA1

0.14

0.46

0.0000425

0.0000459

protein complex assembly,movement of cell or subce…

actin binding,cadherin binding involved in cell-ce…

extracellular region,cytosol,cytoskeleton,cell-cel…

24

20

42

FTITPPTAQVVGVLK.2|FTITPPTAQVVGVLK.3|EASDPQPEEADGGL…

SEN / CTL

P23528

Cofilin-1

CFL1

0.14

0.73

0.0735

0.0276

cytoskeleton organization,Rho protein signal trans…

protein binding,actin filament binding

extracellular space,nucleus,cytoplasm,focal adhesi…

42

22

40

LGGSAVISLEGKPL.2|LGGSAVISLEGKPL.3|NIILEEGKEILVGDVG…

SEN / CTL

P50453

Serpin B9

SERPINB9

0.14

0.34

0.0938

0.0338

mast cell mediated immunity,apoptotic process,immu…

protease binding,serine-type endopeptidase inhibit…

extracellular space,intracellular,nucleus,cytoplas…

15

21

29

LVLVNAIYFK.2|AQLLELPYAR.2|FC[CAM]ADHPFLFFIR.3|FC[C…

SEN / CTL

P61353

60S ribosomal protein L27

RPL27

0.13

0.27

0.133

0.0446

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,poly(A) RNA bin…

nucleus,cytosol,ribosome,focal adhesion,membrane,c…

6

11

19

VVLVLAGR.2|NIDDGTSDRPYSHALVAGIDRYPR.5|NIDDGTSDRPYS…

SEN / CTL

P05556

Integrin beta-1

ITGB1

0.12

0.57

0.0103

0.00543

G1/S transition of mitotic cell cycle,in utero emb…

virus receptor activity,fibronectin binding,protea…

ruffle,cytoplasm,plasma membrane,cell-cell adheren…

45

36

53

LKPEDITQIQPQQLVLR.3|LKPEDITQIQPQQLVLR.2|LKPEDITQIQ…

SEN / CTL

P56537

Eukaryotic translation initiation factor 6

EIF6

0.12

0.4

0.0339

0.0145

ribosomal subunit export from nucleus,maturation o…

translation initiation factor activity,protein bin…

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pr…

24

13

23

HGLLVPNNTTDQELQHIR.4|HGLLVPNNTTDQELQHIR.3|TSIEDQDE…

SEN / CTL

Q9BTY2

Plasma alpha-L-fucosidase

FUCA2

0.12

0.3

0.0752

0.0282

fucose metabolic process,response to bacterium,gly…

alpha-L-fucosidase activity

extracellular space,extracellular exosome

21

12

14

LVYAIFLK.2|EAGISDYLTIEELVK.2|WPTSGQLFLGHPK.3|WPTSG…

SEN / CTL

P07602

Prosaposin

PSAP

0.12

1.36

0.091

0.0332

platelet degranulation,glycosphingolipid metabolic…

G-protein coupled receptor binding,protein binding…

extracellular region,extracellular space,cytoplasm…

51

30

59

SDVYC[CAM]EVC[CAM]EFLVK.2|SDVYC[CAM]EVC[CAM]EFLVK….

SEN / CTL

P15311

Ezrin

EZR

0.11

0.52

0.00897

0.0049

negative regulation of transcription from RNA poly…

actin binding,protein binding,microtubule binding,…

ruffle,immunological synapse,uropod,extracellular …

72

50

90

QRIDEFEAL.2|GMLKDNAMLEYLK.3|GMLKDNAMLEYLK.2|SQEQLA…

SEN / CTL

Q99613

Eukaryotic translation initiation factor 3 subunit C

EIF3C

0.11

0.76

0.0504

0.0201

formation of translation preinitiation complex,tra…

translation initiation factor binding,poly(A) RNA …

cytosol,eukaryotic translation initiation factor 3…

12

47

79

GC[CAM]ILTLVER.2|AKELLGQGLLLR.3|AKELLGQGLLLR.2|RLD…

SEN / CTL

P06737

Glycogen phosphorylase, liver form

PYGL

0.1

0.28

0.00113

0.000838

glycogen metabolic process,glycogen catabolic proc…

purine nucleobase binding,protein binding,ATP bind…

cytoplasm,cytosol,plasma membrane,extracellular ex…

36

51

80

LHSFLGDDVFLR.3|LHSFLGDDVFLR.2|IFVDIEKLPWSK.3|IFVDI…

SEN / CTL

Q96QK1

Vacuolar protein sorting-associated protein 35

VPS35

0.1

0.63

0.0909

0.0332

intracellular protein transport,Wnt signaling path…

protein binding,protein transporter activity,D1 do…

lysosomal membrane,endosome,early endosome,late en…

27

41

64

NIIIALIDR.2|IRFTLPPLVFAAYQLAFR.3|SEDPDQQYLILNTAR.2…

SEN / CTL

P52565

Rho GDP-dissociation inhibitor 1

ARHGDIA

0.09

0.4

0.000323

0.000284

movement of cell or subcellular component,negative…

Rho GDP-dissociation inhibitor activity,GTPase act…

cytosol,cytoskeleton,extracellular exosome

57

15

29

AEEYEFLTPVEEAPK.2|AEEYEFLTPVEEAPK.3|SIQEIQELDKDDES…

SEN / CTL

Q15084

Protein disulfide-isomerase A6

PDIA6

0.09

0.23

0.000397

0.00034

protein folding,response to endoplasmic reticulum …

protein disulfide isomerase activity,protein bindi…

endoplasmic reticulum,endoplasmic reticulum lumen,…

69

32

56

TGEAIVDAALSALR.2|TGEAIVDAALSALR.3|NSYLEVLLK.2|GSFS…

SEN / CTL

P98160

Basement membrane-specific heparan sulfate proteoglycan core protein

HSPG2

0.09

0.82

0.00915

0.00497

retinoid metabolic process,angiogenesis,glycosamin…

calcium ion binding,protein binding,protein C-term…

extracellular region,basement membrane,extracellul…

390

163

239

LLSGPYFWSLPSR.2|LLSGPYFWSLPSR.3|AGLSSGFIGC[CAM]VR….

SEN / CTL

O00231

26S proteasome non-ATPase regulatory subunit 11

PSMD11

0.08

0.61

0.0022

0.0015

MAPK cascade,protein polyubiquitination,stimulator…

structural molecule activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

27

33

53

YQEALHLGSQLLR.3|YQEALHLGSQLLR.2|AQSLLSTDREASIDILHS…

SEN / CTL

P39060

Collagen alpha-1(XVIII) chain

COL18A1

0.08

0.36

0.111

0.0386

angiogenesis,endothelial cell morphogenesis,cell a…

structural molecule activity,metal ion binding

extracellular region,collagen trimer,basement memb…

60

31

46

LQDLYSIVR.2|IFSFDGKDVLR.3|DELLFPSWEALFSGSEGPLKPGAR…

SEN / CTL

P00749

Urokinase-type plasminogen activator

PLAU

0.07

0.24

0.121

0.0417

response to hypoxia,proteolysis,chemotaxis,signal …

serine-type endopeptidase activity,protein binding

extracellular region,extracellular space,plasma me…

12

6

7

IIGGEFTTIENQPWFAAIYR.3|VSHFLPWIR.2|DYSADTLAHHNDIAL…

SEN / CTL

P13797

Plastin-3

PLS3

0.05

0.49

0.0561

0.0222

actin filament bundle assembly,actin filament netw…

calcium ion binding,actin filament binding

cytoplasm,actin filament,actin filament bundle

33

45

74

AYFHLLNQIAPK.3|AYFHLLNQIAPK.2|VYALPEDLVEVKPK.3|VYA…

SEN / CTL

Q15404

Ras suppressor protein 1

RSU1

0.03

0.53

0.0657

0.0252

signal transduction,positive regulation of cell-su…

protein binding

cytosol,focal adhesion,extracellular exosome

18

19

28

LQILSLRDNDLISLPK.3|LQILSLRDNDLISLPK.2|NLEVLNFFNNQI…

SEN / CTL

P35606

Coatomer subunit beta’

COPB2

0.03

0.56

0.0688

0.0262

intracellular protein transport,ER to Golgi vesicl…

structural molecule activity

Golgi membrane,endoplasmic reticulum membrane,cyto…

15

61

94

TFEVC[CAM]DLPVR.2|TFEVC[CAM]DLPVR.3|KNWVVTGADDMQIR…

SEN / CTL

Q02790

Peptidyl-prolyl cis-trans isomerase FKBP4

FKBP4

0.03

0.51

0.108

0.0378

protein peptidyl-prolyl isomerization,protein fold…

peptidyl-prolyl cis-trans isomerase activity,prote…

nucleoplasm,cytoplasm,mitochondrion,endoplasmic re…

15

58

112

RGEAHLAVNDFELAR.3|RGEAHLAVNDFELAR.4|RGEAHLAVNDFELA…

SEN / CTL

P52788

Spermine synthase

SMS

0.03

0.72

0.146

0.048

methionine metabolic process,polyamine metabolic p…

spermine synthase activity

cytosol,extracellular exosome

24

28

36

LILDLSMK.2|TC[CAM]GDVLDNLKGDC[CAM]YQVLIEDC[CAM]IPV…

SEN / CTL

Q12906

Interleukin enhancer-binding factor 3

ILF3

0.02

0.69

0.0188

0.00892

transcription, DNA-templated,protein phosphorylati…

DNA binding,RNA binding,double-stranded RNA bindin…

nucleus,nucleoplasm,nucleolus,cytoplasm,mitochondr…

21

70

118

SC[CAM]VIVIR.2|C[CAM]LAALASLR.2|HSSVYPTQEELEAVQNMV…

SEN / CTL

P07237

Protein disulfide-isomerase

P4HB

0.01

0.82

0.0137

0.00686

response to reactive oxygen species,peptidyl-proli…

protein disulfide isomerase activity,integrin bind…

extracellular region,endoplasmic reticulum,endopla…

156

62

113

ILFIFIDSDHTDNQR.3|ILFIFIDSDHTDNQR.2|VDATEESDLAQQYG…

SEN / CTL

P42574

Caspase-3

CASP3

0

0.72

0.13

0.044

response to hypoxia,apoptotic DNA fragmentation,pr…

protease binding,aspartic-type endopeptidase activ…

nucleus,nucleoplasm,cytosol,plasma membrane,death-…

12

16

19

LFIIQAC[CAM]R.2|QYADKLEFMHILTR.3|QYADKLEFMHILTR.4|…

SEN / CTL

P45974

Ubiquitin carboxyl-terminal hydrolase 5

USP5

-0.01

1.26

0.000149

0.000144

ubiquitin-dependent protein catabolic process,prot…

cysteine-type endopeptidase activity,thiol-depende…

lysosome

30

54

78

DGLGGLPDIVR.2|DGLGGLPDIVRDR.3|SAADSISESVPVGPK.2|SA…

SEN / CTL

P49720

Proteasome subunit beta type-3

PSMB3

-0.01

0.28

0.137

0.0454

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytoplasm,m…

18

13

31

FGPYYTEPVIAGLDPK.2|FGPYYTEPVIAGLDPK.3|LYIGLAGLATDV…

SEN / CTL

Q15843

NEDD8

NEDD8

-0.03

0.59

0.0474

0.0192

regulation of transcription from RNA polymerase II…

protein binding,ubiquitin protein ligase binding

nucleus,cytosol,extracellular exosome

15

4

7

ILGGSVLHLVLALR.3|ILGGSVLHLVLALR.2|TLTGKEIEIDIEPTDK…

SEN / CTL

Q9NTK5

Obg-like ATPase 1

OLA1

-0.03

0.52

0.081

0.0301

ATP metabolic process,cell-cell adhesion

ATP binding,GTP binding,ATPase activity,ribosome b…

nucleolus,cytoplasm,centrosome,cell-cell adherens …

9

38

62

IPAFLNVVDIAGLVK.2|IPAFLNVVDIAGLVK.3|NYIVEDGDIIFFK….

SEN / CTL

P63241


Q6IS14

Eukaryotic translation initiation factor 5A-1;Eukaryotic translation initiation factor 5A-1-like

EIF5A


EIF5AL1

-0.03

0.52

0.116

0.0401

mRNA export from nucleus,translational frameshifti…

RNA binding,translation elongation factor activity…

nucleus,annulate lamellae,nuclear pore,cytoplasm,e…

36

7

21

VHLVGIDIFTGK.3|VHLVGIDIFTGK.2|YDC[CAM]GEEILITVLSAM…

SEN / CTL

Q9H223

EH domain-containing protein 4

EHD4

-0.05

0.42

0.028

0.0125

pinocytosis,regulation of endocytosis,endocytic re…

nucleic acid binding,calcium ion binding,protein b…

nucleus,endoplasmic reticulum,plasma membrane,cell…

9

32

46

EYQISAGDFPEVK.2|EYQISAGDFPEVK.3|YLLEQDFPGMR.2|VYGA…

SEN / CTL

O75223

Gamma-glutamylcyclotransferase

GGCT

-0.05

0.06

0.107

0.0378

release of cytochrome c from mitochondria,glutathi…

gamma-glutamylcyclotransferase activity,protein ho…

cytosol,extracellular exosome

3

15

18

NPSAAFFC[CAM]VAR.2|NPSAAFFC[CAM]VAR.3|VSEEIEDIIKK….

SEN / CTL

P49458

Signal recognition particle 9 kDa protein

SRP9

-0.06

0.24

0.102

0.0362

SRP-dependent cotranslational protein targeting to…

RNA binding,signal recognition particle binding,pr…

signal recognition particle receptor complex,signa…

12

8

11

VTDDLVC[CAM]LVYK.2|PQYQTWEEFSR.2|PQYQTWEEFSR.3|VTD…

SEN / CTL

Q9HC38

Glyoxalase domain-containing protein 4

GLOD4

-0.06

0.32

0.151

0.049

cell-cell adhesion

cadherin binding involved in cell-cell adhesion

mitochondrion,cell-cell adherens junction,extracel…

15

22

35

ILTPLVSLDTPGK.2|ILTPLVSLDTPGK.3|SLNYWC[CAM]NLLGMK….

SEN / CTL

P34932

Heat shock 70 kDa protein 4

HSPA4

-0.07

0.34

0.00000177

0.00000276

response to unfolded protein,protein import into m…

protein binding,ATP binding

cytosol,extracellular exosome

66

85

157

EFSITDVVPYPISLR.2|EFSITDVVPYPISLR.3|AFSDPFVEAEKSNL…

SEN / CTL

Q9BZK3

Putative nascent polypeptide-associated complex subunit alpha-like protein

NACAP1

-0.07

0.13

0.0187

0.00892

12

3

7

IEDLSQEAQLAAAEK.2|IEDLSQEAQLAAAEK.3|NILFVITKPDVYK….

SEN / CTL

P20618

Proteasome subunit beta type-1

PSMB1

-0.07

0.32

0.0361

0.0152

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

24

17

37

LVKDVFISAAERDVYTGDALR.4|LVKDVFISAAERDVYTGDALR.3|LS…

SEN / CTL

P46108

Adapter molecule crk

CRK

-0.07

0.34

0.0621

0.0241

activation of MAPKK activity,regulation of transcr…

SH3/SH2 adaptor activity,protein binding,enzyme bi…

nucleus,cytoplasm,cytosol,plasma membrane,actin cy…

21

23

29

VSHYIINSSGPRPPVPPSPAQPPPGVSPSR.4|LSRQEAVALLQGQR.3|…

SEN / CTL

P09972

Fructose-bisphosphate aldolase C

ALDOC

-0.08

0.27

0.00157

0.00113

fructose metabolic process,gluconeogenesis,fructos…

fructose-bisphosphate aldolase activity,protein bi…

mitochondrion,cytosol,cytoskeleton,extracellular e…

30

27

42

VDKGVVPLAGTDGETTTQGLDGLSER.3|VDKGVVPLAGTDGETTTQGLD…

SEN / CTL

P61970

Nuclear transport factor 2

NUTF2

-0.08

0.2

0.0406

0.0168

protein import into nucleus, translocation,protein…

protein binding,protein transmembrane transporter …

nuclear outer membrane,nucleoplasm,cytosol,nuclear…

12

8

20

NINDAWVC[CAM]TNDMFR.2|NINDAWVC[CAM]TNDMFR.3|NINDAW…

SEN / CTL

E9PAV3


Q13765

Nascent polypeptide-associated complex subunit alpha, muscle-specific form;Nascent polypeptide-associated complex subunit alpha

NACA

-0.08

0.13

0.0487

0.0196

transcription, DNA-templated,regulation of transcr…

DNA binding;

nucleus,cytoplasm;

9

2

4

IEDLSQQAQLAAAEK.3|IEDLSQQAQLAAAEK.2|SPASDTYIVFGEAK…

SEN / CTL

P52209

6-phosphogluconate dehydrogenase, decarboxylating

PGD

-0.08

0.4

0.106

0.0373

pentose-phosphate shunt,pentose-phosphate shunt, o…

phosphogluconate dehydrogenase (decarboxylating) a…

nucleus,cytosol,extracellular exosome

42

36

73

GILFVGSGVSGGEEGAR.2|GILFVGSGVSGGEEGAR.3|GTGKWTAISA…

SEN / CTL

O95757

Heat shock 70 kDa protein 4L

HSPA4L

-0.09

0.1

0.141

0.0467

protein folding,response to unfolded protein

ATP binding

nucleus,cytoplasm,cytosol

3

48

66

SGGIETIANEYSDR.2|QDLPPLDEKPR.3|SSGEM[Oxi]EVD.2|MQV…

SEN / CTL

P08133

Annexin A6

ANXA6

-0.1

0.34

0.00366

0.00234

calcium ion transport,regulation of muscle contrac…

calcium ion binding,protein binding,GTP binding,ca…

mitochondrion,lysosomal membrane,focal adhesion,me…

96

72

121

GFGSDKEAILDIITSR.3|GFGSDKEAILDIITSR.2|ALIEILATR.2|…

SEN / CTL

Q04837

Single-stranded DNA-binding protein, mitochondrial

SSBP1

-0.11

0.35

0.0561

0.0222

DNA replication,mitochondrion organization,positiv…

chromatin binding,single-stranded DNA binding,poly…

nucleus,mitochondrion,mitochondrial matrix,mitocho…

12

10

18

QVEGKNPVTIFSLATNEMWR.3|NPVTIFSLATNEMWR.3|NPVTIFSLA…

SEN / CTL

P50395

Rab GDP dissociation inhibitor beta

GDI2

-0.12

0.71

0.0333

0.0143

signal transduction,small GTPase mediated signal t…

Rab GDP-dissociation inhibitor activity,GTPase act…

cytoplasm,Golgi apparatus,cytosol,focal adhesion,m…

105

56

113

DLGTESQIFISR.2|TDDYLDQPC[CAM]YETINR.2|TDDYLDQPC[CA…

SEN / CTL

P31150

Rab GDP dissociation inhibitor alpha

GDI1

-0.12

0.38

0.0472

0.0191

signal transduction,protein transport,Rab protein …

GDP-dissociation inhibitor activity,Rab GDP-dissoc…

cytoplasm,Golgi apparatus,cytosol,midbody,neuron p…

36

28

53

IIC[CAM]ILSHPIKNTNDANSC[CAM]QIIIPQNQVNR.4|TDDYLDQP…

SEN / CTL

P46976

Glycogenin-1

GYG1

-0.12

0.47

0.147

0.048

glycogen biosynthetic process,glycogen catabolic p…

protein binding,glycogenin glucosyltransferase act…

cytosol,membrane,lysosomal lumen,extracellular exo…

9

11

16

GALVLGSSLK.2|LVVLATPQVSDSMR.2|LVVLATPQVSDSMR.3|WEQ…

SEN / CTL

P55786

Puromycin-sensitive aminopeptidase

NPEPPS

-0.13

0.55

0.00251

0.00166

protein polyubiquitination,proteolysis,peptide cat…

aminopeptidase activity,zinc ion binding,peptide b…

nucleus,cytosol,plasma membrane,extracellular exos…

102

55

85

LNLGTVGFYR.2|LGLQNDLFSLAR.2|AGIISTVEVLK.2|AFPC[CAM…

SEN / CTL

P54802

Alpha-N-acetylglucosaminidase

NAGLU

-0.13

0.39

0.0324

0.014

glycosaminoglycan catabolic process,lysosome organ…

alpha-N-acetylglucosaminidase activity

lysosome,lysosomal lumen,extracellular exosome

30

21

31

ALAAKPGLDTYSLGGGGAAR.3|FLLGSWLEQAR.2|KDPVPDLAAWVTS…

SEN / CTL

P12956

X-ray repair cross-complementing protein 6

XRCC6

-0.13

0.51

0.112

0.0389

telomere maintenance,DNA ligation,double-strand br…

DNA binding,damaged DNA binding,double-stranded DN…

nuclear telomere cap complex,nuclear chromosome, t…

42

66

122

DSLIFLVDASK.2|SDSFENPVLQQHFR.3|SDSFENPVLQQHFR.2|NI…

SEN / CTL

Q9UHV9

Prefoldin subunit 2

PFDN2

-0.13

0.23

0.147

0.048

protein folding,positive regulation of cytoskeleto…

protein binding,protein binding involved in protei…

nucleus,nucleoplasm,nucleolus,cytoplasm,mitochondr…

12

9

15

GAVSAEQVIAGFNR.3|GAVSAEQVIAGFNR.2|IIETLTQQLQAK.2|I…

SEN / CTL

Q92945

Far upstream element-binding protein 2

KHSRP

-0.14

0.35

0.00666

0.00384

RNA splicing, via transesterification reactions,tr…

DNA binding,protein binding,mRNA 3′-UTR AU-rich re…

nucleoplasm,cytosol,cytoplasmic stress granule,mem…

18

42

79

IINDLLQSLR.2|IGGGIDVPVPR.2|MMLDDIVSR.2|M[Oxi]MLDDI…

SEN / CTL

Q15459

Splicing factor 3A subunit 1

SF3A1

-0.14

0.06

0.0208

0.00969

regulation of alternative mRNA splicing, via splic…

RNA binding,protein binding,poly(A) RNA binding

nucleoplasm,spliceosomal complex,U2-type spliceoso…

3

50

82

LTAQFVAR.2|GLVPEDDTKEK.3|IRQNEINNPK.3|IRQNEINNPK.2…

SEN / CTL

Q86V81

THO complex subunit 4

ALYREF

-0.14

0.18

0.123

0.042

regulation of DNA recombination,mRNA splicing, via…

nucleotide binding,protein binding,poly(A) RNA bin…

transcription export complex,nucleus,nucleoplasm,c…

6

12

20

SLGTADVHFER.3|SLGTADVHFER.2|LLVSNLDFGVSDADIQELFAEF…

SEN / CTL

P62993

Growth factor receptor-bound protein 2

GRB2

-0.15

0.41

0.0207

0.00966

MAPK cascade,epidermal growth factor receptor sign…

phosphotyrosine binding,SH3/SH2 adaptor activity,R…

nucleus,nucleoplasm,nucleolus,cytoplasm,endosome,G…

12

19

28

YFLWVVK.2|FNSLNELVDYHR.3|FNSLNELVDYHR.2|RGDFIHVMDN…

SEN / CTL

P05387

60S acidic ribosomal protein P2

RPLP2

-0.15

0.76

0.0746

0.028

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,large ribosomal…

cytosol,focal adhesion,membrane,cytosolic large ri…

45

13

30

NIEDVIAQGIGK.2|NIEDVIAQGIGK.3|ILDSVGIEADDDRLNK.3|I…

SEN / CTL

Q12765

Secernin-1

SCRN1

-0.15

0.48

0.0858

0.0317

proteolysis,exocytosis

molecular_function,dipeptidase activity

nucleus,cytoplasm,nuclear membrane

15

21

30

C[CAM]IC[CAM]SQLSLTTK.2|SIFKPFIFVDDVK.3|SIFKPFIFVD…

SEN / CTL

P31946

14-3-3 protein beta/alpha

YWHAB

-0.16

0.74

0.00317

0.00205

MAPK cascade,protein targeting,viral process,negat…

transcription corepressor activity,protein binding…

nucleus,cytoplasm,mitochondrion,cytosol,cell-cell …

57

37

87

NLLSVAYK.2|NLLSVAYK.1|NLLSVAYKNVVGAR.3|NLLSVAYKNVV…

SEN / CTL

P51991

Heterogeneous nuclear ribonucleoprotein A3

HNRNPA3

-0.16

0.28

0.0302

0.0133

mRNA splicing, via spliceosome,gene expression,mRN…

nucleotide binding,RNA binding,mRNA binding,protei…

nucleus,nucleoplasm,cytoplasm,intracellular ribonu…

12

32

62

YGKIETIEVMEDR.3|YGKIETIEVMEDR.2|IETIEVMEDR.2|IETIE…

SEN / CTL

P11166

Solute carrier family 2, facilitated glucose transporter member 1

SLC2A1

-0.16

0.31

0.0359

0.0152

lactose biosynthetic process,protein complex assem…

glucose transmembrane transporter activity,protein…

Golgi membrane,female pronucleus,cytosol,plasma me…

9

10

17

TFDEIASGFR.2|VTILELFR.2|LRGTADVTHDLQEMKEESR.4|LRGT…

SEN / CTL

Q9HAT2

Sialate O-acetylesterase

SIAE

-0.16

0.3

0.0389

0.0162

regulation of immune system process,carbohydrate m…

sialate O-acetylesterase activity

extracellular space,lysosome,extracellular exosome

12

18

31

WHQTADFGYVPNPK.3|WHQTADFGYVPNPK.2|YMSAVC[CAM]WLFGR…

SEN / CTL

P18206

Vinculin

VCL

-0.17

0.9

0.0113

0.00589

morphogenesis of an epithelium,platelet degranulat…

dystroglycan binding,actin binding,structural mole…

extracellular region,cytosol,cytoskeleton,plasma m…

198

102

192

AIPDLTAPVAAVQAAVSNLVR.3|AIPDLTAPVAAVQAAVSNLVR.2|GW…

SEN / CTL

P09960

Leukotriene A-4 hydrolase

LTA4H

-0.17

0.7

0.0126

0.00644

proteolysis,leukotriene metabolic process,leukotri…

aminopeptidase activity,epoxide hydrolase activity…

nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr…

48

45

79

PEIVDTC[CAM]SLASPASVC[CAM]R.3|PEIVDTC[CAM]SLASPASV…

SEN / CTL

O75083

WD repeat-containing protein 1

WDR1

-0.17

0.9

0.0267

0.0121

platelet degranulation,sensory perception of sound…

actin filament binding

podosome,extracellular region,cytoplasm,cytosol,ac…

87

47

76

LYSILGTTLKDEGK.3|LYSILGTTLKDEGK.2|VFASLPQVER.2|YAP…

SEN / CTL

P04424

Argininosuccinate lyase

ASL

-0.17

0.48

0.0355

0.0151

urea cycle,internal protein amino acid acetylation…

argininosuccinate lyase activity,protein binding

cytoplasm,cytosol,extracellular exosome

12

29

36

FNASIAYDR.2|MAEDLILYC[CAM]TK.2|INVLPLGSGAIAGNPLGVD…

SEN / CTL

Q13838

Spliceosome RNA helicase DDX39B

DDX39B

-0.17

0.39

0.0958

0.0344

spliceosomal complex assembly,mRNA splicing, via s…

ATP-dependent RNA helicase activity,protein bindin…

transcription export complex,nucleus,nucleoplasm,s…

18

15

31

VAVFFGGLSIK.2|C[CAM]IALAQLLVEQNFPAIAIHR.3|C[CAM]IA…

SEN / CTL

P24534

Elongation factor 1-beta

EEF1B2

-0.17

0.39

0.122

0.0419

translational elongation,response to ethanol

translation elongation factor activity,protein bin…

cytoplasm,cytosol,eukaryotic translation elongatio…

18

13

25

LVPVGYGIK.2|SIQADGLVWGSSK.2|SIQADGLVWGSSK.3|SSILLD…

SEN / CTL

P04075

Fructose-bisphosphate aldolase A

ALDOA

-0.18

0.88

0.000072

0.0000744

platelet degranulation,fructose metabolic process,…

actin binding,fructose-bisphosphate aldolase activ…

extracellular region,extracellular space,nucleus,c…

153

51

110

VDKGVVPLAGTNGETTTQGLDGLSER.3|VDKGVVPLAGTNGETTTQGLD…

SEN / CTL

P31153

S-adenosylmethionine synthase isoform type-2

MAT2A

-0.18

0.27

0.0265

0.012

S-adenosylmethionine biosynthetic process,one-carb…

methionine adenosyltransferase activity,protein bi…

cytosol,methionine adenosyltransferase complex

15

24

40

NFDLRPGVIVR.3|FVIGGPQGDAGLTGR.2|FVIGGPQGDAGLTGR.3|…

SEN / CTL

P14174

Macrophage migration inhibitory factor

MIF

-0.18

0.33

0.135

0.0449

prostaglandin biosynthetic process,negative regula…

dopachrome isomerase activity,receptor binding,cyt…

extracellular region,extracellular space,nucleopla…

30

10

22

PMFIVNTNVPR.2|PMFIVNTNVPR.3|PM[Oxi]FIVNTNVPR.2|PM[…

SEN / CTL

P04264

Keratin, type II cytoskeletal 1

KRT1

-0.19

0.72

0.0000149

0.000018

complement activation, lectin pathway,retina homeo…

receptor activity,structural molecule activity,pro…

extracellular space,nucleus,cytoskeleton,plasma me…

87

64

116

LALDLEIATYR.2|SLNNQFASFIDKVR.3|SLNNQFASFIDKVR.2|WE…

SEN / CTL

P25787

Proteasome subunit alpha type-2

PSMA2

-0.19

0.18

0.000417

0.000354

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,cytoplasmic mRNA processing bod…

24

15

31

RLTPTEVKDYLAAIA.3|KLAQQYYLVYQEPIPTAQLVQR.3|KLAQQYY…

SEN / CTL

O14818

Proteasome subunit alpha type-7

PSMA7

-0.19

0.74

0.0728

0.0274

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

39

16

28

LTVEDPVTVEYITR.2|LTVEDPVTVEYITR.3|KIC[CAM]ALDDNVC[…

SEN / CTL

O75436

Vacuolar protein sorting-associated protein 26A

VPS26A

-0.19

0.41

0.103

0.0365

intracellular protein transport,Wnt signaling path…

protein binding,protein transporter activity

endosome,early endosome,cytosol,endosome membrane,…

21

22

31

YFLNLVLVDEEDRR.3|ELALPGELTQSR.2|LFLAGYDPTPTMR.2|LF…

SEN / CTL

P13861

cAMP-dependent protein kinase type II-alpha regulatory subunit

PRKAR2A

-0.19

1.19

0.134

0.0448

renal water homeostasis,blood coagulation,activati…

cAMP-dependent protein kinase inhibitor activity,p…

cytoplasm,centrosome,cytosol,plasma membrane,focal…

18

23

31

SLEVSER.2|NLDQEQLSQVLDAMFER.3|NLDQEQLSQVLDAMFER.2|…

SEN / CTL

Q13510

Acid ceramidase

ASAH1

-0.2

0.12

0.00423

0.00258

ceramide metabolic process,glycosphingolipid metab…

catalytic activity,ceramidase activity

extracellular space,lysosomal lumen,extracellular …

9

24

34

LTVYTTLIDVTK.2|ESLDVYELDAK.2|TSQENISFETMYDVLSTKPVL…

SEN / CTL

P14854

Cytochrome c oxidase subunit 6B1

COX6B1

-0.2

0.2

0.0314

0.0137

mitochondrial electron transport, cytochrome c to …

cytochrome-c oxidase activity

mitochondrion,mitochondrial inner membrane,mitocho…

9

9

12

GGDISVC[CAM]EWYQR.2|NC[CAM]WQNYLDFHR.3|NC[CAM]WQNY…

SEN / CTL

O15230

Laminin subunit alpha-5

LAMA5

-0.21

0.59

3.62e-7

6.69e-7

angiogenesis,branching involved in ureteric bud mo…

integrin binding,structural molecule activity

extracellular region,basement membrane,basal lamin…

123

77

89

LGLVWAALQGAR.2|ILQAVQAAEDAAGQALQQADHTWATVVR.3|ILQA…

SEN / CTL

P12429

Annexin A3

ANXA3

-0.21

0.35

0.00000406

0.00000579

phagocytosis,positive regulation of endothelial ce…

calcium ion binding,calcium-dependent phospholipid…

cytoplasm,plasma membrane,membrane,axon,dendrite,p…

66

31

45

MLISILTER.2|GAGTNEDALIEILTTR.2|GAGTNEDALIEILTTR.3|…

SEN / CTL

Q9Y696

Chloride intracellular channel protein 4

CLIC4

-0.21

0.36

0.000272

0.000243

angiogenesis,endothelial cell morphogenesis,chlori…

voltage-gated ion channel activity,chloride channe…

intracellular,cytoplasm,mitochondrion,centrosome,c…

30

24

43

GVVFSVTTVDLK.2|YLTNAYSRDEFTNTC[CAM]PSDKEVEIAYSDVAK…

SEN / CTL

Q9Y3B8

Oligoribonuclease, mitochondrial

REXO2

-0.21

0.12

0.000592

0.000481

nucleobase-containing compound metabolic process,n…

3′-5′-exoribonuclease activity,nucleic acid bindin…

nucleus,nucleolus,mitochondrion,mitochondrial inte…

9

14

18

ESTITLQQAEYEFLSFVR.3|ESTITLQQAEYEFLSFVR.2|ALDDISES…

SEN / CTL

P53634

Dipeptidyl peptidase 1

CTSC

-0.21

0.39

0.00183

0.00128

T cell mediated cytotoxicity,proteolysis,ER to Gol…

cysteine-type endopeptidase activity,serine-type e…

Golgi membrane,extracellular space,lysosome,endopl…

24

16

31

GTDEC[CAM]AIESIAVAATPIPKL.2|NSWGTGWGENGYFR.2|RGTDE…

SEN / CTL

P01034

Cystatin-C

CST3

-0.21

0.52

0.0102

0.00541

eye development,response to hypoxia,cell activatio…

beta-amyloid binding,protease binding,endopeptidas…

extracellular region,basement membrane,extracellul…

27

7

11

ALDFAVGEYNK.2|KQIVAGVNYFLDVELGR.3|TQPNLDNC[CAM]PFH…

SEN / CTL

Q03252

Lamin-B2

LMNB2

-0.21

0.62

0.0252

0.0115

biological_process

molecular_function,structural molecule activity

nuclear inner membrane,lamin filament

24

59

82

LQIEIGK.2|GLESDVAELR.2|ALELENDRLLLK.3|ALELENDRLLLK…

SEN / CTL

Q96G03

Phosphoglucomutase-2

PGM2

-0.21

0.44

0.0301

0.0133

glycogen biosynthetic process,glycogen catabolic p…

magnesium ion binding,phosphoglucomutase activity,…

cytosol,extracellular exosome

15

36

58

LAATTFISQGIPVYLFSDITPTPFVPFTVSHLK.4|LAATTFISQGIPVY…

SEN / CTL

P20810

Calpastatin

CAST

-0.21

1.1

0.0374

0.0156

negative regulation of endopeptidase activity,cell…

endopeptidase inhibitor activity,cysteine-type end…

cytoplasm,endoplasmic reticulum,cytosol,cell-cell …

15

48

69

C[CAM]GEDDETIPSEYR.2|SESELIDELSEDFDRSEC[CAM]K.3|GT…

SEN / CTL

Q99497

Protein deglycase DJ-1

PARK7

-0.22

0.4

2.38e-8

5.64e-8

negative regulation of protein phosphorylation,neg…

transcription coactivator activity,mRNA binding,re…

chromatin,nucleus,cytoplasm,mitochondrion,mitochon…

45

27

55

DGLILTSR.2|GPGTSFEFALAIVEALNGKEVAAQVK.3|GPGTSFEFAL…

SEN / CTL

P13929

Beta-enolase

ENO3

-0.22

0.3

0.0103

0.00543

gluconeogenesis,aging,response to drug,skeletal mu…

magnesium ion binding,phosphopyruvate hydratase ac…

phosphopyruvate hydratase complex,extracellular sp…

9

14

19

VNQIGSVTESIQAC[CAM]K.2|VNQIGSVTESIQAC[CAM]K.3|YGKD…

SEN / CTL

Q9Y5Z4

Heme-binding protein 2

HEBP2

-0.22

0.59

0.0949

0.0342

negative regulation of mitochondrial membrane pote…

protein binding

cytoplasm,mitochondrion,extracellular exosome

9

10

11

AEMTVFVR.2|NQEQLLTLASILR.2|NQEQLLTLASILR.3|VYYTAGY…

SEN / CTL

O95967

EGF-containing fibulin-like extracellular matrix protein 2

EFEMP2

-0.22

0.42

0.0958

0.0344

extracellular matrix structural constituent,calciu…

extracellular region,basement membrane,extracellul…

6

6

6

C[CAM]INHYGGYLC[CAM]LPR.3|LC[CAM]QDIDEC[CAM]ESGAHQ…

SEN / CTL

P07858

Cathepsin B

CTSB

-0.23

0.44

0.00219

0.0015

toll-like receptor signaling pathway,proteolysis,c…

cysteine-type endopeptidase activity,serine-type e…

extracellular region,extracellular space,intracell…

39

22

46

VMFTEDLKLPASFDAR.3|EQWPQC[CAM]PTIK.2|GQDHC[CAM]GIE…

SEN / CTL

P05386

60S acidic ribosomal protein P1

RPLP1

-0.23

0.24

0.00921

0.00498

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,protein binding…

cytoplasm,cytosol,focal adhesion,cytosolic large r…

15

5

12

AAGVNVEPFWPGLFAK.2|AAGVNVEPFWPGLFAK.3|ALANVNIGSLIC…

SEN / CTL

O00148

ATP-dependent RNA helicase DDX39A

DDX39A

-0.23

0.39

0.108

0.0378

mRNA splicing, via spliceosome,termination of RNA …

ATP-dependent RNA helicase activity,protein bindin…

nucleus,nucleoplasm,spliceosomal complex,membrane,…

27

28

52

ILVATNLFGR.2|GLAITFVSDENDAK.2|GLAITFVSDENDAK.3|DFL…

SEN / CTL

P29401

Transketolase

TKT

-0.24

0.69

3.26e-8

7.34e-8

xylulose biosynthetic process,pentose-phosphate sh…

transketolase activity,protein homodimerization ac…

nucleus,nucleoplasm,peroxisome,cytosol,vesicle,mye…

150

53

103

TVPFC[CAM]STFAAFFTR.2|TVPFC[CAM]STFAAFFTR.3|VLDPFT…

SEN / CTL

P11021

78 kDa glucose-regulated protein

HSPA5

-0.24

1.05

0.0202

0.0095

ER overload response,activation of signaling prote…

glycoprotein binding,calcium ion binding,protein b…

nucleus,mitochondrion,endoplasmic reticulum,endopl…

165

68

133

IINEPTAAAIAYGLDKR.3|IINEPTAAAIAYGLDKR.2|VLEDSDLKKS…

SEN / CTL

O00469

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2

PLOD2

-0.24

0.59

0.143

0.0471

response to hypoxia,cellular protein modification …

iron ion binding,procollagen-lysine 5-dioxygenase …

endoplasmic reticulum,endoplasmic reticulum membra…

33

33

47

SEDYVDIVQGNR.2|VLGQGEEWRGGDGINSIGGGQK.3|IFTENIVEQP…

SEN / CTL

P08758

Annexin A5

ANXA5

-0.25

0.74

0.000369

0.000319

signal transduction,blood coagulation,response to …

phospholipase inhibitor activity,calcium ion bindi…

intracellular,cytoplasm,focal adhesion,external si…

108

45

70

GLGTDEESILTLLTSR.3|GLGTDEESILTLLTSR.2|VLTEIIASR.2|…

SEN / CTL

Q9NUQ9

Protein FAM49B

FAM49B

-0.26

0.32

0.00323

0.00208

cilium,membrane,extracellular exosome

12

23

41

VLKDQPPNSVEGLLNALR.3|VLKDQPPNSVEGLLNALR.2|INNVPAEG…

SEN / CTL

Q9Y287

Integral membrane protein 2B

ITM2B

-0.26

0.66

0.0316

0.0138

nervous system development,negative regulation of …

beta-amyloid binding,protein binding,ATP binding

Golgi membrane,extracellular region,extracellular …

6

6

6

NLLELLINIK.2|FAVETLIC[CAM]S.2|VTFNSALAQK.2|IENIDHL…

SEN / CTL

Q15274

Nicotinate-nucleotide pyrophosphorylase [carboxylating]

QPRT

-0.27

0.27

0.00000734

0.00000976

NAD biosynthetic process,NAD metabolic process,qui…

nicotinate-nucleotide diphosphorylase (carboxylati…

cytoplasm,cytosol,extracellular exosome

18

11

15

C[CAM]SGIASAAAAAVEAAR.3|C[CAM]SGIASAAAAAVEAAR.2|YD…

SEN / CTL

Q96C90

Protein phosphatase 1 regulatory subunit 14B

PPP1R14B

-0.27

0.28

0.000734

0.000581

regulation of protein dephosphorylation,regulation…

protein serine/threonine phosphatase inhibitor act…

cytoplasm

15

9

14

VKELLVDC[CAM]YKPTEAFISGLLDKIR.4|VYFQSPPGAAGEGPGGAD…

SEN / CTL

Q9NVN3

Synembryn-B

RIC8B

-0.27

0.19

0.121

0.0416

regulation of G-protein coupled receptor protein s…

G-protein alpha-subunit binding,guanyl-nucleotide …

cytoplasm,centrosome,cytosol,plasma membrane,cell …

3

1

1

GSSYREGLTPVLSLLTEC[CAM]SR.3

SEN / CTL

P30101

Protein disulfide-isomerase A3

PDIA3

-0.28

0.98

0.00000233

0.00000355

antigen processing and presentation of peptide ant…

protein disulfide isomerase activity,cysteine-type…

nucleus,endoplasmic reticulum,endoplasmic reticulu…

120

62

120

FLQDYFDGNLKR.3|FLQDYFDGNLKR.2|KTFSHELSDFGLESTAGEIP…

SEN / CTL

O14979

Heterogeneous nuclear ribonucleoprotein D-like

HNRNPDL

-0.28

0.3

0.0000807

0.0000819

transcription, DNA-templated,regulation of transcr…

nucleotide binding,DNA binding,poly(A) RNA binding

nucleoplasm,cytoplasm,extracellular exosome

18

22

35

DLTEYLSR.2|FGEVVDC[CAM]TIK.2|GFGFVLFK.2|GFGFVLFK.1…

SEN / CTL

P10599

Thioredoxin

TXN

-0.28

0.27

0.000516

0.00043

sulfate assimilation,negative regulation of transc…

protein binding,protein disulfide oxidoreductase a…

nucleus,nucleoplasm,cytoplasm,mitochondrion,cytoso…

24

12

20

TAFQEALDAAGDKLVVVDFSATWC[CAM]GPC[CAM]K.4|TAFQEALDA…

SEN / CTL

P25789

Proteasome subunit alpha type-4

PSMA4

-0.28

0.91

0.00263

0.00173

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,cytoplasmic mRNA processing bod…

36

18

30

LLDEVFFSEK.2|IYKLNEDMAC[CAM]SVAGITSDANVLTNELR.3|YL…

SEN / CTL

P63104

14-3-3 protein zeta/delta

YWHAZ

-0.28

1.42

0.00692

0.00396

protein targeting,signal transduction,platelet act…

protein binding,transcription factor binding,prote…

extracellular space,nucleus,nucleoplasm,cytoplasm,…

84

22

53

IETELRDIC[CAM]NDVLSLLEK.3|IETELRDIC[CAM]NDVLSLLEK….

SEN / CTL

Q14393

Growth arrest-specific protein 6

GAS6

-0.28

0.62

0.019

0.00903

neuron migration,positive regulation of protein ph…

phosphatidylserine binding,receptor binding,voltag…

extracellular region,extracellular space,cytoplasm…

15

11

13

SPVLTFAGGLPDVPVTSAPVTAFYR.3|AVPLSVALVDYHSTK.3|AVPL…

SEN / CTL

O43670

BUB3-interacting and GLEBS motif-containing protein ZNF207

ZNF207

-0.28

0.1

0.0231

0.0107

mitotic sister chromatid segregation,microtubule b…

DNA binding,transcription factor activity, sequenc…

kinetochore,condensed chromosome kinetochore,nucle…

3

10

12

LIHPDEDISLEER.3|LIHPDEDISLEER.2|LIHPDEDISLEERR.4|L…

SEN / CTL

P98172

Ephrin-B1

EFNB1

-0.28

0.19

0.112

0.0389

neural crest cell migration,cell adhesion,cell-cel…

protein binding,ephrin receptor binding

nucleus,cytoplasm,plasma membrane,integral compone…

3

4

4

LYLVRPEQAAAC[CAM]STVLDPNVLVTC[CAM]NRPEQEIR.4|AAALS…

SEN / CTL

O43278

Kunitz-type protease inhibitor 1

SPINT1

-0.28

0.19

0.15

0.0488

neural tube closure,negative regulation of endopep…

serine-type endopeptidase inhibitor activity

extracellular region,extracellular space,plasma me…

6

11

13

EGFINYLTR.2|WYYNPFSEHC[CAM]AR.3|GHC[CAM]VDLPDTGLC[…

SEN / CTL

P06733

Alpha-enolase

ENO1

-0.29

0.83

7.16e-10

2.25e-9

gluconeogenesis,transcription, DNA-templated,respo…

magnesium ion binding,DNA binding,phosphopyruvate …

phosphopyruvate hydratase complex,extracellular sp…

228

56

121

VNQIGSVTESLQAC[CAM]K.2|VNQIGSVTESLQAC[CAM]K.3|YISP…

SEN / CTL

P00338

L-lactate dehydrogenase A chain

LDHA

-0.29

1.05

0.000129

0.000126

response to hypoxia,lactate metabolic process,pyru…

L-lactate dehydrogenase activity,protein binding,k…

nucleus,cytosol,cell-cell adherens junction,membra…

123

38

92

LVIITAGAR.2|VTLTSEEEAR.2|QVVESAYEVIK.2|QVVESAYEVIK…

SEN / CTL

P60174

Triosephosphate isomerase

TPI1

-0.29

0.74

0.000129

0.000126

gluconeogenesis,glycolytic process,pentose-phospha…

triose-phosphate isomerase activity,ubiquitin prot…

extracellular space,nucleus,cytosol,extracellular …

156

37

70

VVLAYEPVWAIGTGK.2|VVLAYEPVWAIGTGK.3|VPADTEVVC[CAM]…

SEN / CTL

Q13442

28 kDa heat- and acid-stable phosphoprotein

PDAP1

-0.29

0.31

0.0002

0.000189

signal transduction,cell proliferation

poly(A) RNA binding

12

15

23

KGVEGLIDIENPNR.3|KGVEGLIDIENPNR.2|GVEGLIDIENPNR.2|…

SEN / CTL

P60900

Proteasome subunit alpha type-6

PSMA6

-0.29

0.39

0.000979

0.000751

MAPK cascade,protein polyubiquitination,stimulator…

RNA binding,endopeptidase activity,threonine-type …

proteasome complex,cytoplasmic mRNA processing bod…

30

20

30

LYQVEYAFK.2|KVPDKLLDSSTVTHLFK.4|KVPDKLLDSSTVTHLFK….

SEN / CTL

P30040

Endoplasmic reticulum resident protein 29

ERP29

-0.3

0.37

0.000115

0.000114

activation of MAPK activity,positive regulation of…

protein homodimerization activity,chaperone bindin…

endoplasmic reticulum,endoplasmic reticulum lumen,…

30

22

35

SLNILTAFQK.2|DGDFENPVPYTGAVK.2|DGDFENPVPYTGAVK.3|Y…

SEN / CTL

Q96AE4

Far upstream element-binding protein 1

FUBP1

-0.3

0.99

0.0539

0.0215

regulation of transcription, DNA-templated,transcr…

single-stranded DNA binding,transcription factor a…

nucleus,nucleoplasm

21

39

63

FAVGIVIGR.2|IGGNEGIDVPIPR.2|IGGNEGIDVPIPR.3|C[CAM]…

SEN / CTL

P61960

Ubiquitin-fold modifier 1

UFM1

-0.3

0.4

0.0938

0.0338

regulation of intracellular estrogen receptor sign…

nucleus,cytoplasm,extracellular exosome

9

5

9

VLSVPESTPFTAVLK.2|VLSVPESTPFTAVLK.3|FAAEEFKVPAATSA…

SEN / CTL

P09651

Heterogeneous nuclear ribonucleoprotein A1

HNRNPA1

-0.31

0.37

1.11e-8

2.83e-8

mRNA splicing, via spliceosome,mRNA processing,RNA…

nucleotide binding,single-stranded DNA binding,RNA…

nucleus,nucleoplasm,spliceosomal complex,cytoplasm…

42

41

92

LFIGGLSFETTDESLR.2|LFIGGLSFETTDESLR.3|KLFIGGLSFETT…

SEN / CTL

O00410

Importin-5

IPO5

-0.31

0.6

0.000453

0.00038

protein import into nucleus, docking,protein impor…

GTPase inhibitor activity,protein binding,nuclear …

nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla…

39

61

119

ITFLLQAIR.2|VIAALLQTMEDQGNQR.2|VIAALLQTMEDQGNQR.3|…

SEN / CTL

Q8IWT0

Protein archease

ZBTB8OS

-0.31

0.16

0.0638

0.0246

tRNA splicing, via endonucleolytic cleavage and li…

metal ion binding

nucleoplasm,extracellular exosome,tRNA-splicing li…

3

2

2

FSADEFFIPR.2|SIGWGEEFSLSK.2

SEN / CTL

P35237

Serpin B6

SERPINB6

-0.32

0.3

5.51e-7

9.73e-7

sensory perception of sound,negative regulation of…

protease binding,serine-type endopeptidase inhibit…

extracellular space,cytoplasm,cytosol,protein comp…

45

28

44

LVLVNAVYFR.2|SC[CAM]DFLSSFR.2|IAELLSPGSVDPLTR.2|IA…

SEN / CTL

P26599

Polypyrimidine tract-binding protein 1

PTBP1

-0.32

0.48

0.0267

0.0121

alternative mRNA splicing, via spliceosome,regulat…

nucleotide binding,RNA binding,protein binding,pol…

nucleoplasm,nucleolus,membrane,extracellular exoso…

18

35

87

VTPQSLFILFGVYGDVQR.3|VTPQSLFILFGVYGDVQR.2|KLPIDVTE…

SEN / CTL

Q6PCB0

von Willebrand factor A domain-containing protein 1

VWA1

-0.32

0.24

0.0361

0.0152

extracellular matrix organization,behavioral respo…

identical protein binding

basement membrane,interstitial matrix,extracellula…

6

15

25

EQLFAEASGARPGVPK.3|EQLFAEASGARPGVPK.2|VREFVGQLVAPL…

SEN / CTL

Q9Y2B0

Protein canopy homolog 2

CNPY2

-0.33

0.33

0.000063

0.000067

enzyme linked receptor protein signaling pathway,t…

protein binding

endoplasmic reticulum,integral component of plasma…

21

15

27

INPDGSQSVVEVPYAR.2|INPDGSQSVVEVPYAR.3|SEAHLTELLEEI…

SEN / CTL

Q969H8

Myeloid-derived growth factor

MYDGF

-0.33

0.36

0.000689

0.000555

angiogenesis,positive regulation of protein phosph…

protein binding

extracellular space,endoplasmic reticulum lumen,en…

18

8

13

SYLYFTQFK.2|ESDVPLKTEEFEVTK.3|ESDVPLKTEEFEVTK.2|AA…

SEN / CTL

Q07021

Complement component 1 Q subcomponent-binding protein, mitochondrial

C1QBP

-0.33

0.18

0.00187

0.0013

negative regulation of transcription from RNA poly…

complement component C1q binding,transcription cor…

extracellular space,nucleus,nucleolus,cytoplasm,mi…

6

12

21

ALVLDC[CAM]HYPEDEVGQEDEAESDIFSIR.3|ALVLDC[CAM]HYPE…

SEN / CTL

P36551

Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial

CPOX

-0.33

0.5

0.00743

0.00419

protoporphyrinogen IX biosynthetic process,heme bi…

coproporphyrinogen oxidase activity,structural con…

cytoplasm,mitochondrion,mitochondrial inner membra…

9

29

42

AVVPSYIPLVK.2|IESILMSLPLTAR.2|IESILMSLPLTAR.3|IESI…

SEN / CTL

P62857

40S ribosomal protein S28

RPS28

-0.33

0.59

0.0626

0.0243

ribosomal small subunit assembly,nuclear-transcrib…

RNA binding,structural constituent of ribosome,pol…

nucleoplasm,cytoplasm,cytosol,small ribosomal subu…

21

8

13

EGDVLTLLESEREAR.3|NVKGPVREGDVLTLLESER.3|GPVREGDVLT…

SEN / CTL

Q04760

Lactoylglutathione lyase

GLO1

-0.34

0.25

0.0000223

0.0000259

carbohydrate metabolic process,pyruvate metabolic …

lactoylglutathione lyase activity,zinc ion binding

cytoplasm,cytosol,extracellular exosome

18

16

31

GFGHIGIAVPDVYSAC[CAM]KR.4|GFGHIGIAVPDVYSAC[CAM]KR….

SEN / CTL

Q9UKK9

ADP-sugar pyrophosphatase

NUDT5

-0.34

0.39

0.00612

0.00358

chromatin remodeling,nucleotide metabolic process,…

magnesium ion binding,protein binding,nucleotidylt…

intracellular,nucleus,cytosol,extracellular exosom…

21

17

27

VYSYALALK.2|TLHYEC[CAM]IVLVK.3|TLHYEC[CAM]IVLVK.2|…

SEN / CTL

Q9BVG4

Protein PBDC1

PBDC1

-0.35

0.14

0.00019

0.00018

biological_process

molecular_function

cellular_component

9

12

17

IQFFAIEIAR.2|LISSVDPQFLK.2|FNGIVEDFNYGTLLR.2|AMQHA…

SEN / CTL

P49327

Fatty acid synthase

FASN

-0.35

0.88

0.00057

0.000467

osteoblast differentiation,acetyl-CoA metabolic pr…

fatty acid synthase activity,[acyl-carrier-protein…

cytoplasm,mitochondrion,Golgi apparatus,cytosol,pl…

57

162

312

TGTVSLEVR.2|SEGVVAVLLTK.2|FC[CAM]FTPHTEEGC[CAM]LSE…

SEN / CTL

Q99873

Protein arginine N-methyltransferase 1

PRMT1

-0.35

0.32

0.0016

0.00114

regulation of transcription, DNA-templated,protein…

protein binding,methyltransferase activity,N-methy…

nucleus,nucleoplasm,cytoplasm,cytosol,methylosome

15

32

48

DKWLAPDGLIFPDR.3|DKWLAPDGLIFPDR.2|KVIGIEC[CAM]SSIS…

SEN / CTL

P49721

Proteasome subunit beta type-2

PSMB2

-0.35

0.92

0.0154

0.00758

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

18

21

33

FILNLPTFSVR.2|IIDKNGIHDLDNISFPK.4|NGYELSPTAAANFTR….

SEN / CTL

Q14696

LDLR chaperone MESD

MESDC2

-0.35

0.27

0.0191

0.00904

protein folding,mesoderm development,Wnt signaling…

molecular_function,low-density lipoprotein particl…

cellular_component,endoplasmic reticulum,plasma me…

6

15

22

DGSYAWEIKDFLVGQDR.3|DGSYAWEIKDFLVGQDR.2|IDPSKPESIL…

SEN / CTL

O15240

Neurosecretory protein VGF

VGF

-0.35

0.26

0.133

0.0446

ovarian follicle development,response to dietary e…

molecular_function,hormone activity,neuropeptide h…

extracellular space,transport vesicle,cytoplasmic …

3

10

11

LADLASDLLLQYLLQGGAR.3|LADLASDLLLQYLLQGGAR.2|RAQEEA…

SEN / CTL

Q9UBG0

C-type mannose receptor 2

MRC2

-0.36

0.33

0.0204

0.00956

osteoblast differentiation,endocytosis,signal tran…

transmembrane signaling receptor activity,protein …

integral component of plasma membrane,focal adhesi…

12

30

39

TLGDQLSLLLGAR.2|DC[CAM]SIALPYVC[CAM]K.2|GAWLGMNFNP…

SEN / CTL

Q9NQP4

Prefoldin subunit 4

PFDN4

-0.36

0.5

0.0727

0.0274

protein folding

protein binding,unfolded protein binding,chaperone…

nucleus,cytoplasm,mitochondrion,cytosol,prefoldin …

9

7

10

ITELKEEIEVK.3|ITELKEEIEVK.2|NLQEEIDALESR.2|NLQEEID…

SEN / CTL

O00391

Sulfhydryl oxidase 1

QSOX1

-0.36

0.79

0.1

0.0358

platelet degranulation,negative regulation of macr…

protein disulfide isomerase activity,flavin-linked…

extracellular region,extracellular space,Golgi app…

51

23

29

DFNIPGFPTVR.2|VGSPNAAVLWLWSSHNR.3|SFYTAYLQR.2|NNEE…

SEN / CTL

P09211

Glutathione S-transferase P

GSTP1

-0.37

0.63

0.000541

0.000445

response to reactive oxygen species,negative regul…

glutathione transferase activity,glutathione perox…

extracellular space,intracellular,nucleus,cytoplas…

48

20

44

ALPGQLKPFETLLSQNQGGK.3|ALPGQLKPFETLLSQNQGGK.2|ALPG…

SEN / CTL

O43854

EGF-like repeat and discoidin I-like domain-containing protein 3

EDIL3

-0.38

0.46

0.00476

0.00286

cell adhesion,multicellular organism development,p…

integrin binding,calcium ion binding

extracellular matrix,extracellular exosome,extrace…

15

11

13

SGHIQDYQITASSIFR.3|SGHIQDYQITASSIFR.2|GNIDNNTPYANS…

SEN / CTL

P62258

14-3-3 protein epsilon

YWHAE

-0.38

1.2

0.00699

0.00398

G2/M transition of mitotic cell cycle,neuron migra…

protein binding,potassium channel regulator activi…

mitochondrion,cytosol,kinesin complex,cell-cell ad…

90

36

102

LIC[CAM]C[CAM]DILDVLDKHLIPAANTGESK.4|LIC[CAM]C[CAM…

SEN / CTL

P15374

Ubiquitin carboxyl-terminal hydrolase isozyme L3

UCHL3

-0.38

0.36

0.00704

0.004

ubiquitin-dependent protein catabolic process,prot…

thiol-dependent ubiquitin-specific protease activi…

nucleus,cytoplasm,extracellular exosome

12

15

26

FLEESVSMSPEER.2|FLEESVSM[Oxi]SPEER.2|SQGQDVTSSVYFM…

SEN / CTL

P13667

Protein disulfide-isomerase A4

PDIA4

-0.38

1.14

0.00841

0.00465

protein folding,protein secretion,response to endo…

protein disulfide isomerase activity,protein bindi…

endoplasmic reticulum lumen,cell surface,melanosom…

60

69

125

FDVSGYPTIK.2|FDVSGYPTLK.2|IANILKDKDPPIPVAK.4|IANIL…

SEN / CTL

Q9UHY7

Enolase-phosphatase E1

ENOPH1

-0.38

0.34

0.0136

0.00682

dephosphorylation,L-methionine biosynthetic proces…

magnesium ion binding,acireductone synthase activi…

nucleus,cytosol,extracellular exosome

9

11

14

LLFGHSTEGDILELVDGHFDTK.4|LLFGHSTEGDILELVDGHFDTK.3|…

SEN / CTL

O00584

Ribonuclease T2

RNASET2

-0.38

0.89

0.0223

0.0104

RNA catabolic process,RNA phosphodiester bond hydr…

RNA binding,ribonuclease activity,ribonuclease T2 …

extracellular region,extracellular space,lysosome,…

33

17

29

SWPFNLEEIKDLLPEMR.3|ELDLNSVLLK.2|LGIKPSINYYQVADFKD…

SEN / CTL

P25788

Proteasome subunit alpha type-3

PSMA3

-0.38

1.23

0.033

0.0143

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytoplasm,c…

24

15

25

AVENSSTAIGIR.2|LFNVDRHVGMAVAGLLADAR.4|VFQVEYAMK.2|…

SEN / CTL

Q92820

Gamma-glutamyl hydrolase

GGH

-0.39

0.21

1.34e-12

6.7e-12

proteolysis,glutamine metabolic process,response t…

exopeptidase activity,omega peptidase activity,gam…

extracellular space,nucleus,lysosome,vacuole,cytos…

30

19

26

YYIAASYVK.2|SINGILFPGGSVDLRR.3|VVPVRLDLTEKDYEILFK….

SEN / CTL

P07942

Laminin subunit beta-1

LAMB1

-0.39

0.48

1.47e-12

7.23e-12

cell adhesion,neuronal-glial interaction involved …

structural molecule activity,extracellular matrix …

extracellular region,basement membrane,laminin-1 c…

84

76

100

YSDIEPSTEGEVIFR.2|YSDIEPSTEGEVIFR.3|ISGVIGPYRETVDS…

SEN / CTL

P06748

Nucleophosmin

NPM1

-0.39

0.23

4.35e-11

1.68e-10

DNA repair,nucleosome assembly,intracellular prote…

DNA binding,transcription coactivator activity,RNA…

nucleus,nucleoplasm,nucleolus,cytoplasm,centrosome…

30

26

61

MSVQPTVSLGGFEITPPVVLR.3|MSVQPTVSLGGFEITPPVVLR.2|M[…

SEN / CTL

P00491

Purine nucleoside phosphorylase

PNP

-0.39

0.39

1.81e-8

4.4e-8

nucleobase-containing compound metabolic process,i…

nucleoside binding,purine nucleobase binding,purin…

intracellular,nucleus,cytoplasm,cytosol,cytoskelet…

48

26

53

VFGFSLITNK.2|HRPQVAIIC[CAM]GSGLGGLTDKLTQAQIFDYGEIP…

SEN / CTL

Q6YP21

Kynurenine–oxoglutarate transaminase 3

CCBL2

-0.39

0.25

0.0121

0.00624

2-oxoglutarate metabolic process,cellular amino ac…

kynurenine-oxoglutarate transaminase activity,pyri…

mitochondrion

6

19

24

IAAIDSLNQYTR.2|MAGATPVFIPLR.2|M[Oxi]AGATPVFIPLR.2|…

SEN / CTL

P37837

Transaldolase

TALDO1

-0.39

0.89

0.013

0.0066

carbohydrate metabolic process,xylulose biosynthet…

sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosp…

nucleus,cytoplasm,cytosol,extracellular exosome

30

31

43

LLGELLQDNAK.2|LLGELLQDNAK.3|LIELYKEAGISKDR.4|NAIDK…

SEN / CTL

P10155

60 kDa SS-A/Ro ribonucleoprotein

TROVE2

-0.39

0.66

0.0168

0.00818

immune system development,transcription from RNA p…

RNA binding,U2 snRNA binding,metal ion binding

nucleus,cytoplasm,intracellular ribonucleoprotein …

24

27

39

LGLENAEALIR.2|ALLQEMPLTALLR.2|ALLQEMPLTALLR.3|ALLQ…

SEN / CTL

P11047

Laminin subunit gamma-1

LAMC1

-0.4

0.39

2.94e-12

1.39e-11

protein complex assembly,cell adhesion,endoderm de…

extracellular matrix structural constituent

extracellular region,basement membrane,laminin-1 c…

72

77

97

LSAEDLVLEGAGLR.2|LSAEDLVLEGAGLR.3|SQEC[CAM]YFDPELY…

SEN / CTL

Q9BRA2

Thioredoxin domain-containing protein 17

TXNDC17

-0.4

0.3

0.00000664

0.00000898

tumor necrosis factor-mediated signaling pathway,o…

peroxidase activity,protein binding,protein-disulf…

cytosol,extracellular exosome

21

11

18

TIFAYFTGSK.2|SWC[CAM]PDC[CAM]VQAEPVVR.2|SWC[CAM]PD…

SEN / CTL

Q12907

Vesicular integral-membrane protein VIP36

LMAN2

-0.4

0.36

0.0125

0.00641

ER to Golgi vesicle-mediated transport,retrograde …

glycoprotein binding,mannose binding,carbohydrate …

Golgi membrane,extracellular space,endoplasmic ret…

9

21

31

WTELAGC[CAM]TADFR.2|NLHGDGIALWYTR.3|NLHGDGIALWYTR….

SEN / CTL

Q9NWV4

UPF0587 protein C1orf123

C1orf123

-0.4

0.09

0.0126

0.00644

biological_process

molecular_function

extracellular exosome

3

8

11

ATLENITNLRPVGEDFR.3|ATLENITNLRPVGEDFR.4|ATLENITNLR…

SEN / CTL

Q9BWS9

Chitinase domain-containing protein 1

CHID1

-0.41

0.07

0.0109

0.00572

carbohydrate metabolic process,chitin catabolic pr…

chitinase activity,protein binding,chitin binding,…

extracellular space,nucleus,lysosome,late endosome…

3

18

27

FTQISPVWLQLK.2|FTQISPVWLQLK.3|GLVVTDLK.2|SQFSDKPVQ…

SEN / CTL

P04439


P13746

HLA class I histocompatibility antigen, A-3 alpha chain;HLA class I histocompatibility antigen, A-11 alpha chain

HLA-A

-0.41

0.65

0.0267

0.0121

;

;

;

39

10

16

WAAVVVPSGEEQR.2|SWTAADMAAQITKR.3|SWTAADMAAQITKR.2|…

SEN / CTL

Q86U42

Polyadenylate-binding protein 2

PABPN1

-0.41

0.21

0.0713

0.027

MAPK cascade,mRNA splicing, via spliceosome,termin…

nucleotide binding,RNA binding,protein binding,pol…

nucleus,nucleoplasm,cytoplasm,nuclear speck,intrac…

3

10

15

TSLALDESLFR.2|VREMEEEAEK.3|VREM[Oxi]EEEAEK.3|VTILC…

SEN / CTL

Q16881

Thioredoxin reductase 1, cytoplasmic

TXNRD1

-0.42

0.27

1.06e-16

7.99e-16

response to reactive oxygen species,mesoderm forma…

thioredoxin-disulfide reductase activity,electron …

nucleus,mitochondrion,cytosol,extracellular exosom…

48

37

60

QFVPIKVEQIEAGTPGR.3|VVAQSTNSEEIIEGEYNTVMLAIGR.3|KV…

SEN / CTL

P63220

40S ribosomal protein S21

RPS21

-0.42

0.23

0.000153

0.000148

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,poly(A) RNA bin…

nucleoplasm,cytoplasm,cytosol,small ribosomal subu…

9

7

18

TYAIC[CAM]GAIR.2|DHASIQMNVAEVDKVTGR.4|DHASIQMNVAEV…

SEN / CTL

Q15631

Translin

TSN

-0.42

0.37

0.000169

0.000161

DNA recombination,RNA metabolic process,gene silen…

DNA binding,single-stranded DNA binding,mRNA bindi…

nucleus,cytosol

15

16

25

KVEEVVYDLSIR.3|KVEEVVYDLSIR.2|EAVTEILGIEPDREK.3|LS…

SEN / CTL

Q16363

Laminin subunit alpha-4

LAMA4

-0.42

0.46

0.00411

0.00253

cell adhesion,regulation of cell adhesion,extracel…

receptor binding,extracellular matrix structural c…

extracellular region,basement membrane,basal lamin…

12

42

51

SLLSDVEELVEKENQASR.3|C[CAM]LDGYIGDSIR.2|ELVDEEADEA…

SEN / CTL

Q8IZ83

Aldehyde dehydrogenase family 16 member A1

ALDH16A1

-0.42

0.08

0.00705

0.004

oxidation-reduction process

aminobutyraldehyde dehydrogenase activity,4-trimet…

membrane,extracellular exosome

3

23

29

AALLWALAAALER.2|LAEVIQK.2|LLWTLESLVTGR.3|LLWTLESLV…

SEN / CTL

Q8N1N4

Keratin, type II cytoskeletal 78

KRT78

-0.42

0.15

0.0339

0.0145

structural molecule activity

extracellular space,keratin filament,extracellular…

3

13

14

TLNNQFASFIDKVR.3|VQISQLHQEIQR.3|VQISQLHQEIQR.2|TQE…

SEN / CTL

P10586

Receptor-type tyrosine-protein phosphatase F

PTPRF

-0.43

0.26

1.63e-15

1.08e-14

cell adhesion,transmembrane receptor protein tyros…

protein tyrosine phosphatase activity,transmembran…

plasma membrane,integral component of plasma membr…

45

55

65

NVLELSNVVR.2|IISYTVVFR.2|WFYIVVVPIDR.2|SDMGVGVFTPT…

SEN / CTL

P28066

Proteasome subunit alpha type-5

PSMA5

-0.43

0.33

0.000014

0.0000173

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytoplasm,c…

21

17

34

LFQVEYAIEAIK.2|LFQVEYAIEAIK.3|SEYDRGVNTFSPEGR.3|AI…

SEN / CTL

P22352

Glutathione peroxidase 3

GPX3

-0.43

0.18

0.00041

0.000349

response to reactive oxygen species,response to li…

glutathione peroxidase activity,transcription fact…

extracellular region,extracellular space,extracell…

6

7

10

MDILSYMR.2|FLVGPDGIPIMR.2|FLVGPDGIPIM[Oxi]R.2|LFWE…

SEN / CTL

Q16836

Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

HADH

-0.43

0.43

0.00265

0.00175

fatty acid beta-oxidation,response to activity,res…

3-hydroxyacyl-CoA dehydrogenase activity,NAD+ bind…

nucleoplasm,cytoplasm,mitochondrion,mitochondrial …

12

22

45

TFESLVDFSK.2|TLSTIATSTDAASVVHSTDLVVEAIVENLK.4|TLST…

SEN / CTL

P07686

Beta-hexosaminidase subunit beta

HEXB

-0.43

0.31

0.0129

0.0066

skeletal system development,glycosphingolipid meta…

beta-N-acetylhexosaminidase activity,acetylglucosa…

acrosomal vesicle,extracellular space,membrane,azu…

9

27

38

VLDIIATINK.2|LAPGTIVEVWKDSAYPEELSR.3|LAPGTIVEVWKDS…

SEN / CTL

Q9Y646

Carboxypeptidase Q

CPQ

-0.43

0.54

0.0373

0.0156

proteolysis,thyroid hormone generation,tissue rege…

carboxypeptidase activity,protein homodimerization…

extracellular space,cytoplasm,lysosome,endoplasmic…

6

10

10

LALLVDTVGPR.2|AIINLAVYGK.2|VHLEPVRIPHWER.4|VGALASL…

SEN / CTL

P19338

Nucleolin

NCL

-0.44

0.66

7.97e-12

3.36e-11

angiogenesis,positive regulation of transcription …

nucleotide binding,RNA binding,protein binding,pro…

nucleus,nucleoplasm,nucleolus,cell cortex,membrane…

60

63

97

NDLAVVDVR.2|GFGFVDFNSEEDAK.2|EVFEDAAEIR.2|NLPYKVTQ…

SEN / CTL

P48637

Glutathione synthetase

GSS

-0.44

0.42

3.09e-7

5.84e-7

cellular amino acid metabolic process,glutathione …

magnesium ion binding,glutathione synthase activit…

cytosol,extracellular exosome

30

27

39

AWELYGSPNALVLLIAQEKER.3|ALAEGVLLR.2|EGIAQTVFLGLNR….

SEN / CTL

P28065

Proteasome subunit beta type-9

PSMB9

-0.44

0.33

0.00113

0.000838

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity

proteasome complex,nucleoplasm,cytoplasm,cytosol,p…

12

8

12

FTTDAIALAMSR.2|FTTDAIALAMSR.3|EGGQVYGTLGGMLTR.2|VI…

SEN / CTL

P30086

Phosphatidylethanolamine-binding protein 1

PEBP1

-0.45

0.78

0.00386

0.00242

MAPK cascade,negative regulation of endopeptidase …

serine-type endopeptidase inhibitor activity,prote…

nucleus,cytosol,extracellular exosome

57

25

48

YVWLVYEQDRPLKC[CAM]DEPILSNR.4|YVWLVYEQDRPLKC[CAM]D…

SEN / CTL

P62310

U6 snRNA-associated Sm-like protein LSm3

LSM3

-0.45

0.38

0.00605

0.00355

mRNA splicing, via spliceosome,mRNA processing,cyt…

RNA binding,protein binding,poly(A) RNA binding

cytoplasmic mRNA processing body,nucleus,nucleopla…

9

4

4

GDGVVLVAPPLRVG.2|NIPMLFVR.2|GDGVVLVAPPLR.2|RNIPMLF…

SEN / CTL

Q9H299

SH3 domain-binding glutamic acid-rich-like protein 3

SH3BGRL3

-0.45

1.47

0.116

0.0401

regulation of actin filament depolymerization,regu…

GTPase activator activity,electron carrier activit…

nucleus,cytoplasm,lamellipodium,extracellular exos…

12

7

15

ATPPQIVNGDQYC[CAM]GDYELFVEAVEQNTLQEFLK.4|IQYQLVDIS…

SEN / CTL

P17174

Aspartate aminotransferase, cytoplasmic

GOT1

-0.46

0.23

1.75e-10

6.2e-10

gluconeogenesis,2-oxoglutarate metabolic process,o…

L-aspartate:2-oxoglutarate aminotransferase activi…

nucleus,cytoplasm,lysosome,cytosol,axon terminus,e…

30

36

57

VGGVQSLGGTGALR.2|IGADFLAR.2|TDDC[CAM]HPWVLPVVK.3|T…

SEN / CTL

Q9NZ08

Endoplasmic reticulum aminopeptidase 1

ERAP1

-0.46

0.29

1e-8

2.58e-8

angiogenesis,adaptive immune response,antigen proc…

endopeptidase activity,aminopeptidase activity,int…

extracellular region,extracellular space,endoplasm…

24

41

61

GFPLITITVR.2|ILASTQFEPTAAR.2|TKTDVLILPEEVEWIK.3|TK…

SEN / CTL

Q9BWD1

Acetyl-CoA acetyltransferase, cytosolic

ACAT2

-0.46

0.2

2.49e-8

5.86e-8

lipid metabolic process,fatty acid beta-oxidation

acetyl-CoA C-acetyltransferase activity

nucleus,nucleolus,cytoplasm,mitochondrion,extracel…

18

22

41

ILVTLLHTLER.3|ILVTLLHTLER.2|AGHFDKEIVPVLVSTR.4|AGH…

SEN / CTL

Q02818

Nucleobindin-1

NUCB1

-0.46

0.99

0.00000375

0.00000545

response to cisplatin,regulation of protein target…

G-protein alpha-subunit binding,DNA binding,calciu…

extracellular space,nucleus,early endosome,rough e…

63

33

46

DLELLIQTATR.2|LLERLPEVEVPQHL.3|LPEVEVPQHL.2|ELQQAV…

SEN / CTL

P40925

Malate dehydrogenase, cytoplasmic

MDH1

-0.46

0.39

0.00000443

0.00000623

gluconeogenesis,tricarboxylic acid cycle,oxaloacet…

malic enzyme activity,L-malate dehydrogenase activ…

extracellular space,cytoplasm,mitochondrion,centro…

33

23

39

FVEGLPINDFSR.2|VIVVGNPANTNC[CAM]LTASK.2|VIVVGNPANT…

SEN / CTL

P45877

Peptidyl-prolyl cis-trans isomerase C

PPIC

-0.46

0.26

0.00292

0.0019

protein peptidyl-prolyl isomerization,protein fold…

peptidyl-prolyl cis-trans isomerase activity,prote…

cytoplasm,extracellular exosome

6

3

3

TPFVVEIADW.2|IVIGLFGK.2|TVENFVALATGEK.2

SEN / CTL

Q6UVY6

DBH-like monooxygenase protein 1

MOXD1

-0.46

0.05

0.00312

0.00202

oxidation-reduction process

copper ion binding,protein binding,oxidoreductase …

endoplasmic reticulum membrane,integral component …

3

2

2

LVLSLPVNVR.2|ELHTC[CAM]DINDK.2

SEN / CTL

P67936

Tropomyosin alpha-4 chain

TPM4

-0.46

1.24

0.00439

0.00267

osteoblast differentiation,movement of cell or sub…

actin binding,calcium ion binding,protein binding,…

stress fiber,podosome,cytosol,cytoskeleton,muscle …

99

36

62

IQLVEEELDRAQER.3|IQLVEEELDRAQER.2|RIQLVEEELDRAQER….

SEN / CTL

Q13740

CD166 antigen

ALCAM

-0.47

0.48

1.63e-10

5.93e-10

adaptive immune response,cell adhesion,heterophili…

receptor binding,protein binding

immunological synapse,integral component of plasma…

51

30

45

ALFLETEQLK.2|ESLTLIVEGKPQIK.3|ESLTLIVEGKPQIK.2|WKY…

SEN / CTL

P35052

Glypican-1

GPC1

-0.47

0.36

0.0000317

0.0000352

retinoid metabolic process,glycosaminoglycan biosy…

copper ion binding,fibroblast growth factor bindin…

proteinaceous extracellular matrix,extracellular s…

21

13

13

VLQAMLATQLR.2|SFVQGLGVASDVVR.2|GFSLSDVPQAEISGEHLR….

SEN / CTL

P61086

Ubiquitin-conjugating enzyme E2 K

UBE2K

-0.47

0.49

0.126

0.0429

ubiquitin-dependent protein catabolic process,posi…

ubiquitin-protein transferase activity,protein bin…

nucleus,cytoplasm,filopodium tip,extracellular exo…

6

16

27

LWAHVYAGAPVSSPEYTK.3|LWAHVYAGAPVSSPEYTK.4|LWAHVYAG…

SEN / CTL

P62158

Calmodulin

CALM1

-0.48

0.46

4.79e-8

1.05e-7

G2/M transition of mitotic cell cycle,MAPK cascade…

Ras guanyl-nucleotide exchange factor activity,cal…

spindle pole,extracellular region,nucleus,nucleopl…

33

14

31

VFDKDGNGYISAAELR.3|VFDKDGNGYISAAELR.2|EAFSLFDKDGDG…

SEN / CTL

O75347

Tubulin-specific chaperone A

TBCA

-0.48

1.08

0.0133

0.00674

protein folding,tubulin complex assembly,post-chap…

poly(A) RNA binding,beta-tubulin binding,chaperone…

nucleolus,cytoplasm,microtubule,microtubule cytosk…

24

14

23

LVLDSVKLEA.2|ILENEKDLEEAEEYKEAR.4|ILENEKDLEEAEEYKE…

SEN / CTL

Q15637

Splicing factor 1

SF1

-0.48

0.12

0.0157

0.00767

spliceosomal complex assembly,mRNA 3′-splice site …

transcription corepressor activity,RNA binding,pro…

nucleus,nucleoplasm,spliceosomal complex,ribosome

3

20

37

VSDKVMIPQDEYPEINFVGLLIGPR.3|C[CAM]GGAGHIASDC[CAM]K…

SEN / CTL

Q16531

DNA damage-binding protein 1

DDB1

-0.49

0.45

1.45e-14

7.99e-14

nucleotide-excision repair, DNA damage recognition…

DNA binding,protein binding,damaged DNA binding

nuclear chromosome, telomeric region,extracellular…

87

71

100

IGRPSETGIIGIIDPEC[CAM]R.3|LLASINSTVR.2|QSGESIDIITR…

SEN / CTL

P13798

Acylamino-acid-releasing enzyme

APEH

-0.49

0.37

2.5e-7

4.79e-7

translational termination,proteolysis,beta-amyloid…

serine-type endopeptidase activity,omega peptidase…

cytoplasm,cytosol,nuclear membrane,extracellular e…

33

34

45

VTSVVVDVVPR.2|QVLLSEPEEAAALYR.2|QVLLSEPEEAAALYR.3|…

SEN / CTL

P12955

Xaa-Pro dipeptidase

PEPD

-0.49

0.45

0.0000146

0.0000178

proteolysis,cellular amino acid metabolic process,…

aminopeptidase activity,metallocarboxypeptidase ac…

extracellular exosome

24

27

41

VPLALFALNR.2|YAVDDVQYVDEIASVLTSQKPSVLLTLR.3|YAVDDV…

SEN / CTL

O95777

U6 snRNA-associated Sm-like protein LSm8

LSM8

-0.49

0.19

0.034

0.0145

mRNA splicing, via spliceosome

RNA binding,protein binding,U6 snRNA binding,poly(…

nucleoplasm,spliceosomal complex,U4/U6 x U5 tri-sn…

3

4

6

GFDQTINLILDESHER.3|GFDQTINLILDESHER.2|TVAVITSDGR.2…

SEN / CTL

Q15393

Splicing factor 3B subunit 3

SF3B3

-0.5

0.19

2.67e-8

6.21e-8

RNA splicing, via transesterification reactions,mR…

RNA binding

nucleus,nucleoplasm,spliceosomal complex,U12-type …

15

61

96

FLAVGLVDNTVR.2|TVLDPVTGDLSDTR.2|TVLDPVTGDLSDTR.3|M…

SEN / CTL

Q9GZT8

NIF3-like protein 1

NIF3L1

-0.5

0.37

0.000213

0.000198

neuron differentiation,positive regulation of tran…

protein binding,transcription factor binding,ident…

nucleus,cytoplasm,mitochondrion

12

15

19

GIDGVSVTSFSAR.2|ALMQVVDFLSR.2|ALM[Oxi]QVVDFLSR.2|V…

SEN / CTL

P30481


P30483

HLA class I histocompatibility antigen, B-44 alpha chain;HLA class I histocompatibility antigen, B-45 alpha chain

HLA-B

-0.5

1.16

0.00919

0.00498

;

;

;

9

3

4

DGEDQTQDTELVETRPAGDR.3|DGEDQTQDTELVETRPAGDR.4|AYLE…

SEN / CTL

P55145

Mesencephalic astrocyte-derived neurotrophic factor

MANF

-0.51

0.25

0.0000114

0.0000145

response to unfolded protein,biological_process,ne…

growth factor activity,poly(A) RNA binding

extracellular space,nucleus,endoplasmic reticulum

12

16

22

FYQDLKDRDVTFSPATIENELIK.4|IINEVSKPLAHHIPVEK.4|IINE…

SEN / CTL

P22626

Heterogeneous nuclear ribonucleoproteins A2/B1

HNRNPA2B1

-0.51

1.1

0.0000242

0.0000281

negative regulation of transcription from RNA poly…

nucleotide binding,RNA binding,mRNA 3′-UTR binding…

nucleus,nucleoplasm,spliceosomal complex,cytoplasm…

60

47

96

IDTIEIITDR.2|LFIGGLSFETTEESLR.3|LFIGGLSFETTEESLR.2…

SEN / CTL

Q9BYZ2

L-lactate dehydrogenase A-like 6B

LDHAL6B

-0.51

0.3

0.00467

0.00282

carbohydrate metabolic process,pyruvate metabolic …

L-lactate dehydrogenase activity

nucleus,mitochondrial matrix

6

1

2

LIIVSNPVDILTYVAWK.3|LIIVSNPVDILTYVAWK.2

SEN / CTL

P16070

CD44 antigen

CD44

-0.51

0.46

0.00762

0.00427

cell-matrix adhesion,single organismal cell-cell a…

collagen binding,hyaluronic acid binding,cytokine …

cytoplasm,Golgi apparatus,plasma membrane,integral…

12

12

18

YGFIEGHVVIPR.3|YGFIEGHVVIPR.2|ALSIGFETC[CAM]R.2|SQ…

SEN / CTL

P06865

Beta-hexosaminidase subunit alpha

HEXA

-0.52

0.37

0.00000154

0.00000247

carbohydrate metabolic process,glycosaminoglycan b…

beta-N-acetylhexosaminidase activity,acetylglucosa…

membrane,azurophil granule,lysosomal lumen,extrace…

24

21

32

ALLSAPWYLNR.2|GLETFSQLVWK.2|SNPEIQDFMR.2|LTSDLTFAY…

SEN / CTL

P80723

Brain acid soluble protein 1

BASP1

-0.52

0.72

0.049

0.0197

thorax and anterior abdomen determination,gonad de…

transcription corepressor activity,protein binding…

nucleus,cytoplasm,cytoskeleton,plasma membrane,nuc…

9

28

41

AQGPAASAEEPKPVEAPAANSDQTVTVKE.3|AQGPAASAEEPKPVEAPA…

SEN / CTL

P00390

Glutathione reductase, mitochondrial

GSR

-0.53

0.86

0.0503

0.0201

response to reactive oxygen species,glutathione me…

glutathione-disulfide reductase activity,electron …

mitochondrial matrix,cytosol,external side of plas…

33

32

54

GIYAVGDVC[CAM]GK.2|ALLTPVAIAAGR.2|GHAAFTSDPKPTIEVS…

SEN / CTL

P54727

UV excision repair protein RAD23 homolog B

RAD23B

-0.54

0.32

2.45e-7

4.72e-7

nucleotide-excision repair, DNA damage recognition…

damaged DNA binding,single-stranded DNA binding,pr…

proteasome complex,nucleus,nucleoplasm,cytoplasm,X…

21

20

33

NFVVVMVTKPK.2|NFVVVMVTKPK.3|ILNDDTALKEYKIDEK.4|ILN…

SEN / CTL

P00492

Hypoxanthine-guanine phosphoribosyltransferase

HPRT1

-0.54

0.52

0.0000751

0.0000768

response to amphetamine,purine nucleotide biosynth…

nucleotide binding,magnesium ion binding,hypoxanth…

cytoplasm,cytosol,extracellular exosome

21

17

27

SIPMTVDFIR.2|NVLIVEDIIDTGK.2|TMQTLLSLVR.2|TM[Oxi]Q…

SEN / CTL

P98066

Tumor necrosis factor-inducible gene 6 protein

TNFAIP6

-0.54

0.15

0.0274

0.0123

inflammatory response,cell adhesion,signal transdu…

protein binding,hyaluronic acid binding

extracellular space

3

1

1

FLSDASVTAGGFQIK.2

SEN / CTL

P06132

Uroporphyrinogen decarboxylase

UROD

-0.55

0.52

0.00116

0.000858

protoporphyrinogen IX biosynthetic process,heme bi…

uroporphyrinogen decarboxylase activity

nucleoplasm,cytoplasm,cytosol

12

12

18

LRDPEVVASELGYVFQAITLTR.3|LRDPEVVASELGYVFQAITLTR.4|…

SEN / CTL

O43505

Beta-1,4-glucuronyltransferase 1

B4GAT1

-0.55

0.29

0.00393

0.00244

axon guidance,keratan sulfate biosynthetic process…

N-acetyllactosaminide beta-1,3-N-acetylglucosaminy…

Golgi membrane,Golgi apparatus,integral component …

6

5

5

TALASGGVLDASGDYR.2|TTMDPNDVILATHASVDNLLHLSGLLER.4|…

SEN / CTL

P07954

Fumarate hydratase, mitochondrial

FH

-0.55

0.71

0.0054

0.00321

tricarboxylic acid cycle,fumarate metabolic proces…

fumarate hydratase activity

cytoplasm,mitochondrion,mitochondrial matrix,cytos…

18

30

61

IYELAAGGTAVGTGLNTR.2|IYELAAGGTAVGTGLNTR.3|THTQDAVP…

SEN / CTL

P51858

Hepatoma-derived growth factor

HDGF

-0.56

0.36

8.89e-9

2.31e-8

negative regulation of transcription from RNA poly…

nucleotide binding,RNA polymerase II transcription…

extracellular space,nucleoplasm,cytoplasm,transcri…

21

29

48

KGFSEGLWEIENNPTVK.3|KGFSEGLWEIENNPTVK.2|GPPQEEEEEE…

SEN / CTL

O14907

Tax1-binding protein 3

TAX1BP3

-0.56

0.19

0.0205

0.00959

Rho protein signal transduction,negative regulatio…

protein binding,beta-catenin binding,protein C-ter…

nucleus,cytoplasm,cytosol,plasma membrane,extracel…

3

4

5

VSEGGPAEIAGLQIGDK.2|VSEGGPAEIAGLQIGDK.3|AVQQSMLS.2…

SEN / CTL

Q15424

Scaffold attachment factor B1

SAFB

-0.56

0.54

0.0448

0.0183

chromatin organization,transcription, DNA-template…

nucleotide binding,core promoter binding,chromatin…

nucleus,nucleoplasm

6

36

54

AIEDEGGNPDEIEITSEGNKK.3|AIEDEGGNPDEIEITSEGNKK.4|AI…

SEN / CTL

P13497

Bone morphogenetic protein 1

BMP1

-0.56

0.25

0.0591

0.0231

skeletal system development,cartilage condensation…

metalloendopeptidase activity,serine-type endopept…

extracellular region,proteinaceous extracellular m…

3

2

2

AGFAVNFFK.2|NC[CAM]IWQLVAPTQYR.2

SEN / CTL

P05067

Amyloid beta A4 protein

APP

-0.58

0.44

1.25e-9

3.71e-9

response to yeast,suckling behavior,platelet degra…

DNA binding,serine-type endopeptidase inhibitor ac…

extracellular region,extracellular space,nuclear e…

36

21

26

LALENYITALQAVPPRPR.3|WYFDVTEGK.2|ISYGNDALMPSLTETK….

SEN / CTL

P00736

Complement C1r subcomponent

C1R

-0.58

0.34

7.26e-9

1.92e-8

proteolysis,immune response,complement activation,…

serine-type endopeptidase activity,calcium ion bin…

extracellular region,extracellular exosome,blood m…

27

25

35

M[Oxi]GNFPWQVFTNIHGR.3|MGNFPWQVFTNIHGR.3|LPVANPQAC…

SEN / CTL

Q8NBS9

Thioredoxin domain-containing protein 5

TXNDC5

-0.58

0.79

0.0000669

0.00007

protein folding,response to endoplasmic reticulum …

protein disulfide isomerase activity

endoplasmic reticulum,endoplasmic reticulum lumen,…

33

30

49

GYPTLLLFR.2|GYPTLLWFR.2|FVLSQAKDEL.2|IGKVDC[CAM]TQ…

SEN / CTL

Q99729

Heterogeneous nuclear ribonucleoprotein A/B

HNRNPAB

-0.58

0.4

0.000905

0.000702

epithelial to mesenchymal transition,positive regu…

nucleotide binding,RNA binding,mRNA binding,protei…

nucleus,nucleoplasm,cytoplasm,intracellular ribonu…

9

14

26

GFGFILFK.2|MFVGGLSWDTSKK.3|M[Oxi]FVGGLSWDTSKK.3|M[…

SEN / CTL

P35908

Keratin, type II cytoskeletal 2 epidermal

KRT2

-0.58

0.94

0.00103

0.000779

keratinocyte development,epidermis development,ker…

structural constituent of cytoskeleton,protein bin…

extracellular space,nucleus,cytoplasm,Golgi appara…

54

56

105

YEELQVTVGR.2|FLEQQNQVLQTK.2|FLEQQNQVLQTK.3|VDLLNQE…

SEN / CTL

Q71DI3

Histone H3.2

HIST2H3A

-0.58

0.35

0.017

0.00825

negative regulation of transcription from RNA poly…

protein binding,nucleosomal DNA binding,histone bi…

nucleosome,extracellular region,nucleus,nucleoplas…

6

1

4

FQSSAVMALQEASEAYLVGLFEDTNLC[CAM]AIHAK.4|FQSSAVM[Ox…

SEN / CTL

Q9GZM7

Tubulointerstitial nephritis antigen-like

TINAGL1

-0.59

0.41

0.00000325

0.0000048

receptor-mediated endocytosis,immune response,cell…

scavenger receptor activity,extracellular matrix s…

extracellular region,extracellular space,extracell…

21

21

33

ITGWGEETLPDGR.2|LDGAWWFLR.2|QATAHC[CAM]PNSYVNNNDIY…

SEN / CTL

P06744

Glucose-6-phosphate isomerase

GPI

-0.63

0.6

7.28e-20

8.55e-19

angiogenesis,in utero embryonic development,mesode…

glucose-6-phosphate isomerase activity,cytokine ac…

extracellular space,nucleoplasm,cytoplasm,cytosol,…

141

49

107

TLAQLNPESSLFIIASK.2|TLAQLNPESSLFIIASK.3|VKEFGIDPQN…

SEN / CTL

Q06481

Amyloid-like protein 2

APLP2

-0.63

0.34

2.46e-9

7.08e-9

platelet degranulation,G-protein coupled receptor …

DNA binding,serine-type endopeptidase inhibitor ac…

nucleus,plasma membrane,membrane,integral componen…

24

16

20

C[CAM]LVGEFVSDVLLVPEK.3|C[CAM]LVGEFVSDVLLVPEK.2|VP…

SEN / CTL

P09493

Tropomyosin alpha-1 chain

TPM1

-0.64

1.39

0.029

0.0128

in utero embryonic development,positive regulation…

actin binding,structural constituent of cytoskelet…

stress fiber,cytosol,cytoskeleton,muscle thin fila…

60

27

42

AQKDEEKMEIQEIQLK.4|AQKDEEKMEIQEIQLK.3|SKQLEDELVSLQ…

SEN / CTL

O75144

ICOS ligand

ICOSLG

-0.64

0.27

0.0458

0.0186

adaptive immune response,defense response,hyperosm…

receptor binding

plasma membrane,integral component of membrane,ext…

3

1

1

GLYDVVSVLR.2

SEN / CTL

P07195

L-lactate dehydrogenase B chain

LDHB

-0.65

1.22

5.72e-8

1.22e-7

carbohydrate metabolic process,lactate metabolic p…

L-lactate dehydrogenase activity,protein binding,k…

cytoplasm,mitochondrion,cytosol,membrane,myelin sh…

99

35

73

IVVVTAGVR.2|SADTLWDIQKDLKDL.2|SADTLWDIQKDLKDL.3|FI…

SEN / CTL

Q01130

Serine/arginine-rich splicing factor 2

SRSF2

-0.65

0.2

0.00000388

0.00000561

regulation of alternative mRNA splicing, via splic…

nucleotide binding,transcription corepressor activ…

nucleus,nucleoplasm,spliceosomal complex,nuclear s…

9

7

13

FHDKRDAEDAMDAMDGAVLDGR.4|VGDVYIPR.2|DAEDAMDAMDGAVL…

SEN / CTL

P00441

Superoxide dismutase [Cu-Zn]

SOD1

-0.66

0.61

0.0000181

0.0000217

activation of MAPK activity,response to reactive o…

superoxide dismutase activity,copper ion binding,p…

extracellular region,extracellular space,nucleus,n…

30

20

39

LAC[CAM]GVIGIAQ.2|HVGDLGNVTADKDGVADVSIEDSVISLSGDHC…

SEN / CTL

P09341


P19875


P19876

Growth-regulated alpha protein;C-X-C motif chemokine 2;C-X-C motif chemokine 3

CXCL1


CXCL2


CXCL3

-0.66

0.28

0.0011

0.000827

chemotaxis,inflammatory response,immune response,s…

receptor binding,chemokine activity,enzyme activat…

extracellular region,extracellular space,intracell…

6

1

2

SPGPHC[CAM]AQTEVIATLK.3|SPGPHC[CAM]AQTEVIATLK.2

SEN / CTL

P28070

Proteasome subunit beta type-4

PSMB4

-0.66

0.59

0.0392

0.0162

MAPK cascade,protein polyubiquitination,stimulator…

lipopolysaccharide binding,threonine-type endopept…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

15

10

21

TQNPMVTGTSVLGVK.2|TQNPMVTGTSVLGVK.3|TQNPM[Oxi]VTGT…

SEN / CTL

Q15582

Transforming growth factor-beta-induced protein ig-h3

TGFBI

-0.67

0.69

1.25e-17

9.89e-17

angiogenesis,chondrocyte differentiation,cell adhe…

integrin binding,protein binding,collagen binding,…

extracellular region,proteinaceous extracellular m…

93

38

60

LTLLAPLNSVFKDGTPPIDAHTR.4|LTLLAPLNSVFKDGTPPIDAHTR….

SEN / CTL

Q9P2B2

Prostaglandin F2 receptor negative regulator

PTGFRN

-0.68

0.41

1.96e-10

6.87e-10

lipid particle organization

protein binding

endoplasmic reticulum membrane,Golgi apparatus,pla…

24

22

23

FTVSWYYR.2|LDRDSLVHSSPHVALSHVDAR.5|LDRDSLVHSSPHVAL…

SEN / CTL

P27695

DNA-(apurinic or apyrimidinic site) lyase

APEX1

-0.69

0.64

0.00000673

0.00000904

telomere maintenance,DNA repair,base-excision repa…

DNA binding,damaged DNA binding,double-stranded te…

nuclear chromosome, telomeric region,nucleus,nucle…

27

28

52

QGFGELLQAVPLADSFR.2|QGFGELLQAVPLADSFR.3|IC[CAM]SWN…

SEN / CTL

P60033

CD81 antigen

CD81

-0.69

0.36

0.000016

0.0000193

activation of MAPK activity,cell surface receptor …

protein binding,MHC class II protein complex bindi…

immunological synapse,plasma membrane,integral com…

12

5

8

TFHETLDC[CAM]C[CAM]GSSTLTALTTSVLK.3|TFHETLDC[CAM]C…

SEN / CTL

P07108

Acyl-CoA-binding protein

DBI

-0.7

0.19

0.00000345

0.00000503

transport,phosphatidylcholine acyl-chain remodelin…

lipid binding,benzodiazepine receptor binding,long…

endoplasmic reticulum,Golgi apparatus,extracellula…

9

8

18

TKPSDEEMLFIYGHYK.3|TKPSDEEMLFIYGHYK.4|TKPSDEEM[Oxi…

SEN / CTL

P99999

Cytochrome c

CYCS

-0.71

0.36

0.0000636

0.0000673

response to reactive oxygen species,mitochondrial …

protein binding,heme binding,electron transporter,…

protein phosphatase type 2A complex,nucleus,mitoch…

9

13

27

ADLIAYLK.2|ADLIAYLK.1|MIFVGIK.2|M[Oxi]IFVGIK.2|MIF…

SEN / CTL

P63165

Small ubiquitin-related modifier 1

SUMO1

-0.71

0.48

0.116

0.0402

DNA repair,double-strand break repair via nonhomol…

protein binding,transcription factor binding,potas…

heterochromatin,fibrillar center,XY body,nucleus,n…

3

6

8

VIGQDSSEIHFK.3|VIGQDSSEIHFK.2|FLFEGQR.2|IADNHTPK.2…

SEN / CTL

P15291

Beta-1,4-galactosyltransferase 1

B4GALT1

-0.72

0.26

5.53e-9

1.52e-8

epithelial cell development,acute inflammatory res…

beta-N-acetylglucosaminylglycopeptide beta-1,4-gal…

Golgi trans cisterna,Golgi membrane,extracellular …

15

7

9

VAIIIPFR.2|YWLYYLHPVLQR.3|QQLDYGIYVINQAGDTIFNR.3|E…

SEN / CTL

O00560

Syntenin-1

SDCBP

-0.72

0.37

0.0000198

0.0000233

negative regulation of receptor internalization,pr…

glycoprotein binding,frizzled binding,interleukin-…

extracellular space,nucleus,cytoplasm,endoplasmic …

12

13

25

SLMDHTIPEV.2|DSTGHVGFIFK.3|DSTGHVGFIFK.2|SIDNGIFVQ…

SEN / CTL

Q16629

Serine/arginine-rich splicing factor 7

SRSF7

-0.72

0.38

0.00567

0.00335

mRNA splicing, via spliceosome,termination of RNA …

nucleotide binding,protein binding,zinc ion bindin…

nucleus,nucleoplasm,cytoplasm,extracellular exosom…

6

10

17

VYVGNLGTGAGKGELER.3|VYVGNLGTGAGKGELER.2|VRVELSTGMP…

SEN / CTL

Q9NX55

Huntingtin-interacting protein K

HYPK

-0.72

0.4

0.0902

0.0329

protein binding

nucleoplasm,cytoplasm,microtubule cytoskeleton

3

11

15

SLREHMGNVVEALIALTN.3|KHDSGAADLER.3|KHDSGAADLER.2|H…

SEN / CTL

P07093

Glia-derived nexin

SERPINE2

-0.73

0.22

1.55e-15

1.04e-14

blood coagulation,negative regulation of cell prol…

serine-type endopeptidase inhibitor activity,recep…

extracellular region,extracellular space,cytosol,e…

27

11

14

LVLVNAVYFK.2|SYQVPMLAQLSVFR.2|ASAATTAILIAR.2|TIDSW…

SEN / CTL

P01130

Low-density lipoprotein receptor

LDLR

-0.73

0.43

0.00722

0.00408

lipid metabolic process,endocytosis,receptor-media…

virus receptor activity,glycoprotein binding,prote…

lysosome,early endosome,late endosome,Golgi appara…

6

18

20

NVVALDTEVASNR.2|AVGSIAYLFFTNR.2|AHGVSSYDTVISR.3|AH…

SEN / CTL

O14786

Neuropilin-1

NRP1

-0.74

0.31

2.94e-10

9.92e-10

angiogenesis,patterning of blood vessels,neuron mi…

vascular endothelial growth factor-activated recep…

semaphorin receptor complex,extracellular space,ea…

21

12

14

FVTAVGTQGAISK.2|IAPPPVVSSGPFLFIK.3|IAPPPVVSSGPFLFI…

SEN / CTL

P24592

Insulin-like growth factor-binding protein 6

IGFBP6

-0.74

0.09

0.00000478

0.00000658

regulation of cell growth,signal transduction,nega…

receptor binding,insulin-like growth factor I bind…

extracellular region,extracellular space,Golgi app…

6

4

4

HLDSVLQQLQTEVYR.3|EGQEC[CAM]GVYTPNC[CAM]APGLQC[CAM…

SEN / CTL

P13645

Keratin, type I cytoskeletal 10

KRT10

-0.75

0.83

2.62e-12

1.26e-11

keratinocyte differentiation

structural constituent of epidermis

extracellular space,nucleus,cytoplasm,intermediate…

93

52

104

IRLENEIQTYR.3|IRLENEIQTYR.2|LKYENEVALR.3|LKYENEVAL…

SEN / CTL

P27797

Calreticulin

CALR

-0.75

1.08

1.94e-8

4.67e-8

negative regulation of transcription from RNA poly…

complement component C1q binding,glycoprotein bind…

acrosomal vesicle,extracellular region,proteinaceo…

87

52

95

EQFLDGDGWTSR.2|FYALSASFEPFSNK.2|FYALSASFEPFSNK.3|G…

SEN / CTL

Q14767

Latent-transforming growth factor beta-binding protein 2

LTBP2

-0.75

0.17

0.0145

0.00722

protein targeting,transforming growth factor beta …

calcium ion binding,protein binding,heparin bindin…

proteinaceous extracellular matrix,extracellular s…

3

8

8

SSEVYAQLC[CAM]NVAR.2|RSTPLGQQQPAPR.3|SSAAGEGTLAR.2…

SEN / CTL

P56159

GDNF family receptor alpha-1

GFRA1

-0.75

0.29

0.0621

0.0241

MAPK cascade,cell surface receptor signaling pathw…

Ras guanyl-nucleotide exchange factor activity,rec…

intracellular,plasma membrane,extrinsic component …

3

5

5

LADFFTNC[CAM]QPESR.2|EGLGASSHITTK.3|NKPLGPAGSENEIP…

SEN / CTL

P07951

Tropomyosin beta chain

TPM2

-0.75

0.76

0.0846

0.0314

muscle contraction,muscle filament sliding,regulat…

actin binding,structural constituent of muscle

cytosol,muscle thin filament tropomyosin

12

24

37

AMKDEEKMELQEMQLK.4|AMKDEEKMELQEMQLK.3|KLVILEGELERS…

SEN / CTL

Q9C005

Protein dpy-30 homolog

DPY30

-0.75

2.58

0.0928

0.0336

chromatin silencing at telomere,transcription, DNA…

protein binding,histone-lysine N-methyltransferase…

chromosome, telomeric region,nucleus,nucleoplasm,G…

6

4

6

ERPPNPIEFLASYLLK.3|ERPPNPIEFLASYLLK.4|ERPPNPIEFLAS…

SEN / CTL

P16035

Metalloproteinase inhibitor 2

TIMP2

-0.76

0.26

6.22e-12

2.75e-11

central nervous system development,aging,negative …

protease binding,integrin binding,metalloendopepti…

extracellular region,proteinaceous extracellular m…

21

8

11

AVSEKEVDSGNDIYGNPIKR.4|AVSEKEVDSGNDIYGNPIKR.3|GAAP…

SEN / CTL

P62906

60S ribosomal protein L10a

RPL10A

-0.77

0.32

1.64e-10

5.93e-10

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion…

21

19

35

KYDAFLASESLIK.3|KYDAFLASESLIK.2|FSVC[CAM]VLGDQQHC[…

SEN / CTL

Q01469

Fatty acid-binding protein, epidermal

FABP5

-0.77

0.91

0.00134

0.000975

glucose metabolic process,lipid metabolic process,…

transporter activity,fatty acid binding,protein bi…

nucleoplasm,cytoplasm,cytosol,extracellular exosom…

24

17

34

ELGVGIALR.2|TTQFSC[CAM]TLGEKFEETTADGRK.4|TTQFSC[CA…

SEN / CTL

P04156

Major prion protein

PRNP

-0.77

0.3

0.039

0.0162

negative regulation of protein phosphorylation,cel…

copper ion binding,lamin binding,microtubule bindi…

nucleus,cytoplasm,endoplasmic reticulum,Golgi appa…

3

4

5

VVEQMC[CAM]ITQYER.2|VVEQM[Oxi]C[CAM]ITQYER.2|PIIHF…

SEN / CTL

Q92688

Acidic leucine-rich nuclear phosphoprotein 32 family member B

ANP32B

-0.78

0.37

2.89e-7

5.5e-7

vasculature development,nucleosome assembly,activa…

protein binding,histone binding,RNA polymerase bin…

nucleus,cytoplasm,extracellular exosome,nucleolus

15

10

17

SLDLFNC[CAM]EVTNLNDYRESVFK.3|IFGGLDM[Oxi]LAEKLPNLT…

SEN / CTL

P20700

Lamin-B1

LMNB1

-0.78

0.78

0.00226

0.00154

structural molecule activity,phospholipase binding

nuclear envelope,nuclear inner membrane,lamin fila…

30

59

97

LQIELGK.2|SLEGDLEDLKDQIAQLEASLAAAK.4|SLEGDLEDLKDQI…

SEN / CTL

P33908

Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA

MAN1A1

-0.78

0.85

0.058

0.0228

N-glycan processing,Golgi apparatus mannose trimmi…

mannosyl-oligosaccharide 1,2-alpha-mannosidase act…

Golgi membrane,cytoplasm,endoplasmic reticulum,end…

6

12

15

FDGGVEAIATR.2|WAWEAVEALENHC[CAM]R.3|HEFEEAK.2|MYFD…

SEN / CTL

Q93088

Betaine–homocysteine S-methyltransferase 1

BHMT

-0.79

0.57

0.0154

0.00758

sulfur amino acid metabolic process,protein methyl…

zinc ion binding,S-adenosylmethionine-homocysteine…

cytoplasm,cytosol,extracellular exosome

6

35

57

ISGQEVNEAAC[CAM]DIAR.2|ISGQEVNEAAC[CAM]DIAR.3|AGPW…

SEN / CTL

P13693

Translationally-controlled tumor protein

TPT1

-0.8

0.56

0.00000815

0.0000107

calcium ion transport,cellular calcium ion homeost…

calcium ion binding,protein binding,microtubule bi…

extracellular space,nucleus,cytoplasm,multivesicul…

18

14

26

VKPFMTGAAEQIKHILANFK.4|IREIADGLC[CAM]LEVEGK.3|IREI…

SEN / CTL

P05155

Plasma protease C1 inhibitor

SERPING1

-0.81

0.69

5.39e-8

1.17e-7

negative regulation of complement activation, lect…

serine-type endopeptidase inhibitor activity,prote…

extracellular region,extracellular space,platelet …

51

19

34

FQPTLLTLPR.2|LVLLNAIYLSAK.2|LLDSLPSDTR.2|TNLESILSY…

SEN / CTL

Q16610

Extracellular matrix protein 1

ECM1

-0.82

0.51

1.73e-8

4.29e-8

ossification,angiogenesis,positive regulation of e…

protease binding,signal transducer activity,interl…

extracellular region,proteinaceous extracellular m…

24

22

28

ELLALIQLER.2|LVWEEAMSR.2|FC[CAM]EAEFSVK.2|RAPYPNYD…

SEN / CTL

P39687

Acidic leucine-rich nuclear phosphoprotein 32 family member A

ANP32A

-0.82

0.92

0.0000266

0.0000304

transcription, DNA-templated,regulation of transcr…

histone binding,poly(A) RNA binding

nucleus,nucleoplasm,cytoplasm,endoplasmic reticulu…

27

19

33

SNEGKLEGLTDEFEELEFLSTINVGLTSIANLPK.4|VSGGLEVLAEK.2…

SEN / CTL

Q92859

Neogenin

NEO1

-0.82

0.29

0.0368

0.0154

cell adhesion,axon guidance,positive regulation of…

receptor activity,protein binding,co-receptor bind…

nucleoplasm,Golgi apparatus,plasma membrane,integr…

3

6

6

QLLPDGSLFISNVVHSK.3|SHLYHPGSPWPIGTSMSLSDR.4|EHNLQV…

SEN / CTL

Q15904

V-type proton ATPase subunit S1

ATP6AP1

-0.83

0.16

0.0000492

0.0000526

insulin receptor signaling pathway,ATP hydrolysis …

transporter activity,ATP binding,Rab GTPase bindin…

endosome membrane,integral component of membrane,p…

6

9

11

LGASPLHVDLATLR.3|LGASPLHVDLATLR.2|EVLTGNDEVIGQVLST…

SEN / CTL

P12004

Proliferating cell nuclear antigen

PCNA

-0.83

0.72

0.00129

0.000946

G1/S transition of mitotic cell cycle,regulation o…

purine-specific mismatch base pair DNA N-glycosyla…

nuclear chromosome, telomeric region,nucleus,nucle…

18

21

41

DLSHIGDAVVISC[CAM]AK.3|DLSHIGDAVVISC[CAM]AK.2|YLNF…

SEN / CTL

Q07955

Serine/arginine-rich splicing factor 1

SRSF1

-0.84

0.48

0.0000431

0.0000463

alternative mRNA splicing, via spliceosome,mRNA 5’…

nucleotide binding,RNA binding,mRNA binding,protei…

nucleus,nucleoplasm,cytoplasm,nuclear speck,extrac…

15

24

32

EAGDVC[CAM]YADVYR.2|EAGDVC[CAM]YADVYRDGTGVVEFVR.3|…

SEN / CTL

P07225

Vitamin K-dependent protein S

PROS1

-0.84

0.48

0.0021

0.00144

platelet degranulation,signal peptide processing,E…

endopeptidase inhibitor activity,calcium ion bindi…

Golgi membrane,extracellular region,extracellular …

9

20

26

SFQTGLFTAAR.2|VYFAGFPR.2|NNLELSTPLKIETISHEDLQR.4|N…

SEN / CTL

P24844

Myosin regulatory light polypeptide 9

MYL9

-0.84

0.42

0.00399

0.00247

muscle contraction,regulation of muscle contractio…

calcium ion binding,structural constituent of musc…

stress fiber,cytosol,muscle myosin complex,Z disc

6

6

10

GNFNYVEFTR.2|NAFAC[CAM]FDEEASGFIHEDHLR.4|NAFAC[CAM…

SEN / CTL

Q86SF2

N-acetylgalactosaminyltransferase 7

GALNT7

-0.85

0.67

0.00073

0.000579

carbohydrate metabolic process,protein O-linked gl…

polypeptide N-acetylgalactosaminyltransferase acti…

Golgi membrane,membrane,integral component of memb…

15

23

30

GFETAYC[CAM]IDSMGK.2|C[CAM]LDRSEVLHQVFISNC[CAM]DSS…

SEN / CTL

P35555

Fibrillin-1

FBN1

-0.86

0.68

5.7e-19

5.5e-18

skeletal system development,metanephros developmen…

integrin binding,hormone activity,extracellular ma…

microfibril,extracellular region,proteinaceous ext…

66

32

32

ILELLPALTTLTNHNR.3|TLPGGNQC[CAM]IVPIC[CAM]R.2|TC[C…

SEN / CTL

P16949

Stathmin

STMN1

-0.87

0.4

9.85e-10

2.98e-9

mitotic cytokinesis,microtubule depolymerization,m…

signal transducer activity,tubulin binding

intracellular,cytoplasm,cytosol,microtubule,membra…

21

18

24

ASGQAFELILSPR.2|ASGQAFELILSPR.3|SKESVPEFPLSPPK.3|S…

SEN / CTL

Q8TEA8

D-tyrosyl-tRNA(Tyr) deacylase 1

DTD1

-0.87

0.3

0.0317

0.0138

DNA replication,tRNA metabolic process,regulation …

aminoacyl-tRNA editing activity,DNA binding,metal …

nucleus,cytoplasm

3

6

8

ASVTVGGEQISAIGR.2|SASSGAEGDVSSEREP.3|SASSGAEGDVSSE…

SEN / CTL

Q9H910

Hematological and neurological expressed 1-like protein

HN1L

-0.88

0.42

5.63e-9

1.54e-8

nucleus,cytoplasm,plasma membrane

21

11

17

TSDIFGSPVTATSR.2|GSGIFDESTPVQTR.2|AMKPPGGESSNLFGSP…

SEN / CTL

P23142

Fibulin-1

FBLN1

-0.88

0.44

0.000581

0.000474

negative regulation of protein phosphorylation,neg…

fibronectin binding,extracellular matrix structura…

extracellular region,proteinaceous extracellular m…

9

25

36

RGYQLSDVDGVTC[CAM]EDIDEC[CAM]ALPTGGHIC[CAM]SYR.4|Y…

SEN / CTL

P84090

Enhancer of rudimentary homolog

ERH

-0.88

0.54

0.00627

0.00365

nucleobase-containing compound metabolic process,p…

protein binding,methyl-CpG binding,poly(A) RNA bin…

midbody,methylosome

6

5

10

TYADYESVNEC[CAM]MEGVC[CAM]K.2|TYADYESVNEC[CAM]MEGV…

SEN / CTL

P17858

ATP-dependent 6-phosphofructokinase, liver type

PFKL

-0.88

1.2

0.0179

0.00859

fructose 6-phosphate metabolic process,glycolytic …

6-phosphofructokinase activity,protein binding,ATP…

cytosol,6-phosphofructokinase complex,membrane,ext…

30

42

74

GQLESIVENIR.2|TFVLEVMGR.2|TFVLEVM[Oxi]GR.2|AIGVLTS…

SEN / CTL

Q9UBR2

Cathepsin Z

CTSZ

-0.88

1.57

0.0207

0.00966

angiotensin maturation,proteolysis,ER to Golgi ves…

cysteine-type endopeptidase activity,protein bindi…

Golgi membrane,extracellular space,lysosome,endopl…

15

16

25

NVDGVNYASITR.2|NVDGVNYASITR.3|NQHIPQYC[CAM]GSC[CAM…

SEN / CTL

P29279

Connective tissue growth factor

CTGF

-0.89

0.54

0.00528

0.00314

cartilage condensation,ossification,angiogenesis,r…

fibronectin binding,integrin binding,protein bindi…

extracellular region,proteinaceous extracellular m…

9

8

8

DGAPC[CAM]IFGGTVYR.2|C[CAM]PAGVSLVLDGC[CAM]GC[CAM]…

SEN / CTL

Q13308

Inactive tyrosine-protein kinase 7

PTK7

-0.9

0.38

3.97e-10

1.29e-9

establishment of planar polarity,ventricular septu…

protein kinase activity,protein binding,ATP bindin…

integral component of plasma membrane,cell-cell ju…

24

30

35

VVLAPQDVVVAR.2|ADGSSLPEWVTDNAGTLHFAR.3|INSVEVYDGTW…

SEN / CTL

Q96PU4

E3 ubiquitin-protein ligase UHRF2

UHRF2

-0.9

0.22

0.0202

0.00952

cell cycle,cell proliferation,maintenance of DNA m…

DNA binding,ubiquitin-protein transferase activity…

nucleus,nucleoplasm,nuclear heterochromatin

3

14

15

IISVDEIFK.2|RPISDDDC[CAM]PSASK.3|IERPGAHPLSFADGK.3…

SEN / CTL

Q16270

Insulin-like growth factor-binding protein 7

IGFBP7

-0.91

0.98

4.86e-10

1.56e-9

regulation of cell growth,cell adhesion,embryo imp…

protein binding,insulin-like growth factor binding

extracellular region,extracellular space,extracell…

36

12

15

TELLPGDRDNLAIQTR.3|TELLPGDRDNLAIQTR.2|SRYPVC[CAM]G…

SEN / CTL

P78324


Q5TFQ8

Tyrosine-protein phosphatase non-receptor type substrate 1;Signal-regulatory protein beta-1 isoform 3

SIRPA


SIRPB1

-0.91

0.29

0.0314

0.0137

cell adhesion,leukocyte migration;

SH3 domain binding;

plasma membrane,membrane,integral component of mem…

3

1

2

ATPQHTVSFTC[CAM]ESHGFSPR.4|ATPQHTVSFTC[CAM]ESHGFSP…

SEN / CTL

O75882

Attractin

ATRN

-0.92

0.09

0.00292

0.0019

inflammatory response,response to oxidative stress…

receptor activity,carbohydrate binding

extracellular space,cytoplasm,plasma membrane,inte…

3

29

41

LTLTPWVGLR.2|EQYAVVGHSAHIVTLK.4|EQYAVVGHSAHIVTLK.3…

SEN / CTL

O00241

Signal-regulatory protein beta-1

SIRPB1

-0.92

0.27

0.0286

0.0127

signal transduction,cell surface receptor signalin…

plasma membrane,integral component of plasma membr…

3

2

2

ATPEHTVSFTC[CAM]ESHGFSPR.4|SVSVAAGESATLR.2

SEN / CTL

O00468

Agrin

AGRN

-0.93

0.81

1.72e-26

3.1e-25

retinoid metabolic process,glycosaminoglycan biosy…

dystroglycan binding,structural constituent of cyt…

extracellular region,basal lamina,cytoplasm,Golgi …

159

54

64

SFLAFPTLR.2|KFDGPC[CAM]DPC[CAM]QGALPDPSR.3|KFDGPC[…

SEN / CTL

P61916

Epididymal secretory protein E1

NPC2

-0.94

0.48

7.02e-8

1.45e-7

cholesterol metabolic process,response to virus,ph…

protein binding,cholesterol binding,enzyme binding

lysosome,endoplasmic reticulum,extracellular exoso…

21

12

19

AVVHGILMGVPVPFPIPEPDGC[CAM]K.3|AVVHGILMGVPVPFPIPEP…

SEN / CTL

Q8WUT4

Leucine-rich repeat neuronal protein 4

LRRN4

-0.94

0.25

0.0209

0.00975

long-term memory,visual learning

integral component of plasma membrane,extracellula…

3

2

2

ALSTSELGHLEQLQVLTLR.3|HLQTPC[CAM]AELQR.2

SEN / CTL

P05156

Complement factor I

CFI

-0.96

0.79

0.00000132

0.00000216

proteolysis,receptor-mediated endocytosis,compleme…

serine-type endopeptidase activity,scavenger recep…

extracellular region,extracellular space,membrane,…

18

26

36

VFSLQWGEVK.2|GLETSLAEC[CAM]TFTK.2|IVIEYVDR.2|AC[CA…

SEN / CTL

P00751

Complement factor B

CFB

-0.96

0.49

0.0121

0.00624

proteolysis,complement activation,complement activ…

complement binding,serine-type endopeptidase activ…

extracellular region,extracellular space,plasma me…

6

51

78

DFHINLFQVLPWLK.3|DFHINLFQVLPWLK.4|DFHINLFQVLPWLK.2…

SEN / CTL

Q13185

Chromobox protein homolog 3

CBX3

-0.97

0.32

8.82e-9

2.31e-8

chromatin remodeling,transcription, DNA-templated,…

protein binding,enzyme binding,protein domain spec…

chromosome, centromeric region,condensed chromosom…

15

13

22

C[CAM]PQIVIAFYEER.2|C[CAM]PQIVIAFYEER.3|WKDSDEADLV…

SEN / CTL

Q13867

Bleomycin hydrolase

BLMH

-0.97

0.18

0.00945

0.00509

protein polyubiquitination,proteolysis,response to…

aminopeptidase activity,carboxypeptidase activity,…

nucleus,cytoplasm,cytosol,extracellular exosome

3

32

47

IGPITPLEFYR.2|IGPITPLEFYR.3|AQHVFQHAVPQEGKPITNQK.5…

SEN / CTL

Q6EMK4

Vasorin

VASN

-0.98

0.31

9.34e-8

1.88e-7

negative regulation of epithelial to mesenchymal t…

transforming growth factor beta binding,cadherin b…

extracellular space,mitochondrion,lysosomal membra…

12

8

8

SLTLGIEPVSPTSLR.2|NPFNC[CAM]VC[CAM]PLSWFGPWVR.3|LL…

SEN / CTL

O00193

Small acidic protein

SMAP

-0.98

0.57

0.00569

0.00336

biological_process

molecular_function

cellular_component

6

6

12

SASPDDDLGSSNWEAADLGNEER.3|TGEEDKKINEELESQYQQSMDSK….

SEN / CTL

O14672

Disintegrin and metalloproteinase domain-containing protein 10

ADAM10

-1

0.88

0.000983

0.000752

in utero embryonic development,protein phosphoryla…

endopeptidase activity,metalloendopeptidase activi…

nucleus,cytoplasm,Golgi apparatus,Golgi-associated…

21

21

28

EAVIAQISSHVK.3|EAVIAQISSHVK.2|AIDTIYQTTDFSGIR.2|AI…

SEN / CTL

P0C0S8


P20671


Q96KK5


Q99878


Q9BTM1

Histone H2A type 1;Histone H2A type 1-D;Histone H2A type 1-H;Histone H2A type 1-J;Histone H2A.J

HIST1H2AG


HIST1H2AD


HIST1H2AH


HIST1H2AJ


H2AFJ

-1

1.08

0.0364

0.0153

chromatin silencing,biological_process;chromatin s…

DNA binding,protein binding,enzyme binding,protein…

nucleosome,nuclear chromatin,nucleus,extracellular…

6

1

3

HLQLAIRNDEELNKLLGK.4|HLQLAIRNDEELNKLLGK.3|HLQLAIRN…

SEN / CTL

P07996

Thrombospondin-1

THBS1

-1.01

0.97

2.94e-21

3.78e-20

activation of MAPK activity,response to hypoxia,ne…

phosphatidylserine binding,glycoprotein binding,fi…

extracellular region,fibrinogen complex,extracellu…

129

63

89

FVFGTTPEDILR.2|TIVTTLQDSIR.2|GFLLLASLR.2|SITLFVQED…

SEN / CTL

Q10471

Polypeptide N-acetylgalactosaminyltransferase 2

GALNT2

-1.02

0.81

1.35e-7

2.65e-7

immunoglobulin biosynthetic process,protein O-link…

polypeptide N-acetylgalactosaminyltransferase acti…

Golgi membrane,endoplasmic reticulum membrane,Golg…

27

28

40

VWQC[CAM]GGSLEIIPC[CAM]SR.2|VLTFLDSHC[CAM]EC[CAM]N…

SEN / CTL

Q9H773

dCTP pyrophosphatase 1

DCTPP1

-1.03

0.6

0.0875

0.0322

nucleoside triphosphate catabolic process,protein …

magnesium ion binding,pyrimidine deoxyribonucleoti…

cytosol

3

12

18

C[CAM]RVDLPLAVLSK.3|C[CAM]RVDLPLAVLSK.2|RLHAEFAAER…

SEN / CTL

Q02388

Collagen alpha-1(VII) chain

COL7A1

-1.06

0.78

4.01e-12

1.84e-11

ER to Golgi vesicle-mediated transport,cell adhesi…

serine-type endopeptidase inhibitor activity,prote…

Golgi membrane,extracellular region,collagen type …

33

34

44

QHVPGVMVLLVDEPLRGDIFSPIR.4|SFLEGLVLPFSGAASAQGVR.3|…

SEN / CTL

P29323

Ephrin type-B receptor 2

EPHB2

-1.06

0.73

0.00000665

0.00000898

angiogenesis,urogenital system development,nervous…

protein tyrosine kinase activity,transmembrane-eph…

extracellular region,cytosol,plasma membrane,integ…

21

21

25

AGAIYVFQVR.2|VDTIAADESFSQVDLGGR.2|WTAPEAIQYR.2|AMA…

SEN / CTL

P12109

Collagen alpha-1(VI) chain

COL6A1

-1.08

0.87

6.2e-10

1.97e-9

osteoblast differentiation,cell adhesion,extracell…

platelet-derived growth factor binding

extracellular region,collagen type VI trimer,lysos…

48

49

69

VFSVAITPDHLEPR.3|VFSVAITPDHLEPR.2|LLLFSDGNSQGATPAA…

SEN / CTL

P09871

Complement C1s subcomponent

C1S

-1.08

0.97

0.0000247

0.0000284

proteolysis,complement activation,complement activ…

serine-type endopeptidase activity,calcium ion bin…

extracellular region,extracellular exosome,blood m…

15

26

38

TNFDNDIALVR.2|MLTPEHVFIHPGWK.4|M[Oxi]LTPEHVFIHPGWK…

SEN / CTL

P19320

Vascular cell adhesion protein 1

VCAM1

-1.09

0.79

0.00000591

0.0000081

response to hypoxia,acute inflammatory response,ch…

integrin binding,primary amine oxidase activity,ce…

podosome,extracellular space,early endosome,endopl…

18

11

11

QSTQTLYVNVAPR.2|MEDSGVYLC[CAM]EGINQAGR.2|SLEVTFTPV…

SEN / CTL

P35442

Thrombospondin-2

THBS2

-1.11

0.59

0.0000131

0.0000162

cell adhesion,negative regulation of angiogenesis,…

calcium ion binding,heparin binding

extracellular region,basement membrane,platelet al…

15

8

9

GTLLALEGPGLSQR.2|SC[CAM]DVTSNTC[CAM]LGPSIQTR.2|GLL…

SEN / CTL

P14324

Farnesyl pyrophosphate synthase

FDPS

-1.11

0.78

0.0000651

0.0000684

cholesterol biosynthetic process,viral process,ger…

dimethylallyltranstransferase activity,geranyltran…

nucleoplasm,cytoplasm,cytosol

15

17

27

GLTVVVAFR.2|LKEVLEYNAIGGK.3|LKEVLEYNAIGGK.2|C[CAM]…

SEN / CTL

P55285

Cadherin-6

CDH6

-1.12

0.4

0.0000118

0.0000148

cell adhesion,homophilic cell adhesion via plasma …

calcium ion binding

plasma membrane,integral component of membrane,ext…

9

12

12

IVVEDVDEPPVFSK.2|LAYILQIR.2|FLYLGPFKDSATVR.3|LHSDQ…

SEN / CTL

P15151

Poliovirus receptor

PVR

-1.12

0.39

0.0000405

0.0000439

positive regulation of natural killer cell mediate…

virus receptor activity,receptor activity,receptor…

extracellular space,cytoplasm,plasma membrane,inte…

9

5

6

VQLTGEPVPMAR.2|HGESGSMAVFHQTQGPSYSESK.4|HGESGSMAVF…

SEN / CTL

Q01105

Protein SET

SET

-1.12

1.12

0.0000737

0.0000757

DNA replication,nucleosome assembly,nucleosome dis…

DNA binding,protein phosphatase inhibitor activity…

nucleus,nucleoplasm,cytoplasm,endoplasmic reticulu…

24

18

30

VEVTEFEDIK.2|VEVTEFEDIKSGYR.3|IPNFWVTTFVNHPQVSALLG…

SEN / CTL

Q08380

Galectin-3-binding protein

LGALS3BP

-1.14

0.72

1.31e-18

1.18e-17

platelet degranulation,receptor-mediated endocytos…

scavenger receptor activity

extracellular region,proteinaceous extracellular m…

72

23

30

SDLAVPSELALLK.2|ELSEALGQIFDSQR.2|ELSEALGQIFDSQR.3|…

SEN / CTL

P08294

Extracellular superoxide dismutase [Cu-Zn]

SOD3

-1.14

1.47

0.0000979

0.0000979

response to reactive oxygen species,response to hy…

superoxide dismutase activity,copper ion binding,p…

extracellular region,extracellular space,nucleus,c…

33

10

14

VTGVVLFR.2|AVVVHAGEDDLGRGGNQASVENGNAGR.4|DDDGALHAA…

SEN / CTL

O95881

Thioredoxin domain-containing protein 12

TXNDC12

-1.15

0.65

0.00379

0.0024

cell differentiation,cell redox homeostasis,oxidat…

peptide disulfide oxidoreductase activity,protein-…

endoplasmic reticulum lumen

9

10

16

ILFLDPSGK.2|EAAASGLPLMVIIHK.3|EAAASGLPLM[Oxi]VIIHK…

SEN / CTL

O94973

AP-2 complex subunit alpha-2

AP2A2

-1.15

1.06

0.135

0.0449

intracellular protein transport,microtubule-based …

molecular_function,lipid binding,protein transport…

cytosol,plasma membrane,cytoplasmic, membrane-boun…

18

41

64

GLAVFISDIR.2|TSVSLAVSR.2|NAVLFEAISLIIHHDSEPNLLVR.4…

SEN / CTL

Q9GZX9

Twisted gastrulation protein homolog 1

TWSG1

-1.16

0.4

0.00175

0.00123

ossification,mesoderm formation,salivary gland mor…

extracellular space,extracellular exosome

6

4

6

STVEELHEPIPSLFR.3|STVEELHEPIPSLFR.2|WFHNAC[CAM]C[C…

SEN / CTL

P10412


P16402


P16403


P22492


Q02539

Histone H1.4;Histone H1.3;Histone H1.2;Histone H1t;Histone H1.1

HIST1H1E


HIST1H1D


HIST1H1C


HIST1H1T


HIST1H1A

-1.16

1.07

0.0639

0.0246

negative regulation of transcription from RNA poly…

protein binding,chromatin DNA binding,poly(A) RNA …

nucleosome,nucleus,nuclear heterochromatin,extrace…

6

2

3

ALAAAGYDVEK.2|ALAAAGYDVEKNNSR.3|ALAAAGYDVEKNNSR.2

SEN / CTL

P62979

Ubiquitin-40S ribosomal protein S27a

RPS27A

-1.18

0.86

4.94e-7

8.78e-7

G2/M transition of mitotic cell cycle,negative reg…

structural constituent of ribosome,protein binding…

extracellular space,nucleus,nucleoplasm,nucleolus,…

27

9

19

TITLEVEPSDTIENVK.2|TITLEVEPSDTIENVK.3|ESTLHLVLR.2|…

SEN / CTL

P12259

Coagulation factor V

F5

-1.2

0.28

0.0156

0.00765

platelet degranulation,proteolysis,ER to Golgi ves…

serine-type endopeptidase activity,copper ion bind…

Golgi membrane,extracellular region,extracellular …

3

40

46

AEVDDVIQVR.2|FC[CAM]ENPDEVKR.3|SQHLDNFSNQIGK.3|SQH…

SEN / CTL

Q9UEE9

Craniofacial development protein 1

CFDP1

-1.21

0.54

0.0806

0.03

cell adhesion,multicellular organism development,b…

molecular_function

condensed chromosome kinetochore,cellular_componen…

3

9

11

VFDFAGEEVR.2|SSGMSSLLGK.2|EKPQANVPSALPSLPAGSGLKR.4…

SEN / CTL

Q14118

Dystroglycan

DAG1

-1.22

0.22

0.0000296

0.0000332

morphogenesis of an epithelial sheet,protein O-lin…

virus receptor activity,dystroglycan binding,actin…

extracellular region,basement membrane,extracellul…

6

17

21

VTIPTDLIASSGDIIK.2|LGC[CAM]SLNQNSVPDIHGVEAPAR.3|GG…

SEN / CTL

P36955

Pigment epithelium-derived factor

SERPINF1

-1.25

0.94

0.000385

0.000331

kidney development,multicellular organism developm…

serine-type endopeptidase inhibitor activity,prote…

extracellular region,basement membrane,extracellul…

12

20

26

SSTSPTTNVLLSPLSVATALSALSLGAEQR.3|DTDTGALLFIGK.2|LA…

SEN / CTL

O75937

DnaJ homolog subfamily C member 8

DNAJC8

-1.25

0.97

0.00385

0.00242

mRNA splicing, via spliceosome

nucleoplasm,cytoplasm,intercellular bridge

9

21

31

LFAELEIK.2|EGKPTIVEEDDPELFK.3|EGKPTIVEEDDPELFK.2|L…

SEN / CTL

Q08629

Testican-1

SPOCK1

-1.28

0.07

0.000902

0.000701

regulation of cell growth,neuron migration,cell ad…

serine-type endopeptidase inhibitor activity,cyste…

proteinaceous extracellular matrix,extracellular s…

3

2

2

SLLGAFIPR.2|ATQC[CAM]HGSTGQC[CAM]WC[CAM]VDK.3

SEN / CTL

Q8NBJ4

Golgi membrane protein 1

GOLM1

-1.3

0.54

0.00661

0.00383

nucleus organization,regulation of lipid metabolic…

protein binding

extracellular space,Golgi apparatus,integral compo…

6

21

27

DTINLLDQR.2|KFSYDLSQC[CAM]INQMK.3|KNEFQGELEK.3|KNE…

SEN / CTL

P14543

Nidogen-1

NID1

-1.33

0.91

2.03e-8

4.84e-8

cell-matrix adhesion,positive regulation of cell-s…

calcium ion binding,collagen binding,laminin bindi…

extracellular region,basement membrane,basal lamin…

27

39

51

VLFETDLVNPR.2|VYYREDLSPSITQR.3|TQFTC[CAM]EC[CAM]SI…

SEN / CTL

Q15262

Receptor-type tyrosine-protein phosphatase kappa

PTPRK

-1.35

0.24

3.35e-10

1.12e-9

protein dephosphorylation,cell adhesion,signal tra…

protein tyrosine phosphatase activity,transmembran…

photoreceptor outer segment,integral component of …

12

12

13

VLLTRPGEGGTGLPGPPLITR.3|GLNPGTLNILVR.2|GSGVSNFAQLI…

SEN / CTL

P08572

Collagen alpha-2(IV) chain

COL4A2

-1.36

0.94

4.26e-12

1.92e-11

angiogenesis,transcription, DNA-templated,negative…

extracellular matrix structural constituent

extracellular region,collagen type IV trimer,endop…

39

15

19

SVSIGYLLVK.2|FSTMPFLYC[CAM]NPGDVC[CAM]YYASR.3|C[CA…

SEN / CTL

Q01995

Transgelin

TAGLN

-1.36

0.93

7.03e-9

1.88e-8

muscle organ development,epithelial cell different…

actin binding

cytoplasm

30

24

41

LGFQVWLK.2|EFTESQLQEGKHVIGLQMGSNR.4|QMEQVAQFLK.2|Q…

SEN / CTL

P51884

Lumican

LUM

-1.38

0.79

3.39e-8

7.56e-8

visual perception,response to organic cyclic compo…

extracellular matrix structural constituent,collag…

extracellular region,proteinaceous extracellular m…

18

21

29

FNALQYLR.2|SLEYLDLSFNQIAR.3|SLEYLDLSFNQIAR.2|LPSGL…

SEN / CTL

P13611

Versican core protein

VCAN

-1.39

0.98

9.82e-17

7.58e-16

skeletal system development,osteoblast differentia…

extracellular matrix structural constituent,calciu…

extracellular region,proteinaceous extracellular m…

60

17

23

LATVGELQAAWR.2|YTLNFEAAQK.2|VSVPTHPEAVGDASLTVVK.3|…

SEN / CTL

P10321

HLA class I histocompatibility antigen, Cw-7 alpha chain

HLA-C

-1.39

0.37

1.16e-11

4.73e-11

18

9

11

SWTAADTAAQITQR.2|SWTAADTAAQITQR.3|FISVGYVDDTQFVR.2…

SEN / CTL

P45973

Chromobox protein homolog 5

CBX5

-1.39

0.25

0.00902

0.00492

blood coagulation,viral process,negative regulatio…

chromatin binding,protein binding,protein binding,…

histone deacetylase complex,kinetochore,nuclear ch…

3

14

21

WKDTDEADLVLAK.3|WKDTDEADLVLAK.2|GQVEYLLK.2|WKGFSEE…

SEN / CTL

P49321

Nuclear autoantigenic sperm protein

NASP

-1.42

0.56

0.00000332

0.00000487

blastocyst development,DNA replication,DNA replica…

Hsp90 protein binding

nuclear chromatin,nucleus,nucleoplasm,cytoplasm,pr…

12

59

92

KPTDGASSSNC[CAM]VTDISHLVR.4|KPTDGASSSNC[CAM]VTDISH…

SEN / CTL

Q9Y4K0

Lysyl oxidase homolog 2

LOXL2

-1.47

1.43

5.99e-7

0.00000105

response to hypoxia,epithelial to mesenchymal tran…

chromatin binding,transcription corepressor activi…

basement membrane,extracellular space,nucleus,nucl…

42

16

19

VVC[CAM]GMFGFPGER.2|LGQGIGPIHLNEIQC[CAM]TGNEK.3|NG…

SEN / CTL

P02774

Vitamin D-binding protein

GC

-1.48

1.58

0.132

0.0444

vitamin D metabolic process,vitamin transport

actin binding,vitamin D binding,vitamin transporte…

extracellular region,extracellular space,cytosol,l…

15

46

77

HQPQEFPTYVEPTNDEIC[CAM]EAFRKDPK.5|HQPQEFPTYVEPTNDE…

SEN / CTL

P02452

Collagen alpha-1(I) chain

COL1A1

-1.53

0.58

2.94e-14

1.59e-13

skeletal system development,blood vessel developme…

extracellular matrix structural constituent,protei…

extracellular region,collagen type I trimer,extrac…

33

46

54

SLSQQIENIRSPEGSR.3|DRDLEVDTTLK.3|DRDLEVDTTLK.2|VLC…

SEN / CTL

P02462

Collagen alpha-1(IV) chain

COL4A1

-1.55

1.61

0.00144

0.00104

patterning of blood vessels,brain development,neur…

extracellular matrix structural constituent,extrac…

extracellular region,collagen type IV trimer,basem…

15

7

11

GTC[CAM]NYYANAYSFWLATIER.3|FSTMPFLFC[CAM]NINNVC[CA…

SEN / CTL

Q9UNN8

Endothelial protein C receptor

PROCR

-1.57

0.36

1.65e-10

5.93e-10

blood coagulation,negative regulation of coagulati…

receptor activity

extracellular region,centrosome,plasma membrane,in…

15

5

7

TLAFPLTIR.2|LHMLQISYFR.3|EFLEDTC[CAM]VQYVQK.2|TQSG…

SEN / CTL

P61457

Pterin-4-alpha-carbinolamine dehydratase

PCBD1

-1.58

0.32

0.0136

0.00681

transcription, DNA-templated,L-phenylalanine catab…

transcription coactivator activity,phenylalanine 4…

nucleoplasm,cytoplasm,cytosol,extracellular exosom…

3

10

15

LSAEERDQLLPNLR.3|AFGFMTR.2|LDHHPEWFNVYNK.4|LDHHPEW…

SEN / CTL

P02751

Fibronectin

FN1

-1.66

1.04

1.96e-140

5.29e-138

angiogenesis,regulation of protein phosphorylation…

protease binding,integrin binding,protein binding,…

extracellular region,fibrinogen complex,basal lami…

474

126

209

VTWAPPPSIDLTNFLVR.2|VTWAPPPSIDLTNFLVR.3|WLPSSSPVTG…

SEN / CTL

Q9BYT8

Neurolysin, mitochondrial

NLN

-1.77

1.2

0.029

0.0128

regulation of gluconeogenesis,proteolysis,peptide …

metalloendopeptidase activity,peptide binding,meta…

mitochondrial intermembrane space,plasma membrane

9

35

48

LVNTGLLTLR.2|LKPLGEAEREFILNLK.4|C[CAM]KEENTIILQQLL…

SEN / CTL

O00160

Unconventional myosin-If

MYO1F

-1.77

0.88

0.0653

0.025

biological_process

motor activity,actin binding,calmodulin binding,AT…

unconventional myosin complex

3

27

32

GFGDLAVLK.2|GRLHGQEGLFPGNYVEK.4|GRLHGQEGLFPGNYVEK….

SEN / CTL

Q12841

Follistatin-related protein 1

FSTL1

-1.81

0.86

3.28e-7

6.14e-7

BMP signaling pathway,response to starvation

calcium ion binding,protein binding,heparin bindin…

extracellular region,extracellular space,extracell…

15

12

12

IIQWLEAEIIPDGWFSK.3|LSFQEFLK.2|IC[CAM]ANVFC[CAM]GA…

SEN / CTL

P01033

Metalloproteinase inhibitor 1

TIMP1

-1.84

0.45

5.33e-16

3.79e-15

cell activation,platelet degranulation,aging,posit…

protease binding,cytokine activity,protein binding…

extracellular region,proteinaceous extracellular m…

27

7

11

LQDGLLHITTC[CAM]SFVAPWNSLSLAQR.3|TYTVGC[CAM]EEC[CA…

SEN / CTL

P22692

Insulin-like growth factor-binding protein 4

IGFBP4

-1.86

0.78

6.31e-8

1.33e-7

skeletal system development,regulation of cell gro…

receptor binding,insulin-like growth factor I bind…

extracellular region,extracellular space

15

3

5

EDARPVPQGSC[CAM]QSELHR.4|THEDLYIIPIPNC[CAM]DR.3|TH…

SEN / CTL

P61769

Beta-2-microglobulin

B2M

-1.9

1.53

0.000351

0.000305

retina homeostasis,positive regulation of T cell m…

glycoprotein binding,protein binding,identical pro…

Golgi membrane,extracellular region,extracellular …

15

7

9

SNFLNC[CAM]YVSGFHPSDIEVDLLK.3|SNFLNC[CAM]YVSGFHPSD…

SEN / CTL

P05121

Plasminogen activator inhibitor 1

SERPINE1

-1.92

1.85

0.000425

0.000359

chronological cell aging,angiogenesis,platelet deg…

protease binding,serine-type endopeptidase inhibit…

extracellular region,extracellular space,plasma me…

21

9

10

MAPEEIIMDRPFLFVVR.3|HNPTGTVLFMGQVMEP.2|QFQADFTSLSD…

SEN / CTL

P01023

Alpha-2-macroglobulin

A2M

-1.92

1.55

0.0937

0.0338

negative regulation of complement activation, lect…

protease binding,serine-type endopeptidase inhibit…

extracellular region,cytosol,platelet alpha granul…

18

89

144

ATVLNYLPK.2|QTVSWAVTPK.2|MVSGFIPLKPTVK.3|M[Oxi]VSG…

SEN / CTL

P41222

Prostaglandin-H2 D-isomerase

PTGDS

-1.94

0.06

0.000274

0.000244

prostaglandin biosynthetic process,transport,cyclo…

prostaglandin-D synthase activity,transporter acti…

extracellular region,extracellular space,endoplasm…

3

2

4

TMLLQPAGSLGSYSYR.2|TM[Oxi]LLQPAGSLGSYSYR.2|AQGFTED…

SEN / CTL

P02768

Serum albumin

ALB

-2.04

1.07

1.53e-42

8.26e-41

retina homeostasis,platelet degranulation,transpor…

DNA binding,fatty acid binding,copper ion binding,…

extracellular region,extracellular space,nucleus,e…

201

107

232

KVPQVSTPTLVEVSR.3|KVPQVSTPTLVEVSR.2|KVPQVSTPTLVEVS…

SEN / CTL

Q8IUX7

Adipocyte enhancer-binding protein 1

AEBP1

-2.05

2.39

0.0245

0.0112

negative regulation of transcription from RNA poly…

RNA polymerase II regulatory region sequence-speci…

extracellular space,nucleus,cytoplasm,extracellula…

15

9

11

YLSPDATVSTEVR.2|YTAGIHGNEVLGR.3|YTAGIHGNEVLGR.2|VV…

SEN / CTL

P14780

Matrix metalloproteinase-9

MMP9

-2.07

0.79

1.41e-14

7.93e-14

skeletal system development,ossification,positive …

endopeptidase activity,metalloendopeptidase activi…

extracellular region,proteinaceous extracellular m…

30

30

40

SLGPALLLLQK.2|AFALWSAVTPLTFTR.2|AFALWSAVTPLTFTR.3|…

SEN / CTL

P54710

Sodium/potassium-transporting ATPase subunit gamma

FXYD2

-2.07

1.16

0.0194

0.00914

regulation of cell growth,transport,establishment …

transporter activity,ion channel activity,sodium:p…

plasma membrane,sodium:potassium-exchanging ATPase…

6

2

3

GDVDPFYYDYETVR.2|TGLSMDGGGSPK.2|TGLSM[Oxi]DGGGSPK….

SEN / CTL

P09486

SPARC

SPARC

-2.15

0.6

5.19e-23

7.78e-22

ossification,negative regulation of endothelial ce…

calcium ion binding,protein binding,collagen bindi…

extracellular region,basement membrane,extracellul…

42

14

22

YIPPC[CAM]LDSELTEFPLR.3|YIPPC[CAM]LDSELTEFPLR.2|FF…

SEN / CTL

P02787

Serotransferrin

TF

-2.26

1.19

1.14e-53

1.03e-51

retina homeostasis,platelet degranulation,cellular…

protein binding,ferrous iron binding,ferric iron b…

extracellular region,extracellular space,early end…

240

86

160

SASDLTWDNLK.2|SVIPSDGPSVAC[CAM]VK.2|LKC[CAM]DEWSVN…

SEN / CTL

P02788

Lactotransferrin

LTF

-2.5

1.1

0.00237

0.00159

ossification,regulation of cytokine production,ret…

DNA binding,serine-type endopeptidase activity,iro…

extracellular region,extracellular space,nucleus,c…

9

76

117

C[CAM]GLVPVLAENYK.2|YYGYTGAFR.2|C[CAM]LAENAGDVAFVK…

SEN / CTL

P30530

Tyrosine-protein kinase receptor UFO

AXL

-2.52

0.43

0.0135

0.00679

neuron migration,natural killer cell differentiati…

virus receptor activity,phosphatidylserine binding…

extracellular space,intracellular,plasma membrane,…

3

9

10

APLQGTLLGYR.2|HGDLHSFLLYSR.3|HGDLHSFLLYSR.2|YGEVFE…

SEN / CTL

Q99969

Retinoic acid receptor responder protein 2

RARRES2

-2.67

0.44

7.63e-8

1.56e-7

retinoid metabolic process,in utero embryonic deve…

receptor binding,protein binding

extracellular region,extracellular matrix,platelet…

9

4

5

GLQVALEEFHK.3|LVHC[CAM]PIETQVLR.3|LVHC[CAM]PIETQVL…

SEN / CTL

P20742

Pregnancy zone protein

PZP

-2.69

0.99

0.075

0.0281

female pregnancy,negative regulation of endopeptid…

endopeptidase inhibitor activity,serine-type endop…

extracellular region,extracellular exosome,blood m…

3

23

26

DLFHC[CAM]VSFTLPR.3|DLFHC[CAM]VSFTLPR.2|SGTHTLPVES…

SEN / CTL

P01009

Alpha-1-antitrypsin

SERPINA1

-2.93

1.4

1.82e-30

4.9e-29

platelet degranulation,ER to Golgi vesicle-mediate…

glycoprotein binding,protease binding,serine-type …

Golgi membrane,extracellular region,proteinaceous …

105

44

85

LSITGTYDLK.2|ITPNLAEFAFSLYR.2|ITPNLAEFAFSLYR.3|SVL…

Reference: SASP atlas
[/raw]