Post-radiation SASP in renal epithelial cells (day 10)

Comparison

UniProtIds

Protein Description

Genes

Log2 Ratio

Std. Dev.

PValue

QValue

GO Biological Process

GO Molecular Process

GO Cellular Process

Ratios

Unique Peptides

Elution Groups

Elution Group

SEN / CTL

P54886

Delta-1-pyrroline-5-carboxylate synthase

ALDH18A1

2.91

1.06

0.0417

0.0171

glutamate metabolic process,proline biosynthetic p...

glutamate 5-kinase activity,glutamate-5-semialdehy...

cytoplasm,mitochondrion,mitochondrial inner membra...

3

48

83

MIDLIIPR.2|M[Oxi]IDLIIPR.2|LGSAVVTR.2|QALHSGQNQLK....

SEN / CTL

P42771

P42772

Cyclin-dependent kinase inhibitor 2A;Cyclin-dependent kinase 4 inhibitor B

CDKN2A

CDKN2B

2.74

0.54

0.0134

0.00676

G1/S transition of mitotic cell cycle,negative reg...

cyclin-dependent protein serine/threonine kinase i...

nucleus,cytoplasm,cytosol,senescence-associated he...

3

1

2

EGFLDTLVVLHR.3|EGFLDTLVVLHR.2

SEN / CTL

Q969X5

Endoplasmic reticulum-Golgi intermediate compartment protein 1

ERGIC1

2.67

0.95

0.00163

0.00116

ER to Golgi vesicle-mediated transport

protein binding

Golgi membrane,endoplasmic reticulum membrane,endo...

6

14

19

IIPAIWFR.2|LTSNPLASHDYILK.3|LTSNPLASHDYILK.2|IVPTV...

SEN / CTL

Q9Y277

Voltage-dependent anion-selective channel protein 3

VDAC3

2.2

0.99

0.0567

0.0224

anion transport,adenine transport,transmembrane tr...

nucleotide binding,voltage-gated anion channel act...

nucleus,mitochondrion,mitochondrial outer membrane...

3

18

27

LTLSALIDGK.2|ASGNLETK.2|LSQNNFALGYK.3|LSQNNFALGYK....

SEN / CTL

Q13045

Protein flightless-1 homolog

FLII

2.08

0.4

4.87e-7

8.71e-7

transcription, DNA-templated,regulation of transcr...

actin binding,protein binding

nucleoplasm,cytoplasm,microtubule organizing cente...

9

58

77

ADLTALFLPR.2|FVFLLDR.2|GLDIYVWR.2|AC[CAM]SAIHAVNLR...

SEN / CTL

O94826

Mitochondrial import receptor subunit TOM70

TOMM70A

2.08

1.1

0.0774

0.0289

protein targeting to mitochondrion,macroautophagy,...

protein binding,protein transmembrane transporter ...

mitochondrion,mitochondrial outer membrane,mitocho...

3

29

43

ILLDQVEEAVADFDEC[CAM]IR.3|ILLDQVEEAVADFDEC[CAM]IR....

SEN / CTL

P21796

Voltage-dependent anion-selective channel protein 1

VDAC1

2.01

1.02

9.46e-18

7.98e-17

behavioral fear response,anion transport,mitochond...

protein binding,voltage-gated anion channel activi...

nucleus,mitochondrion,mitochondrial outer membrane...

48

31

53

LTLSALLDGK.2|YQIDPDAC[CAM]FSAK.2|YQIDPDAC[CAM]FSAK...

SEN / CTL

Q99988

Growth/differentiation factor 15

GDF15

1.96

0.87

0.00000167

0.00000264

signal transduction,transforming growth factor bet...

cytokine activity,transforming growth factor beta ...

extracellular region,extracellular space,nucleus,c...

12

7

7

ASLEDLGWADWVLSPR.2|LKPDTVPAPC[CAM]C[CAM]VPASYNPMVL...

SEN / CTL

P07203

Glutathione peroxidase 1

GPX1

1.89

1.18

0.00659

0.00383

response to reactive oxygen species,temperature ho...

glutathione peroxidase activity,SH3 domain binding

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

6

17

27

FLVGPDGVPLRR.3|YVRPGGGFEPNFMLFEK.3|YVRPGGGFEPNFM[O...

SEN / CTL

P48735

Isocitrate dehydrogenase [NADP], mitochondrial

IDH2

1.86

1.17

7.05e-9

1.88e-8

carbohydrate metabolic process,glyoxylate cycle,tr...

magnesium ion binding,isocitrate dehydrogenase (NA...

mitochondrion,mitochondrial inner membrane,mitocho...

27

38

63

IIWQFIK.2|VC[CAM]VETVESGAMTK.2|VC[CAM]VETVESGAM[Ox...

SEN / CTL

Q6DD88

Atlastin-3

ATL3

1.83

0.87

0.0627

0.0243

endoplasmic reticulum organization,Golgi organizat...

GTPase activity,protein binding,GTP binding,identi...

endoplasmic reticulum,endoplasmic reticulum membra...

3

31

45

GLLEYFK.2|DQHSFELDEK.3|DQHSFELDEK.2|IYQGEDLPHPK.3|...

SEN / CTL

Q9HCB6

Spondin-1

SPON1

1.72

0.71

3.72e-12

1.73e-11

cell adhesion,protein O-linked fucosylation

metal ion binding

proteinaceous extracellular matrix,extracellular s...

27

12

13

AQWPAWQPLNVR.2|AAPSAEFSVDR.2|VTLSAAPPSYFR.2|GFTLIA...

SEN / CTL

Q92882

Osteoclast-stimulating factor 1

OSTF1

1.7

1.26

0.124

0.0422

ossification,signal transduction

protein binding,SH3 domain binding

intracellular,cytoplasm,extracellular exosome

3

13

23

GYADIVQLLLAK.2|GYADIVQLLLAK.3|AGSTALYWAC[CAM]HGGHK...

SEN / CTL

Q9BPX5

Actin-related protein 2/3 complex subunit 5-like protein

ARPC5L

1.62

0.46

0.0233

0.0108

biological_process,Arp2/3 complex-mediated actin n...

molecular_function,actin binding

cytoplasm,Arp2/3 protein complex,focal adhesion,ex...

3

10

13

ALAVGGLGSIIR.2|RVDIDEFDENK.3|RVDIDEFDENK.2|GFEKPTE...

SEN / CTL

Q93050

V-type proton ATPase 116 kDa subunit a isoform 1

ATP6V0A1

1.58

0.66

0.069

0.0262

vacuolar acidification,insulin receptor signaling ...

protein binding,proton-transporting ATPase activit...

vacuolar proton-transporting V-type ATPase, V0 dom...

3

20

24

LGFVAGVINR.2|RGTEHSGSTVPSILNR.4|FLPFSFEHIR.3|LGFVA...

SEN / CTL

P10909

Clusterin

CLU

1.57

0.9

2.98e-15

1.79e-14

cell morphogenesis,microglial cell activation,rele...

protein binding,ubiquitin protein ligase binding,c...

extracellular region,extracellular space,nucleus,c...

48

25

42

LFDSDPITVTVPVEVSR.2|LFDSDPITVTVPVEVSR.3|ASSIIDELFQ...

SEN / CTL

P08134

Rho-related GTP-binding protein RhoC

RHOC

1.57

0.34

0.000113

0.000112

cytokinesis,small GTPase mediated signal transduct...

signal transducer activity,protein binding,GTP bin...

cytosol,plasma membrane,cleavage furrow,extracellu...

6

5

7

ISAFGYLEC[CAM]SAK.2|ISAFGYLEC[CAM]SAK.3|EGVREVFEMA...

SEN / CTL

P45880

Voltage-dependent anion-selective channel protein 2

VDAC2

1.55

1.15

0.00054

0.000445

anion transport,negative regulation of protein pol...

nucleotide binding,voltage-gated anion channel act...

nucleus,mitochondrion,mitochondrial outer membrane...

18

21

28

YQLDPTASISAK.2|LTLSALVDGK.2|VNNSSLIGVGYTQTLRPGVK.3...

SEN / CTL

Q9P2J5

Leucine--tRNA ligase, cytoplasmic

LARS

1.51

0.33

0.0109

0.00572

tRNA aminoacylation for protein translation,leucyl...

aminoacyl-tRNA editing activity,leucine-tRNA ligas...

nucleus,cytoplasm,cytosol

3

78

124

WQFLTLR.2|KHFEANNGKLPDNK.4|LHLGHTFSLSK.3|LHLGHTFSL...

SEN / CTL

P11310

Medium-chain specific acyl-CoA dehydrogenase, mitochondrial

ACADM

1.47

0.43

0.0299

0.0132

fatty acid beta-oxidation,carnitine metabolic proc...

fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti...

nucleus,mitochondrion,mitochondrial matrix,axon,ex...

3

33

52

ANWYFLLAR.2|GIVFEDVKVPK.3|GIVFEDVKVPK.2|ELNMGQR.2|...

SEN / CTL

P14678

P63162

Small nuclear ribonucleoprotein-associated proteins B and B';Small nuclear ribonucleoprotein-associated protein N

SNRPB

SNRPN

1.46

0.88

0.0873

0.0321

spliceosomal snRNP assembly,mRNA splicing, via spl...

protein binding,U2 snRNA binding,poly(A) RNA bindi...

nucleoplasm,spliceosomal complex,U5 snRNP,U7 snRNP...

3

1

1

VLGLVLLR.2

SEN / CTL

O95379

Tumor necrosis factor alpha-induced protein 8

TNFAIP8

1.45

0.2

0.00839

0.00465

apoptotic process,negative regulation of apoptotic...

protein binding,cysteine-type endopeptidase inhibi...

cytoplasm

3

6

10

SIATTLIDDTSSEVLDELYR.3|SIATTLIDDTSSEVLDELYR.2|EVAT...

SEN / CTL

P69905

Hemoglobin subunit alpha

HBA1

1.44

1.22

0.000519

0.000431

receptor-mediated endocytosis,positive regulation ...

oxygen transporter activity,iron ion binding,prote...

extracellular region,cytosol,hemoglobin complex,me...

12

23

78

VGAHAGEYGAEALER.3|VGAHAGEYGAEALER.2|MFLSFPTTK.2|M[...

SEN / CTL

P06732

Creatine kinase M-type

CKM

1.43

0.29

0.0135

0.0068

creatine metabolic process,phosphorylation,phospho...

creatine kinase activity,protein binding,ATP bindi...

cytosol

3

5

6

GGDDLDPNYVLSSR.2|LGSSEVEQVQLVVDGVK.3|GQSIDDMIPAQK....

SEN / CTL

P17096

High mobility group protein HMG-I/HMG-Y

HMGA1

1.4

1.14

0.00953

0.00512

DNA unwinding involved in DNA replication,nucleoso...

transcriptional activator activity, RNA polymerase...

nucleus,nucleoplasm,transcription factor complex,c...

12

9

13

KLEKEEEEGISQESSEEEQ.3|KQPPVSPGTALVGSQKEPSEVPTPK.4|...

SEN / CTL

P21980

Protein-glutamine gamma-glutamyltransferase 2

TGM2

1.38

0.93

1e-20

1.23e-19

blood vessel remodeling,isopeptide cross-linking v...

protein-glutamine gamma-glutamyltransferase activi...

mitochondrion,endoplasmic reticulum,cytosol,focal ...

90

46

73

SVPLC[CAM]ILYEK.2|RGQPFWLTLHFEGR.3|RGQPFWLTLHFEGR....

SEN / CTL

Q9H4B7

Tubulin beta-1 chain

TUBB1

1.37

0.46

0.036

0.0152

spindle assembly

GTPase activity,structural constituent of cytoskel...

cytoplasm,microtubule,extracellular exosome

3

21

38

NSSC[CAM]FVEWIPNNVK.2|NSSC[CAM]FVEWIPNNVK.3|IMNSFS...

SEN / CTL

Q13885

Tubulin beta-2A chain

TUBB2A

1.32

0.77

2.85e-15

1.75e-14

cytoskeleton organization,microtubule-based proces...

GTPase activity,structural constituent of cytoskel...

nucleus,cytoplasm,microtubule,extracellular exosom...

54

12

25

YLTVAAIFR.2|ESESC[CAM]DC[CAM]LQGFQLTHSLGGGTGSGMGTL...

SEN / CTL

P68104

Elongation factor 1-alpha 1

EEF1A1

1.31

0.72

2.02e-38

7.81e-37

transcription, DNA-templated,regulation of transcr...

tRNA binding,translation elongation factor activit...

extracellular space,nucleus,nucleolus,cytoplasm,cy...

132

52

144

EHALLAYTLGVK.3|EHALLAYTLGVK.2|IGGIGTVPVGR.2|YYVTII...

SEN / CTL

Q9NQH7

Probable Xaa-Pro aminopeptidase 3

XPNPEP3

1.31

1.6

0.106

0.0373

glomerular filtration,protein processing

aminopeptidase activity,metallopeptidase activity,...

mitochondrion,extracellular exosome

3

10

14

AILFVPR.2|GVQQLIQR.2|YC[CAM]PHHVGHYLGMDVHDTPDMPR.5...

SEN / CTL

Q71U36

Tubulin alpha-1A chain

TUBA1A

1.3

0.6

2.73e-49

1.84e-47

G2/M transition of mitotic cell cycle,cytoskeleton...

GTPase activity,structural molecule activity,struc...

nucleus,cytosol,microtubule,cytoplasmic microtubul...

135

45

112

AVFVDLEPTVIDEVR.2|AVFVDLEPTVIDEVR.3|LIGQIVSSITASLR...

SEN / CTL

P68371

Tubulin beta-4B chain

TUBB4B

1.28

0.7

4.16e-55

5.61e-53

G2/M transition of mitotic cell cycle,movement of ...

double-stranded RNA binding,GTPase activity,struct...

nucleus,cytosol,cytoskeleton,microtubule,extracell...

201

42

123

YLTVAAVFR.2|NSSYFVEWIPNNVK.2|NSSYFVEWIPNNVK.3|SGPF...

SEN / CTL

P14618

Pyruvate kinase PKM

PKM

1.27

0.99

2.89e-39

1.3e-37

programmed cell death,canonical glycolysis,cell-ce...

magnesium ion binding,pyruvate kinase activity,pro...

nucleus,cytoplasm,mitochondrion,cytosol,plasma mem...

246

71

161

GDLGIEIPAEK.2|IYVDDGLISLQVK.2|IYVDDGLISLQVK.3|KGVN...

SEN / CTL

P27824

Calnexin

CANX

1.27

0.92

0.000253

0.000228

antigen processing and presentation of peptide ant...

glycoprotein binding,calcium ion binding,protein b...

endoplasmic reticulum,endoplasmic reticulum lumen,...

18

59

93

GTLSGWILSK.2|KIPNPDFFEDLEPFR.3|KIPNPDFFEDLEPFR.2|V...

SEN / CTL

Q14376

UDP-glucose 4-epimerase

GALE

1.27

0.48

0.0444

0.0182

galactose catabolic process

UDP-N-acetylglucosamine 4-epimerase activity,UDP-g...

cytosol,extracellular exosome

3

22

28

VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFR.4|VLVTGGAGYIG...

SEN / CTL

Q93008

Probable ubiquitin carboxyl-terminal hydrolase FAF-X

USP9X

1.26

1.28

0.0272

0.0122

negative regulation of transcription from RNA poly...

cysteine-type endopeptidase activity,thiol-depende...

cytoplasm,cytosol,membrane,growth cone

6

82

105

VVIQSNDDIASR.2|SGGLPLVLSMLTR.2|SGGLPLVLSM[Oxi]LTR....

SEN / CTL

Q9BUF5

Tubulin beta-6 chain

TUBB6

1.24

1.11

1.46e-11

5.89e-11

cytoskeleton organization,microtubule-based proces...

molecular_function,GTPase activity,structural cons...

nucleus,cytoplasm,microtubule,extracellular exosom...

72

25

55

YLTVATVFR.2|M[Oxi]ASTFIGNSTAIQELFKR.3|MASTFIGNSTAI...

SEN / CTL

P18065

Insulin-like growth factor-binding protein 2

IGFBP2

1.24

0.67

0.00000432

0.0000061

regulation of cell growth,signal transduction,fema...

receptor binding,insulin-like growth factor I bind...

extracellular region,extracellular space,apical pl...

18

11

14

TPC[CAM]QQELDQVLER.2|LEGEAC[CAM]GVYTPR.2|LAAC[CAM]...

SEN / CTL

P62280

40S ribosomal protein S11

RPS11

1.24

0.4

0.0275

0.0123

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,rRNA binding,po...

nucleoplasm,nucleolus,cytoplasm,cytosol,ribosome,f...

3

16

23

NMSVHLSPC[CAM]FR.3|NM[Oxi]SVHLSPC[CAM]FR.3|NMSVHLS...

SEN / CTL

P00387

NADH-cytochrome b5 reductase 3

CYB5R3

1.23

0.95

0.000206

0.000193

cholesterol biosynthetic process,blood circulation...

cytochrome-b5 reductase activity, acting on NAD(P)...

cytoplasm,mitochondrion,mitochondrial outer membra...

15

25

51

FALPSPQHILGLPVGQHIYLSAR.4|FALPSPQHILGLPVGQHIYLSAR....

SEN / CTL

Q12797

Aspartyl/asparaginyl beta-hydroxylase

ASPH

1.23

0.73

0.000537

0.000445

muscle contraction,peptidyl-amino acid modificatio...

peptide-aspartate beta-dioxygenase activity,struct...

endoplasmic reticulum,endoplasmic reticulum membra...

9

34

40

GLFLPEDENLREK.3|GAIETYQEVASLPDVPADLLK.3|GAIETYQEVA...

SEN / CTL

Q9H853

Putative tubulin-like protein alpha-4B

TUBA4B

1.22

0.44

0.036

0.0152

cytoskeleton organization,microtubule-based proces...

molecular_function,GTPase activity,structural cons...

cellular_component,cytoplasm,microtubule

3

1

2

QIFHPEQLITGK.3|QIFHPEQLITGK.2

SEN / CTL

P13807

Glycogen [starch] synthase, muscle

GYS1

1.21

0.42

0.0392

0.0162

glycogen biosynthetic process,heart development

glycogen (starch) synthase activity,protein bindin...

cytosol,membrane,inclusion body

3

25

31

LSDLLDWK.2|FSAMHEFQNLHAQSK.4|FSAMHEFQNLHAQSK.3|LSD...

SEN / CTL

P46940

Ras GTPase-activating-like protein IQGAP1

IQGAP1

1.2

0.69

1.67e-32

5.02e-31

regulation of cytokine production,signal transduct...

GTPase inhibitor activity,GTPase activator activit...

ruffle,nucleus,cytoplasm,cytosol,microtubule,actin...

120

128

200

NKYQELINDIAR.3|NKYQELINDIAR.2|IIGNLLYYR.2|LIVDVIR....

SEN / CTL

Q14204

Cytoplasmic dynein 1 heavy chain 1

DYNC1H1

1.2

0.95

8.71e-16

6.03e-15

G2/M transition of mitotic cell cycle,ER to Golgi ...

microtubule motor activity,ATP binding,ATPase acti...

centrosome,cytosol,cytoplasmic dynein complex,micr...

81

337

531

FGNPLLVQDVESYDPVLNPVLNR.3|GNEIVLSAGSTPR.2|IFVFEPPP...

SEN / CTL

Q6NUK1

Calcium-binding mitochondrial carrier protein SCaMC-1

SLC25A24

1.2

0.61

0.00159

0.00114

mitochondrial transport,regulation of cell death,A...

ATP transmembrane transporter activity,calcium ion...

mitochondrion,mitochondrial inner membrane,integra...

6

28

40

QLLAGGIAGAVSR.2|QLLAGGIAGAVSR.3|TSTAPLDR.2|QTLGVTQ...

SEN / CTL

Q9BVC6

Transmembrane protein 109

TMEM109

1.2

0.65

0.0809

0.0301

ion transport,regulation of ion transmembrane tran...

molecular_function,voltage-gated ion channel activ...

nuclear outer membrane,integral component of membr...

3

5

6

EAPVDVLTQIGR.2|ASGAQLEAK.2|REAPVDVLTQIGR.3|REAPVDV...

SEN / CTL

P04066

Tissue alpha-L-fucosidase

FUCA1

1.19

0.66

6.94e-12

3.02e-11

fucose metabolic process,glycosaminoglycan catabol...

alpha-L-fucosidase activity

cytoplasm,lysosomal lumen,extracellular exosome

39

21

32

DGLIVPIFQER.2|WLSINGEAIYASKPWR.3|DLVGELGTALR.2|DVG...

SEN / CTL

P50851

Lipopolysaccharide-responsive and beige-like anchor protein

LRBA

1.17

1.09

0.00497

0.00298

biological_process

molecular_function

lysosome,endoplasmic reticulum,Golgi apparatus,pla...

12

75

87

VANEAEFILSR.2|LQATMETDDNIR.2|EAVEAQIR.2|EIFVDFAPFL...

SEN / CTL

P10145

Interleukin-8

CXCL8

1.16

0.53

0.0612

0.0238

angiogenesis,response to molecule of bacterial ori...

interleukin-8 receptor binding,protein binding,che...

extracellular region,extracellular space,intracell...

3

1

2

VIESGPHC[CAM]ANTEIIVK.3|VIESGPHC[CAM]ANTEIIVK.2

SEN / CTL

Q16787

Laminin subunit alpha-3

LAMA3

1.15

0.97

0.0118

0.00614

cell adhesion,epidermis development,extracellular ...

receptor binding,structural molecule activity

extracellular region,basement membrane,laminin-5 c...

9

14

14

LLIDDQLLR.2|VPTQPHAPIPTFGQTIQTTVDR.3|SPQTYMDGLLHYV...

SEN / CTL

P07437

Tubulin beta chain

TUBB

1.14

0.56

1.33e-12

6.7e-12

G2/M transition of mitotic cell cycle,movement of ...

GTPase activity,structural molecule activity,struc...

extracellular region,nucleus,nuclear envelope lume...

30

8

21

ALTVPELTQQVFDAK.2|ALTVPELTQQVFDAK.3|ISVYYNEATGGKYV...

SEN / CTL

Q14108

Lysosome membrane protein 2

SCARB2

1.14

0.29

2.72e-8

6.21e-8

protein targeting to lysosome,viral entry into hos...

virus receptor activity,protein binding,enzyme bin...

lysosomal membrane,focal adhesion,membrane,integra...

12

15

24

KLDDFVETGDIR.3|KLDDFVETGDIR.2|FVSAIEGMHPNQEDHETFVD...

SEN / CTL

Q9NY65

Tubulin alpha-8 chain

TUBA8

1.14

0.25

0.0139

0.00694

cytoskeleton organization,microtubule-based proces...

GTPase activity,structural constituent of cytoskel...

cytoplasm,microtubule

3

7

9

KLTDAC[CAM]SGLQGFLIFHSFGGGTGSGFTSLLMER.4|GHYTVGKES...

SEN / CTL

P12277

Creatine kinase B-type

CKB

1.13

0.65

1.76e-19

1.9e-18

creatine metabolic process,phosphorylation,substan...

creatine kinase activity,protein binding,ATP bindi...

extracellular space,cytoplasm,mitochondrion,cytoso...

63

33

80

VLTPELYAELR.2|VLTPELYAELR.3|HGGYKPSDEHKTDLNPDNLQGG...

SEN / CTL

P17655

Calpain-2 catalytic subunit

CAPN2

1.12

0.73

1.83e-21

2.47e-20

response to hypoxia,blastocyst development,proteol...

calcium-dependent cysteine-type endopeptidase acti...

chromatin,nucleus,cytoplasm,lysosome,endoplasmic r...

69

45

77

FADDQLIIDFDNFVR.2|FADDQLIIDFDNFVR.3|LFAQLAGEDAEISA...

SEN / CTL

Q9BVA1

Tubulin beta-2B chain

TUBB2B

1.12

0.24

0.0162

0.00794

neuron migration,cytoskeleton organization,microtu...

GTPase activity,structural constituent of cytoskel...

nucleus,cytoplasm,microtubule

3

2

2

INVYYNEATGNKYVPR.3|INVYYNEATGNK.2

SEN / CTL

A6NHL2

Tubulin alpha chain-like 3

TUBAL3

1.12

0.27

0.0171

0.00828

cytoskeleton organization,microtubule-based proces...

GTPase activity,structural constituent of cytoskel...

cytoplasm,microtubule

3

4

7

KLAEQC[CAM]GGLQGFLIFRSFGGGTGSGFTSLLMER.4|SLFHPEQLL...

SEN / CTL

O75915

PRA1 family protein 3

ARL6IP5

1.11

0.3

0.0246

0.0112

negative regulation of L-glutamate transport,intri...

molecular_function

endoplasmic reticulum,endoplasmic reticulum membra...

3

4

6

TPMGIVLDALEQQEEGINR.3|TPMGIVLDALEQQEEGINR.2|RTPMGI...

SEN / CTL

P30044

Peroxiredoxin-5, mitochondrial

PRDX5

1.09

0.61

6.09e-18

5.3e-17

response to reactive oxygen species,apoptotic proc...

RNA polymerase III regulatory region DNA binding,p...

extracellular space,nucleus,cytoplasm,mitochondrio...

48

19

35

THLPGFVEQAEALK.3|THLPGFVEQAEALK.2|THLPGFVEQAEALKAK...

SEN / CTL

O43324

Eukaryotic translation elongation factor 1 epsilon-1

EEF1E1

1.09

0.32

0.0239

0.011

translational elongation,tRNA aminoacylation for p...

translation elongation factor activity,glutathione...

nucleus,cytoplasm,cytosol,extracellular exosome

3

12

17

AIVQQWLEYR.2|WFC[CAM]HIQHYPGIR.4|WFC[CAM]HIQHYPGIR...

SEN / CTL

Q01813

ATP-dependent 6-phosphofructokinase, platelet type

PFKP

1.08

0.74

2.6e-11

1.02e-10

fructose 6-phosphate metabolic process,canonical g...

6-phosphofructokinase activity,ATP binding,protein...

nucleus,cytoplasm,cytosol,cell-cell adherens junct...

39

52

85

EWSGLLEELAR.2|LAIKLPDDQIPK.3|LAIKLPDDQIPK.2|NVIFQP...

SEN / CTL

P12236

ADP/ATP translocase 3

SLC25A6

1.08

1.68

0.148

0.0482

protein targeting to mitochondrion,apoptotic proce...

ATP:ADP antiporter activity,protein binding,adenin...

nucleus,mitochondrion,mitochondrial inner membrane...

9

8

15

DFLAGGIAAAISK.2|DFLAGGIAAAISK.3|KGADIMYTGTVDC[CAM]...

SEN / CTL

P39656

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit

DDOST

1.07

0.97

0.00142

0.00103

protein glycosylation,protein N-linked glycosylati...

oligosaccharyl transferase activity,dolichyl-dipho...

endoplasmic reticulum,endoplasmic reticulum membra...

9

20

32

NTLLIAGLQAR.2|TLVLLDNLNVR.2|WVFKEEGVLR.3|WVFKEEGVL...

SEN / CTL

P26640

Valine--tRNA ligase

VARS

1.06

0.46

0.00000469

0.00000649

tRNA aminoacylation for protein translation,valyl-...

aminoacyl-tRNA editing activity,valine-tRNA ligase...

mitochondrion,cytosol

12

72

116

LSAAVTEAFVR.2|SSAQDPQAVLGALGR.2|SSAQDPQAVLGALGR.3|...

SEN / CTL

P48047

ATP synthase subunit O, mitochondrial

ATP5O

1.05

0.51

0.0000294

0.0000331

ATP biosynthetic process,proton transport,mitochon...

transporter activity,protein binding,drug binding,...

nucleus,mitochondrion,mitochondrial inner membrane...

9

18

35

LVRPPVQVYGIEGR.3|LVRPPVQVYGIEGR.2|FSPLTTNLINLLAENG...

SEN / CTL

P02042

P02100

P68871

P69891

P69892

Hemoglobin subunit delta;Hemoglobin subunit epsilon;Hemoglobin subunit beta;Hemoglobin subunit gamma-1;Hemoglobin subunit gamma-2

HBD

HBE1

HBB

HBG1

HBG2

1.04

1.22

0.0278

0.0124

blood coagulation,oxygen transport;blood coagulati...

oxygen transporter activity,iron ion binding,prote...

cytosol,hemoglobin complex,blood microparticle;cyt...

6

1

2

LLVVYPWTQR.2|LLVVYPWTQR.3

SEN / CTL

Q99714

3-hydroxyacyl-CoA dehydrogenase type-2

HSD17B10

1.04

0.88

0.111

0.0387

lipid metabolic process,branched-chain amino acid ...

3-hydroxyacyl-CoA dehydrogenase activity,protein b...

cytoplasm,mitochondrion,mitochondrial matrix,plasm...

6

26

51

GGIVGMTLPIAR.2|GGIVGM[Oxi]TLPIAR.2|DLAPIGIR.2|GQTH...

SEN / CTL

Q16527

Cysteine and glycine-rich protein 2

CSRP2

1.03

0.88

0.00375

0.00238

multicellular organism development,cell differenti...

molecular_function,zinc ion binding

nucleus,focal adhesion

9

10

14

GFGYGQGAGALVHAQ.2|GYGYGQGAGTLNMDRGER.3|C[CAM]C[CAM...

SEN / CTL

Q14894

Ketimine reductase mu-crystallin

CRYM

1.03

1

0.00619

0.00361

negative regulation of transcription from RNA poly...

transcription corepressor activity,protein homodim...

nucleus,cytoplasm,mitochondrion,peroxisomal matrix...

9

13

18

VPAFLSAAEVEEHLR.3|FADTVQGEVR.2|SLGMAVEDTVAAK.2|SLG...

SEN / CTL

P02511

Alpha-crystallin B chain

CRYAB

1.03

0.66

0.0213

0.00992

response to hypoxia,lens development in camera-typ...

structural constituent of eye lens,protein binding...

nucleus,nucleoplasm,cytoplasm,mitochondrion,Golgi ...

6

25

40

FSVNLDVK.2|LFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLR.4|LF...

SEN / CTL

Q96DG6

Carboxymethylenebutenolidase homolog

CMBL

1.02

0.2

0.000115

0.000114

xenobiotic metabolic process

hydrolase activity

cytosol,extracellular exosome

6

19

23

NLIEWLNK.2|AVIVIQDIFGWQLPNTR.3|AVIVIQDIFGWQLPNTR.2...

SEN / CTL

O00299

Chloride intracellular channel protein 1

CLIC1

1

0.89

5e-9

1.39e-8

chloride transport,signal transduction,regulation ...

voltage-gated ion channel activity,chloride channe...

extracellular space,nucleus,nuclear envelope,cytop...

63

24

42

LAALNPESNTAGLDIFAK.2|LAALNPESNTAGLDIFAK.3|GFTIPEAF...

SEN / CTL

Q15717

ELAV-like protein 1

ELAVL1

1

0.08

0.00231

0.00157

mRNA splicing, via spliceosome,multicellular organ...

nucleotide binding,RNA binding,double-stranded RNA...

nucleus,nucleoplasm,cytoplasm,cytosol,membrane,rib...

3

21

35

VLVDQTTGLSR.2|DANLYISGLPR.3|DANLYISGLPR.2|FGGPVHHQ...

SEN / CTL

P61586

Transforming protein RhoA

RHOA

0.97

0.76

0.00000196

0.00000302

transforming growth factor beta receptor signaling...

GTPase activity,protein binding,GTP binding,myosin...

endosome,endoplasmic reticulum membrane,cytosol,cy...

27

17

30

HFC[CAM]PNVPIILVGNKK.4|HFC[CAM]PNVPIILVGNKK.3|TC[C...

SEN / CTL

Q9H6S3

Epidermal growth factor receptor kinase substrate 8-like protein 2

EPS8L2

0.97

0.62

0.000495

0.000414

Rho protein signal transduction,regulation of Rho ...

actin binding,cadherin binding involved in cell-ce...

cytoplasm,plasma membrane,cell-cell adherens junct...

9

30

35

VGPQVPLSEPGFR.2|LAINLLAK.2|ETQILNC[CAM]ALDDIEWFVAR...

SEN / CTL

P60903

Protein S100-A10

S100A10

0.96

0.46

2.7e-10

9.23e-10

membrane raft assembly,membrane budding,positive r...

calcium ion binding,protein binding,protein homodi...

extrinsic component of plasma membrane,extracellul...

24

12

32

FAGDKGYLTKEDLR.4|FAGDKGYLTKEDLR.3|VLMEKEFPGFLENQKD...

SEN / CTL

Q3ZCM7

Tubulin beta-8 chain

TUBB8

0.96

1.04

0.0000192

0.0000227

oocyte maturation,spindle assembly involved in fem...

molecular_function,GTPase activity,structural cons...

cytoplasm,microtubule,extracellular exosome,meioti...

21

4

13

LPTPTYGDLNHLVSATMSGVTTC[CAM]LR.3|EAESC[CAM]DC[CAM]...

SEN / CTL

P36543

V-type proton ATPase subunit E 1

ATP6V1E1

0.96

0.39

0.0459

0.0186

insulin receptor signaling pathway,ATP hydrolysis ...

protein binding,hydrogen-exporting ATPase activity...

mitochondrion,lysosomal membrane,endosome,cytosol,...

3

16

22

ARDDLITDLLNEAK.3|ARDDLITDLLNEAK.2|VSNTLESR.2|IMEYY...

SEN / CTL

P04083

Annexin A1

ANXA1

0.95

0.47

9.2e-22

1.31e-20

DNA strand renaturation,neutrophil homeostasis,ada...

single-stranded DNA binding,single-stranded RNA bi...

cornified envelope,phagocytic cup,extracellular re...

75

38

69

GLGTDEDTLIEILASR.3|GLGTDEDTLIEILASR.2|GVDEATIIDILT...

SEN / CTL

P48307

Tissue factor pathway inhibitor 2

TFPI2

0.95

2.1

0.0805

0.03

blood coagulation,negative regulation of endopepti...

serine-type endopeptidase inhibitor activity,extra...

proteinaceous extracellular matrix,nucleus,extrace...

6

4

4

LQVSVDDQC[CAM]EGSTEK.2|TC[CAM]DAFTYTGC[CAM]GGNDNNF...

SEN / CTL

Q32MK0

Q86YV6

Q9H1R3

Myosin light chain kinase 3;Myosin light chain kinase family member 4;Myosin light chain kinase 2, skeletal/cardiac muscle

MYLK3

MYLK4

MYLK2

0.95

0.72

0.105

0.0371

regulation of vascular permeability involved in ac...

calmodulin-dependent protein kinase activity,myosi...

cytoplasm,cytosol,actin cytoskeleton;extracellular...

3

1

1

IIDFGLAR.2

SEN / CTL

P04406

Glyceraldehyde-3-phosphate dehydrogenase

GAPDH

0.94

0.83

1.67e-26

3.1e-25

microtubule cytoskeleton organization,gluconeogene...

glyceraldehyde-3-phosphate dehydrogenase (NAD+) (p...

nucleus,cytoplasm,lipid particle,cytosol,plasma me...

174

51

166

LISWYDNEFGYSNR.2|LISWYDNEFGYSNR.3|GALQNIIPASTGAAK....

SEN / CTL

P38646

Stress-70 protein, mitochondrial

HSPA9

0.94

1.21

0.000012

0.0000151

protein folding,protein export from nucleus,erythr...

protein binding,ATP binding,ubiquitin protein liga...

nucleolus,cytoplasm,mitochondrion,focal adhesion,e...

36

68

123

TTPSVVAFTADGER.2|TTPSVVAFTADGER.3|AQFEGIVTDLIR.2|A...

SEN / CTL

O60936

Nucleolar protein 3

NOL3

0.94

0.4

0.0636

0.0246

response to hypoxia,blood vessel remodeling,respon...

RNA binding,death receptor binding,calcium ion bin...

nucleolus,mitochondrion,cytosol,membrane,sarcoplas...

3

5

6

LVETLQADSGLLLDALLAR.3|LVETLQADSGLLLDALLAR.2|GEAAC[...

SEN / CTL

O15264

P45983

P45984

P53778

P53779

Q15759

Q16539

Mitogen-activated protein kinase 13;Mitogen-activated protein kinase 8;Mitogen-activated protein kinase 9;Mitogen-activated protein kinase 12;Mitogen-activated protein kinase 10;Mitogen-activated protein kinase 11;Mitogen-activated protein kinase 14

MAPK13

MAPK8

MAPK9

MAPK12

MAPK10

MAPK11

MAPK14

0.94

0.72

0.105

0.0371

MAPK cascade,transcription, DNA-templated,regulati...

protein serine/threonine kinase activity,MAP kinas...

cytosol;nucleus,nucleoplasm,mitochondrion,cytosol;...

3

1

1

ILDFGLAR.2

SEN / CTL

Q96TA1

Niban-like protein 1

FAM129B

0.93

0.5

2.15e-15

1.36e-14

negative regulation of apoptotic process,cell-cell...

cadherin binding involved in cell-cell adhesion

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pl...

45

38

58

FDVSSTSVFK.2|FQELIFEDFAR.2|HC[CAM]NNGIPEDSKVEGPAFT...

SEN / CTL

P40939

Trifunctional enzyme subunit alpha, mitochondrial

HADHA

0.92

0.8

3.87e-10

1.28e-9

fatty acid beta-oxidation,response to insulin,card...

fatty-acyl-CoA binding,3-hydroxyacyl-CoA dehydroge...

mitochondrion,mitochondrial inner membrane,mitocho...

33

68

128

LTAYAMTIPFVR.2|LTAYAMTIPFVR.3|LTAYAM[Oxi]TIPFVR.2|...

SEN / CTL

Q13509

Tubulin beta-3 chain

TUBB3

0.9

0.95

1.6e-8

4.04e-8

cytoskeleton organization,microtubule-based proces...

GTPase activity,structural constituent of cytoskel...

nucleus,cytoplasm,microtubule,axon,dendrite,neuron...

42

12

23

ISVYYNEASSHKYVPR.4|LHFFMPGFAPLTAR.3|LHFFMPGFAPLTAR...

SEN / CTL

P07741

Adenine phosphoribosyltransferase

APRT

0.9

1.18

0.0013

0.000948

adenine salvage,lactation,grooming behavior,cellul...

adenine binding,adenine phosphoribosyltransferase ...

nucleoplasm,cytoplasm,cytosol,extracellular exosom...

15

17

29

GFLFGPSLAQELGLGC[CAM]VLIR.3|GFLFGPSLAQELGLGC[CAM]V...

SEN / CTL

P07355

Annexin A2

ANXA2

0.89

1.02

3.01e-28

6.26e-27

angiogenesis,membrane raft assembly,positive regul...

protease binding,calcium ion binding,protein bindi...

ruffle,basement membrane,extracellular space,nucle...

222

49

99

GLGTDEDSLIEIIC[CAM]SR.2|GLGTDEDSLIEIIC[CAM]SR.3|GV...

SEN / CTL

Q14240

Eukaryotic initiation factor 4A-II

EIF4A2

0.89

0.61

0.0693

0.0263

nuclear-transcribed mRNA poly(A) tail shortening,t...

translation initiation factor activity,ATP-depende...

cytosol,eukaryotic translation initiation factor 4...

3

18

29

KGVAINFVTEEDKR.4|KGVAINFVTEEDKR.3|KGVAINFVTEEDKR.2...

SEN / CTL

O00151

PDZ and LIM domain protein 1

PDLIM1

0.88

0.29

2.87e-19

2.87e-18

response to hypoxia,regulation of transcription, D...

transcription coactivator activity,zinc ion bindin...

transcription factor complex,cytoplasm,cytoskeleto...

39

27

50

IKGC[CAM]TDNLTLTVAR.3|IKGC[CAM]TDNLTLTVAR.2|C[CAM]...

SEN / CTL

P60709

P63261

Actin, cytoplasmic 1;Actin, cytoplasmic 2

ACTB

ACTG1

0.88

1.26

9.1e-19

8.47e-18

retina homeostasis,movement of cell or subcellular...

structural constituent of cytoskeleton,protein bin...

nuclear chromatin,extracellular space,nucleoplasm,...

282

34

122

SYELPDGQVITIGNER.2|SYELPDGQVITIGNER.3|VAPEEHPVLLTE...

SEN / CTL

Q6IAA8

Ragulator complex protein LAMTOR1

LAMTOR1

0.88

0.36

0.00102

0.000773

regulation of receptor recycling,endosome organiza...

protein binding,guanyl-nucleotide exchange factor ...

lysosome,lysosomal membrane,Golgi apparatus,plasma...

6

9

17

TDEQALLSSILAK.2|IAAYAYSALSQIR.2|ALNGAEPNYHSLPSAR.4...

SEN / CTL

P04179

Superoxide dismutase [Mn], mitochondrial

SOD2

0.86

1.13

0.0000142

0.0000174

response to reactive oxygen species,response to su...

superoxide dismutase activity,manganese ion bindin...

mitochondrion,mitochondrial matrix,extracellular e...

54

23

42

AIWNVINWENVTER.2|AIWNVINWENVTER.3|GDVTAQIALQPALK.2...

SEN / CTL

P34059

N-acetylgalactosamine-6-sulfatase

GALNS

0.85

1.61

0.0673

0.0257

keratan sulfate catabolic process

N-acetylgalactosamine-4-sulfatase activity,sulfuri...

lysosomal lumen,extracellular exosome

9

12

17

YYEEFPINLK.2|AHFWTWTNSWENFR.3|AHFWTWTNSWENFR.2|AID...

SEN / CTL

P60866

40S ribosomal protein S20

RPS20

0.85

0.66

0.132

0.0444

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,poly(A) RNA bin...

nucleoplasm,cytoplasm,cytosol,membrane,cytosolic s...

3

5

10

LIDLHSPSEIVK.3|LIDLHSPSEIVK.2|DTGKTPVEPEVAIHR.4|DT...

SEN / CTL

P50552

Vasodilator-stimulated phosphoprotein

VASP

0.84

0.29

0.0000215

0.0000252

neural tube closure,axon guidance,actin polymeriza...

actin binding,protein binding,profilin binding,SH3...

cytoplasm,cytosol,plasma membrane,cell-cell adhere...

9

28

48

WLPAGTGPQAFSR.2|SSSSVTTSETQPC[CAM]TPSSSDYSDLQR.3|V...

SEN / CTL

Q9BVK6

Transmembrane emp24 domain-containing protein 9

TMED9

0.84

0.52

0.000425

0.000359

ER to Golgi vesicle-mediated transport,retrograde ...

syntaxin binding

Golgi membrane,endoplasmic reticulum,endoplasmic r...

9

13

20

QLVEQVEQIQKEQNYQR.3|FSLFAGGMLR.2|FSLFAGGM[Oxi]LR.2...

SEN / CTL

O00748

Cocaine esterase

CES2

0.84

0.09

0.0035

0.00224

xenobiotic metabolic process,catabolic process

methylumbelliferyl-acetate deacetylase activity,ca...

extracellular space,endoplasmic reticulum,endoplas...

3

21

31

MIPGVVDGVFLPR.2|M[Oxi]IPGVVDGVFLPR.2|ADHGDELPFVFR....

SEN / CTL

P61026

Ras-related protein Rab-10

RAB10

0.83

0.37

0.00000813

0.0000107

Golgi to plasma membrane transport,small GTPase me...

GTPase activity,GTP binding,GDP binding,myosin V b...

Golgi membrane,endosome,endoplasmic reticulum memb...

12

17

24

AFLTLAEDILR.2|LLLIGDSGVGK.2|LQIWDTAGQER.2|LQIWDTAG...

SEN / CTL

P10606

Cytochrome c oxidase subunit 5B, mitochondrial

COX5B

0.83

0.69

0.0135

0.0068

mitochondrial electron transport, cytochrome c to ...

cytochrome-c oxidase activity,protein binding,meta...

mitochondrion,mitochondrial inner membrane,mitocho...

6

10

16

KGLDPYNVLAPK.3|KGLDPYNVLAPK.2|GLDPYNVLAPK.2|EDPNLV...

SEN / CTL

P00568

Adenylate kinase isoenzyme 1

AK1

0.82

0.51

5.55e-8

1.2e-7

nucleoside diphosphate phosphorylation,ADP biosynt...

adenylate kinase activity,nucleoside diphosphate k...

outer dense fiber,cytoplasm,cytosol,plasma membran...

21

16

23

IIFVVGGPGSGK.2|GQLVPLETVLDMLR.3|GQLVPLETVLDMLR.2|G...

SEN / CTL

P12268

Inosine-5'-monophosphate dehydrogenase 2

IMPDH2

0.81

0.34

0.00000215

0.0000033

GMP biosynthetic process,GTP biosynthetic process,...

nucleotide binding,DNA binding,RNA binding,IMP deh...

nucleus,cytoplasm,peroxisomal membrane,cytosol,mem...

12

39

77

NLIDAGVDALR.2|GKLPIVNEDDELVAIIAR.3|GKLPIVNEDDELVAI...

SEN / CTL

Q9NP97

Dynein light chain roadblock-type 1

DYNLRB1

0.81

0.19

0.0000045

0.0000063

transport,microtubule-based movement,visual behavi...

microtubule motor activity,dynein intermediate cha...

cytoplasm,centrosome,cytoplasmic dynein complex,mi...

9

6

12

STVRDIDPQNDLTFLR.3|DIDPQNDLTFLR.2|DIDPQNDLTFLR.3|G...

SEN / CTL

P33176

Kinesin-1 heavy chain

KIF5B

0.81

0.8

0.00226

0.00154

microtubule-based movement,cytoplasm organization,...

microtubule motor activity,protein binding,ATP bin...

cytoplasm,microtubule organizing center,kinesin co...

12

140

283

GLEETVAK.2|LYLVDLAGSEK.2|FQGEDTVVIASKPYAFDR.3|FQGE...

SEN / CTL

O43639

P16333

Cytoplasmic protein NCK2;Cytoplasmic protein NCK1

NCK2

NCK1

0.81

0.29

0.0572

0.0226

immunological synapse formation,actin filament org...

SH3/SH2 adaptor activity,ARF guanyl-nucleotide exc...

cytoplasm,endoplasmic reticulum,trans-Golgi networ...

3

1

1

LWLLDDSK.2

SEN / CTL

P61247

40S ribosomal protein S3a

RPS3A

0.8

0.46

0.00000392

0.00000563

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,fo...

15

30

55

LFC[CAM]VGFTK.2|ADGYEPPVQESV.2|LIPDSIGKDIEK.3|LIPD...

SEN / CTL

P35232

Prohibitin

PHB

0.8

0.74

0.00000902

0.0000118

negative regulation of transcription from RNA poly...

RNA polymerase II transcription factor activity, s...

nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch...

30

36

61

FDAGELITQR.2|DLQNVNITLR.2|VLPSITTEILK.2|VLPSITTEIL...

SEN / CTL

Q96FQ6

Protein S100-A16

S100A16

0.8

0.65

0.000447

0.000376

response to calcium ion

calcium ion binding,protein binding,protein homodi...

nucleolus,cytoplasm,cytosol,plasma membrane,extrac...

12

8

13

AVIVLVENFYK.2|AVIVLVENFYK.3|ISFDEYWTLIGGITGPIAK.3|...

SEN / CTL

Q99829

Copine-1

CPNE1

0.8

0.27

0.00212

0.00145

transcription, DNA-templated,regulation of transcr...

phosphatidylserine binding,endopeptidase activity,...

nucleus,cytoplasm,cytosol,plasma membrane,membrane...

6

23

37

SDPFLEFFR.2|EALAQTVLAEVPTQLVSYFR.3|EALAQTVLAEVPTQL...

SEN / CTL

Q9Y490

Talin-1

TLN1

0.79

0.65

5.75e-26

9.71e-25

platelet degranulation,movement of cell or subcell...

integrin binding,structural constituent of cytoske...

ruffle,extracellular region,cytoplasm,microtubule ...

225

186

355

GLAGAVSELLR.2|AVAEQIPLLVQGVR.2|AVAEQIPLLVQGVR.3|AV...

SEN / CTL

Q9Y6N5

Sulfide:quinone oxidoreductase, mitochondrial

SQRDL

0.79

0.67

2.71e-8

6.21e-8

sulfide oxidation, using sulfide:quinone oxidoredu...

quinone binding,sulfide:quinone oxidoreductase act...

mitochondrial inner membrane

30

39

63

YADALQEIIQER.2|TAAAVAAQSGILDR.2|TAAAVAAQSGILDR.3|H...

SEN / CTL

P62701

40S ribosomal protein S4, X isoform

RPS4X

0.79

0.55

0.000128

0.000126

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,protein binding...

nucleoplasm,cytosol,ribosome,polysome,focal adhesi...

12

30

47

LSNIFVIGK.2|LREC[CAM]LPLIIFLR.3|LREC[CAM]LPLIIFLR....

SEN / CTL

P67809

Nuclease-sensitive element-binding protein 1

YBX1

0.79

0.39

0.00161

0.00114

negative regulation of transcription from RNA poly...

RNA polymerase II core promoter proximal region se...

nucleus,nucleoplasm,U12-type spliceosomal complex,...

6

29

58

RPQYSNPPVQGEVMEGADNQGAGEQGRPVR.4|RPQYSNPPVQGEVM[Ox...

SEN / CTL

O00264

Membrane-associated progesterone receptor component 1

PGRMC1

0.79

0.63

0.00391

0.00244

steroid binding,heme binding

nucleolus,endoplasmic reticulum,endoplasmic reticu...

9

19

22

FYGPEGPYGVFAGR.2|IVRGDQPAASGDSDDDEPPPLPR.3|ILMAING...

SEN / CTL

Q16891

MICOS complex subunit MIC60

IMMT

0.78

0.77

0.00914

0.00497

biological_process,cristae formation,mitochondrial...

protein binding,poly(A) RNA binding

mitochondrion,mitochondrial inner membrane,membran...

12

79

130

VVSQYHELVVQAR.3|VVSQYHELVVQAR.2|LRGIEQAVQSHAVAEEEA...

SEN / CTL

P35080

Profilin-2

PFN2

0.78

0.35

0.0919

0.0334

negative regulation of epithelial cell migration,a...

adenyl-nucleotide exchange factor activity,actin m...

cytoplasm,cytoskeleton,terminal bouton,extracellul...

3

8

11

DREGFFTNGLTLGAK.3|DREGFFTNGLTLGAK.2|VLVFVM[Oxi]GK....

SEN / CTL

Q99536

Synaptic vesicle membrane protein VAT-1 homolog

VAT1

0.77

0.56

1.62e-8

4.04e-8

negative regulation of mitochondrial fusion,oxidat...

zinc ion binding,oxidoreductase activity

mitochondrial outer membrane,integral component of...

33

28

53

TWWNQFSVTALQLLQANR.3|LQSRPAAPPAPGPGQLTLR.3|LQSRPAA...

SEN / CTL

Q9BUT1

3-hydroxybutyrate dehydrogenase type 2

BDH2

0.77

0.37

0.000239

0.000218

fatty acid beta-oxidation,siderophore biosynthetic...

3-hydroxybutyrate dehydrogenase activity,oxidoredu...

cytoplasm,cytosol,extracellular exosome,mitochondr...

9

13

19

SVAADFIQQGIR.2|VIILTAAAQGIGQAAALAFAR.3|VIILTAAAQGI...

SEN / CTL

P68402

Platelet-activating factor acetylhydrolase IB subunit beta

PAFAH1B2

0.77

0.32

0.000712

0.000567

lipid metabolic process,spermatogenesis,brain deve...

1-alkyl-2-acetylglycerophosphocholine esterase act...

nucleolus,cytoplasm,cytosol,plasma membrane,extrac...

9

10

21

IIVLGLLPR.2|ELFSPLHALNFGIGGDTTR.3|ELFSPLHALNFGIGGD...

SEN / CTL

O60701

UDP-glucose 6-dehydrogenase

UGDH

0.77

0.8

0.00232

0.00157

gastrulation with mouth forming second,carbohydrat...

UDP-glucose 6-dehydrogenase activity,electron carr...

nucleus,nucleoplasm,cytosol,extracellular exosome

15

46

76

ILTTNTWSSELSK.2|VTVVDVNESR.2|IAILGFAFK.2|LAANAFLAQ...

SEN / CTL

P62913

60S ribosomal protein L11

RPL11

0.77

0.33

0.00279

0.00183

ribosomal large subunit assembly,nuclear-transcrib...

RNA binding,structural constituent of ribosome,pro...

nucleoplasm,nucleolus,cytoplasm,cytosol,membrane,c...

6

20

23

VLEQLTGQTPVFSK.2|VLEQLTGQTPVFSK.3|AEEILEK.2|HRISKE...

SEN / CTL

P23368

NAD-dependent malic enzyme, mitochondrial

ME2

0.77

1.16

0.0542

0.0215

malate metabolic process,oxidation-reduction proce...

malic enzyme activity,malate dehydrogenase (decarb...

mitochondrion,mitochondrial matrix,intracellular m...

12

35

55

VFTPGQGNNVYIFPGVALAVILC[CAM]NTR.3|LC[CAM]LYTAC[CAM...

SEN / CTL

O60749

Sorting nexin-2

SNX2

0.76

0.09

0.00304

0.00197

intracellular protein transport,endocytosis,vesicl...

epidermal growth factor receptor binding,insulin r...

cytoplasm,cytosol,cell-cell adherens junction,endo...

3

24

36

AVNTQALSGAGILR.2|AVNTQALSGAGILR.3|TVKHPTLLQDPDLR.4...

SEN / CTL

P49411

Elongation factor Tu, mitochondrial

TUFM

0.76

1.63

0.00817

0.00455

translational elongation,response to ethanol,mitoc...

translation elongation factor activity,GTPase acti...

mitochondrion,membrane,mitochondrial nucleoid,extr...

30

46

87

GITINAAHVEYSTAAR.3|GITINAAHVEYSTAAR.2|GITINAAHVEYS...

SEN / CTL

Q96HY6

DDRGK domain-containing protein 1

DDRGK1

0.76

0.39

0.00955

0.00512

regulation of intracellular estrogen receptor sign...

protein binding,ubiquitin-like protein ligase bind...

endoplasmic reticulum,endoplasmic reticulum membra...

6

12

18

VVLLEDLASQVGLR.2|VVLLEDLASQVGLR.3|FIYITPEELAAVANFI...

SEN / CTL

O60763

General vesicular transport factor p115

USO1

0.76

0.61

0.0234

0.0108

intracellular protein transport,ER to Golgi vesicl...

protein transporter activity,poly(A) RNA binding,c...

Golgi membrane,nucleolus,endoplasmic reticulum,Gol...

9

49

72

VTNLHLMLQLVR.3|VTNLHLMLQLVR.2|EVIRNDGVLLLQALTR.3|E...

SEN / CTL

Q92743

Serine protease HTRA1

HTRA1

0.76

0.67

0.119

0.041

regulation of cell growth,placenta development,pro...

serine-type endopeptidase activity,insulin-like gr...

extracellular region,extracellular space,cytosol,p...

6

2

2

IAPAVVHIELFR.3|SSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQR.3

SEN / CTL

Q96SI9

Spermatid perinuclear RNA-binding protein

STRBP

0.76

0.52

0.141

0.0465

multicellular organism development,spermatid devel...

DNA binding,double-stranded RNA binding,single-str...

nucleus,cytoplasm,microtubule cytoskeleton

3

24

25

SC[CAM]VIVLR.2|EDITHSAQHALR.3|RPFEDGLGDDKDPNKK.4|R...

SEN / CTL

P04004

Vitronectin

VTN

0.76

1.51

0.145

0.0477

receptor-mediated endocytosis,immune response,cell...

scavenger receptor activity,integrin binding,prote...

extracellular region,basement membrane,extracellul...

12

22

33

LIRDVWGIEGPIDAAFTR.3|DVWGIEGPIDAAFTR.2|DVWGIEGPIDA...

SEN / CTL

Q9BR76

Coronin-1B

CORO1B

0.75

0.61

0.00000154

0.00000247

cell migration,actin cytoskeleton organization,ruf...

protein binding,identical protein binding,actin fi...

stress fiber,cytoplasm,cytosol,actin filament,plas...

21

27

44

DADPILISLR.2|AGEAGKLEEVMQELR.3|AGEAGKLEEVMQELR.2|V...

SEN / CTL

Q6PCE3

Glucose 1,6-bisphosphate synthase

PGM2L1

0.75

0.18

0.000287

0.000255

glucose metabolic process,phosphorylation

intramolecular transferase activity, phosphotransf...

cytosol

6

15

17

DVPVYLFSR.2|FC[CAM]GTFAILHVR.3|GFVVGYDTR.2|VFGFKPP...

SEN / CTL

Q13418

Integrin-linked protein kinase

ILK

0.75

0.8

0.00387

0.00242

branching involved in ureteric bud morphogenesis,p...

protein serine/threonine kinase activity,signal tr...

stress fiber,nucleoplasm,cytoplasm,cytosol,plasma ...

12

21

36

FDMIVPILEK.2|FDM[Oxi]IVPILEK.2|SAVVEMLIMR.2|GMAFLH...

SEN / CTL

P30042

ES1 protein homolog, mitochondrial

C21orf33

0.75

0.41

0.00763

0.00427

mitochondrion

6

22

42

VLKEFHQAGKPIGLC[CAM]C[CAM]IAPVLAAK.4|VLKEFHQAGKPIG...

SEN / CTL

P59190

Ras-related protein Rab-15

RAB15

0.75

0.45

0.0601

0.0235

small GTPase mediated signal transduction,protein ...

protein binding,GTP binding

cytoplasm,plasma membrane,endosome membrane,perinu...

3

1

1

IQIWDTAGQER.2

SEN / CTL

P68366

Tubulin alpha-4A chain

TUBA4A

0.74

0.63

6.77e-13

3.52e-12

G2/M transition of mitotic cell cycle,platelet deg...

GTPase activity,structural constituent of cytoskel...

extracellular region,cytosol,microtubule,extracell...

42

16

28

LISQIVSSITASLR.2|LISQIVSSITASLR.3|AVFVDLEPTVIDEIR....

SEN / CTL

P52943

Cysteine-rich protein 2

CRIP2

0.74

0.62

1.15e-7

2.29e-7

positive regulation of cell proliferation,hemopoie...

zinc ion binding

cell cortex,extracellular matrix

21

12

18

ASSVTTFTGEPNTC[CAM]PR.2|GVNIGGAGSYIYEKPLAEGPQVTGPI...

SEN / CTL

P62826

GTP-binding nuclear protein Ran

RAN

0.74

0.41

0.00000596

0.00000812

ribosomal large subunit export from nucleus,riboso...

chromatin binding,transcription coactivator activi...

nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla...

15

19

35

GPIKFNVWDTAGQEK.3|GPIKFNVWDTAGQEK.2|LVLVGDGGTGK.2|...

SEN / CTL

P35998

26S protease regulatory subunit 7

PSMC2

0.74

0.56

0.000227

0.000208

MAPK cascade,protein polyubiquitination,osteoblast...

protein binding,ATP binding,ATPase activity,TBP-cl...

proteasome complex,cytoplasmic mRNA processing bod...

15

40

63

ALDEGDIALLK.2|KIEFSLPDLEGR.3|KIEFSLPDLEGR.2|SVC[CA...

SEN / CTL

P04350

Tubulin beta-4A chain

TUBB4A

0.73

0.39

0.000294

0.00026

G2/M transition of mitotic cell cycle,cytoskeleton...

GTPase activity,structural constituent of cytoskel...

nucleus,cytosol,microtubule,cilium,internode regio...

12

4

7

M[Oxi]AATFIGNSTAIQELFKR.3|MAATFIGNSTAIQELFKR.3|M[O...

SEN / CTL

Q8N1G4

Leucine-rich repeat-containing protein 47

LRRC47

0.73

0.62

0.00986

0.00526

phenylalanyl-tRNA aminoacylation

poly(A) RNA binding,phenylalanine-tRNA ligase acti...

phenylalanine-tRNA ligase complex

6

28

40

SILEYLR.2|DVRPYIVGAVVR.3|DVRPYIVGAVVR.2|AAGGQLPPR....

SEN / CTL

P68032

Actin, alpha cardiac muscle 1

ACTC1

0.72

0.62

1.2e-16

8.78e-16

apoptotic process,positive regulation of gene expr...

ATP binding,ATPase activity,myosin binding

extracellular space,cytoplasm,cytosol,actin filame...

81

12

42

EKLC[CAM]YVALDFENEM[Oxi]ATAASSSSLEK.3|MTQIMFETFNVP...

SEN / CTL

Q9UGI8

Testin

TES

0.72

0.66

0.0000286

0.0000324

negative regulation of cell proliferation,cell-cel...

protein binding,zinc ion binding,poly(A) RNA bindi...

nucleus,cytoplasm,plasma membrane,cell-cell adhere...

18

33

47

C[CAM]EGFELHFWR.3|LSMKEGDPAIYAER.3|KNVSINTVTYEWAPP...

SEN / CTL

P04632

Calpain small subunit 1

CAPNS1

0.72

1.04

0.000693

0.000557

proteolysis,positive regulation of cell proliferat...

calcium-dependent cysteine-type endopeptidase acti...

cytosol,plasma membrane,membrane,extracellular exo...

30

18

39

ILGGVISAISEAAAQYNPEPPPPR.4|ILGGVISAISEAAAQYNPEPPPP...

SEN / CTL

P62304

Small nuclear ribonucleoprotein E

SNRPE

0.72

0.47

0.136

0.0453

spliceosomal complex assembly,spliceosomal snRNP a...

RNA binding,protein binding

nucleus,nucleoplasm,spliceosomal complex,U5 snRNP,...

3

5

11

VMVQPINLIFR.2|VMVQPINLIFR.3|VM[Oxi]VQPINLIFR.3|VM[...

SEN / CTL

O75955

Flotillin-1

FLOT1

0.71

0.28

3.77e-7

6.84e-7

membrane raft assembly,positive regulation of cyto...

protease binding,protein binding,ionotropic glutam...

uropod,lysosomal membrane,endosome,early endosome,...

15

31

45

AAYDIEVNTR.2|MRGEAEAFAIGAR.3|MRGEAEAFAIGAR.2|HGVPI...

SEN / CTL

Q9NZM1

Myoferlin

MYOF

0.71

0.86

0.0000493

0.0000526

plasma membrane repair,muscle contraction,blood ci...

protein binding,phospholipid binding

nuclear envelope,plasma membrane,caveola,integral ...

30

117

143

WVTFLLK.2|FGSHC[CAM]GIPEEYC[CAM]VSGVNTWR.3|ANVTVLD...

SEN / CTL

P49755

Transmembrane emp24 domain-containing protein 10

TMED10

0.71

0.37

0.00242

0.00162

kidney development,intracellular protein transport...

protein binding,syntaxin binding,protein complex b...

Golgi membrane,endoplasmic reticulum,endoplasmic r...

6

11

23

RLEDLSESIVNDFAYMK.3|RLEDLSESIVNDFAYM[Oxi]K.3|RLEDL...

SEN / CTL

Q15746

Myosin light chain kinase, smooth muscle

MYLK

0.71

0.98

0.0415

0.0171

protein phosphorylation,muscle contraction,smooth ...

actin binding,myosin light chain kinase activity,c...

stress fiber,cytoplasm,cytosol,lamellipodium,cleav...

12

57

67

LIDFGLAR.2|LSSMAMISGLSGR.2|TSSSITLQAAR.2|TIRDLEVVE...

SEN / CTL

Q562R1

Beta-actin-like protein 2

ACTBL2

0.7

0.36

7.98e-10

2.48e-9

biological_process

molecular_function,ATP binding

extracellular space,cytoplasm,cytoskeleton,extrace...

24

9

17

VAPDEHPILLTEAPLNPK.3|VAPDEHPILLTEAPLNPK.4|KDLYANTV...

SEN / CTL

P51665

26S proteasome non-ATPase regulatory subunit 7

PSMD7

0.7

0.38

0.000209

0.000195

MAPK cascade,protein polyubiquitination,stimulator...

protein binding,protein homodimerization activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

12

15

25

LHKNDIAINELMK.3|VVGVLLGSWQK.2|VVVHPLVLLSVVDHFNR.4|...

SEN / CTL

P20340

Q9NRW1

Ras-related protein Rab-6A;Ras-related protein Rab-6B

RAB6A

RAB6B

0.7

0.58

0.000798

0.000626

protein targeting to Golgi,retrograde vesicle-medi...

GTPase activity,protein binding,GTP binding,protei...

Golgi membrane,endoplasmic reticulum membrane,Golg...

9

3

3

LQLWDTAGQER.2|LVFLGEQSVGK.2|FKLVFLGEQSVGK.3

SEN / CTL

O43399

Tumor protein D54

TPD52L2

0.69

0.35

6.5e-8

1.36e-7

poly(A) RNA binding

18

18

28

LGLSTLGELKQNLSR.3|LGLSTLGELK.2|TSAALSTVGSAISR.2|TS...

SEN / CTL

P21912

Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SDHB

0.69

0.27

0.00167

0.00119

tricarboxylic acid cycle,succinate metabolic proce...

succinate dehydrogenase activity,protein binding,s...

nucleoplasm,mitochondrion,mitochondrial inner memb...

6

18

26

LQDPFSLYR.2|C[CAM]GPMVLDALIK.2|C[CAM]GPM[Oxi]VLDAL...

SEN / CTL

O76061

Stanniocalcin-2

STC2

0.69

1.41

0.0456

0.0186

cellular calcium ion homeostasis,response to oxida...

hormone activity,enzyme binding,heme binding,prote...

extracellular space,endoplasmic reticulum,Golgi ap...

6

2

2

HDLC[CAM]AAAQENTR.2|VIVEMIHFK.2

SEN / CTL

P50479

PDZ and LIM domain protein 4

PDLIM4

0.68

0.56

6.65e-8

1.38e-7

protein binding,zinc ion binding

27

14

19

VKPPEGYDVVAVYPNAK.3|GYFFLDER.2|DFSAPLTISR.2|AALAAL...

SEN / CTL

Q16555

Dihydropyrimidinase-related protein 2

DPYSL2

0.68

0.84

0.0000198

0.0000233

response to amphetamine,nucleobase-containing comp...

dihydropyrimidinase activity,protein binding,micro...

mitochondrion,cytosol,dendrite,growth cone,neurona...

45

34

71

QIGENLIVPGGVK.2|SSAEVIAQAR.2|IVLEDGTLHVTEGSGR.3|IV...

SEN / CTL

Q13404

Ubiquitin-conjugating enzyme E2 variant 1

UBE2V1

0.68

0.64

0.000973

0.00075

protein polyubiquitination,stimulatory C-type lect...

protein binding,ubiquitin protein ligase binding,u...

ubiquitin ligase complex,nucleus,cytoplasm,cytosol...

9

10

16

WTGMIIGPPR.2|WTGM[Oxi]IIGPPR.2|VVLQELR.2|IEC[CAM]G...

SEN / CTL

Q15435

Protein phosphatase 1 regulatory subunit 7

PPP1R7

0.68

0.22

0.0029

0.0019

chromosome segregation,biological_process,positive...

protein phosphatase type 1 regulator activity,enzy...

nucleus,chromosome,cytoplasm,extracellular exosome

6

25

37

IEGLQNLVNLR.2|AIENIDTLTNLESLFLGK.3|AIENIDTLTNLESLF...

SEN / CTL

Q00610

Clathrin heavy chain 1

CLTC

0.67

0.7

2.35e-28

5.29e-27

osteoblast differentiation,intracellular protein t...

double-stranded RNA binding,structural molecule ac...

spindle,cytosol,plasma membrane,focal adhesion,mem...

234

154

302

LLLPWLEAR.2|SVDPTLALSVYLR.2|VANVELYYR.2|QKWLLLTGIS...

SEN / CTL

P22314

Ubiquitin-like modifier-activating enzyme 1

UBA1

0.67

0.62

3.19e-15

1.87e-14

cellular response to DNA damage stimulus,protein u...

ubiquitin activating enzyme activity,ubiquitin-pro...

nucleus,cytoplasm,mitochondrion,cytosol,extracellu...

111

67

128

LQTSSVLVSGLR.2|LAGTQPLEVLEAVQR.3|LAGTQPLEVLEAVQR.2...

SEN / CTL

O75367

Core histone macro-H2A.1

H2AFY

0.67

0.35

1.08e-7

2.16e-7

negative regulation of transcription from RNA poly...

rDNA binding,RNA polymerase II regulatory region s...

nuclear chromosome,nuclear chromosome, telomeric r...

18

23

38

HILLAVANDEELNQLLK.3|HILLAVANDEELNQLLK.2|KGGKEFVEAV...

SEN / CTL

P0DMV8

P0DMV9

Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B

HSPA1A

HSPA1B

0.67

0.9

3.39e-7

6.32e-7

positive regulation of gene expression,regulation ...

virus receptor activity,G-protein coupled receptor...

nucleoplasm,cytoplasm,mitochondrion,centriole,cyto...

90

60

132

TTPSYVAFTDTER.2|TTPSYVAFTDTER.3|IINEPTAAAIAYGLDR.3...

SEN / CTL

P27816

Microtubule-associated protein 4

MAP4

0.67

0.76

8.96e-7

0.00000152

mitotic spindle organization,neuron projection dev...

structural molecule activity,microtubule binding,p...

cytoplasm,microtubule,microtubule associated compl...

36

68

96

NVVLPTETEVAPAKDVTLLKETER.4|ATPMPSRPSTTPFIDKKPTSAKP...

SEN / CTL

O94979

Protein transport protein Sec31A

SEC31A

0.67

1.05

0.00148

0.00107

antigen processing and presentation of peptide ant...

protein binding,calcium-dependent protein binding

Golgi membrane,cytoplasm,endoplasmic reticulum,end...

18

51

78

NPAVLSAASFDGR.2|TTFEDLIQR.2|NVWSFLK.2|RPVGASFSFGGK...

SEN / CTL

P23246

Splicing factor, proline- and glutamine-rich

SFPQ

0.67

0.88

0.0082

0.00456

negative regulation of transcription from RNA poly...

nucleotide binding,transcription regulatory region...

chromatin,nucleus,nucleoplasm,cytoplasm,nuclear ma...

12

49

90

NLSPYVSNELLEEAFSQFGPIER.3|NLSPYVSNELLEEAFSQFGPIER....

SEN / CTL

P36578

60S ribosomal protein L4

RPL4

0.67

0.42

0.00882

0.00484

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion...

6

42

74

NIPGITLLNVSK.2|NIPGITLLNVSK.3|FC[CAM]IWTESAFR.2|KP...

SEN / CTL

P50914

60S ribosomal protein L14

RPL14

0.67

0.35

0.0132

0.00668

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pol...

cytoplasm,cytosol,cell-cell adherens junction,memb...

6

10

14

LVAIVDVIDQNR.2|LVAIVDVIDQNR.3|C[CAM]MQLTDFILK.2|C[...

SEN / CTL

P22087

rRNA 2'-O-methyltransferase fibrillarin

FBL

0.67

0.77

0.0789

0.0295

box C/D snoRNA 3'-end processing,osteoblast differ...

TFIID-class transcription factor binding,RNA bindi...

dense fibrillar component,granular component,nucle...

6

26

47

IVALNAHTFLR.3|IVALNAHTFLR.2|VSISEGDDKIEYR.3|VSISEG...

SEN / CTL

P25705

ATP synthase subunit alpha, mitochondrial

ATP5A1

0.66

0.68

2.17e-15

1.36e-14

negative regulation of endothelial cell proliferat...

protein binding,ATP binding,transmembrane transpor...

mitochondrion,mitochondrial inner membrane,mitocho...

87

55

105

TGAIVDVPVGEELLGR.2|TGAIVDVPVGEELLGR.3|EAYPGDVFYLHS...

SEN / CTL

Q14254

Flotillin-2

FLOT2

0.66

0.38

0.00177

0.00125

membrane raft assembly,cell adhesion,chemical syna...

protease binding,protein binding,ionotropic glutam...

uropod,acrosomal membrane,endosome,plasma membrane...

12

26

30

SAFSEEVNIK.2|TAEAQLAYELQGAR.2|MALVLEALPQIAAK.2|M[O...

SEN / CTL

Q02543

60S ribosomal protein L18a

RPL18A

0.66

0.67

0.0336

0.0144

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

cytosol,membrane,cytosolic large ribosomal subunit

6

17

25

EYRDLTTAGAVTQC[CAM]YR.3|DLTTAGAVTQC[CAM]YR.2|DLTTA...

SEN / CTL

Q9BZQ8

Protein Niban

FAM129A

0.65

0.41

0.000148

0.000143

negative regulation of protein phosphorylation,pos...

molecular_function,protein binding

cytoplasm,plasma membrane,membrane,extracellular e...

12

25

36

FSALLSDC[CAM]VR.2|EFPVYLWQPFFR.2|EFPVYLWQPFFR.3|QY...

SEN / CTL

P21291

Cysteine and glycine-rich protein 1

CSRP1

0.65

0.96

0.000216

0.0002

platelet aggregation

zinc ion binding,poly(A) RNA binding

nucleus,focal adhesion,extracellular exosome

21

16

31

NLDSTTVAVHGEEIYC[CAM]K.3|NLDSTTVAVHGEEIYC[CAM]K.2|...

SEN / CTL

O14950

P19105

Myosin regulatory light chain 12B;Myosin regulatory light chain 12A

MYL12B

MYL12A

0.65

0.46

0.038

0.0158

muscle contraction,regulation of cell shape;muscle...

calcium ion binding,myosin heavy chain binding;cal...

stress fiber,cytosol,brush border,myosin II comple...

27

18

38

GNFNYIEFTR.2|LNGTDPEDVIR.2|NAFAC[CAM]FDEEATGTIQEDY...

SEN / CTL

Q15149

Plectin

PLEC

0.64

0.91

9.66e-29

2.37e-27

hemidesmosome assembly,cell-cell adhesion

actin binding,protein binding,structural constitue...

cytoplasm,cytosol,plasma membrane,brush border,cel...

309

489

728

WQAVLAQTDVR.2|SQVEEELFSVR.2|VTLVQTLEIQR.2|IISLETYN...

SEN / CTL

P78417

Glutathione S-transferase omega-1

GSTO1

0.64

0.73

0.0000255

0.0000293

glutathione metabolic process,regulation of releas...

glutathione transferase activity,oxidoreductase ac...

cytoplasm,cytosol,extracellular exosome

18

28

41

VPSLVGSFIR.2|MILELFSK.2|M[Oxi]ILELFSK.2|GIRHEVININ...

SEN / CTL

Q9H082

Ras-related protein Rab-33B

RAB33B

0.64

0.46

0.0129

0.00659

protein targeting to Golgi,intra-Golgi vesicle-med...

GTPase activity,protein binding,GTP binding

Golgi membrane,Golgi apparatus,Golgi lumen,extrace...

6

4

5

IQLWDTAGQER.2|IKIQLWDTAGQER.3|IKIQLWDTAGQER.2|QHLL...

SEN / CTL

P31949

Protein S100-A11

S100A11

0.64

0.97

0.0172

0.00828

signal transduction,negative regulation of DNA rep...

calcium ion binding,protein homodimerization activ...

ruffle,extracellular space,nucleus,cytoplasm,cell-...

33

8

13

C[CAM]IESLIAVFQK.2|C[CAM]IESLIAVFQK.3|ISSPTETERC[C...

SEN / CTL

P25325

3-mercaptopyruvate sulfurtransferase

MPST

0.64

0.43

0.133

0.0446

kidney development,liver development,cyanate catab...

thiosulfate sulfurtransferase activity,3-mercaptop...

mitochondrion,cytosol,cell junction,neuron project...

3

17

26

ALVSAQWVAEALR.2|ALVSAQWVAEALR.3|ARPEDVISEGR.3|ARPE...

SEN / CTL

O15143

Actin-related protein 2/3 complex subunit 1B

ARPC1B

0.63

0.3

1.54e-11

6.1e-11

movement of cell or subcellular component,Arp2/3 c...

structural constituent of cytoskeleton,actin filam...

cytosol,Arp2/3 protein complex,focal adhesion,acti...

30

22

41

TWKPTLVILR.3|VHELKEHNGQVTGIDWAPESNR.4|VHELKEHNGQVT...

SEN / CTL

P60981

Destrin

DSTN

0.63

0.67

0.0000827

0.0000836

actin polymerization or depolymerization,actin fil...

protein binding,actin filament binding

actin cytoskeleton,cortical actin cytoskeleton,ext...

21

22

34

YALYDASFETK.2|AVIFC[CAM]LSADKK.3|AVIFC[CAM]LSADKK....

SEN / CTL

Q16774

Guanylate kinase

GUK1

0.63

0.33

0.00347

0.00222

purine nucleotide metabolic process,dGDP biosynthe...

guanylate kinase activity,ATP binding

cytosol

6

15

23

IC[CAM]VLDVDLQGVR.2|VAVQAVQAMNR.2|VAVQAVQAM[Oxi]NR...

SEN / CTL

P46777

60S ribosomal protein L5

RPL5

0.62

0.46

9.81e-7

0.00000166

ribosomal large subunit assembly,nuclear-transcrib...

RNA binding,structural constituent of ribosome,pro...

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion...

21

27

56

VGLTNYAAAYC[CAM]TGLLLAR.3|VGLTNYAAAYC[CAM]TGLLLAR....

SEN / CTL

Q16851

UTP--glucose-1-phosphate uridylyltransferase

UGP2

0.62

0.49

0.00000427

0.00000606

glycogen biosynthetic process,UDP-glucose metaboli...

UTP:glucose-1-phosphate uridylyltransferase activi...

nucleus,cytosol,extracellular exosome

24

37

59

GLPDNISSVLNK.2|EFPTVPLVK.2|SFENSLGINVPR.2|SFENSLGI...

SEN / CTL

Q9UPN3

Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5

MACF1

0.62

0.97

0.000347

0.000303

regulation of epithelial cell migration,Wnt signal...

actin binding,calcium ion binding,protein binding,...

cytoplasm,Golgi apparatus,cytoskeleton,microtubule...

18

251

298

ALLELVPWR.2|LVLDTVNEVSR.2|VIAQLEIR.2|C[CAM]DSFLHQS...

SEN / CTL

A5A3E0

POTE ankyrin domain family member F

POTEF

0.62

0.84

0.00182

0.00128

retina homeostasis

extracellular space,cell cortex,extracellular exos...

15

4

5

VAPEEHPVLLTEATLNPK.3|C[CAM]PEALFQPC[CAM]FLGMESC[CA...

SEN / CTL

P10253

Lysosomal alpha-glucosidase

GAA

0.62

1.07

0.00201

0.00139

maltose metabolic process,regulation of the force ...

alpha-1,4-glucosidase activity,oligo-1,6-glucosida...

lysosome,lysosomal membrane,membrane,lysosomal lum...

18

34

49

GAYTQVIFLAR.2|QQPMALAVALTK.2|WTQLGAFYPFMR.2|WTQLGA...

SEN / CTL

O75396

Vesicle-trafficking protein SEC22b

SEC22B

0.62

0.53

0.0151

0.00746

ER to Golgi vesicle-mediated transport,retrograde ...

SNARE binding,SNAP receptor activity,protein bindi...

Golgi membrane,endoplasmic reticulum membrane,endo...

9

15

21

VLLTMIAR.2|VLLTM[Oxi]IAR.2|NLGSINTELQDVQR.2|IMVANI...

SEN / CTL

Q9BUI4

DNA-directed RNA polymerase III subunit RPC3

POLR3C

0.62

0.2

0.0304

0.0133

regulation of transcription from RNA polymerase II...

DNA binding,DNA-directed RNA polymerase activity,p...

nucleus,nucleoplasm,DNA-directed RNA polymerase II...

3

15

17

SLPVGYNISK.2|VIAHDTGTSLDQVK.3|VIAHDTGTSLDQVK.2|SGD...

SEN / CTL

Q13492

Phosphatidylinositol-binding clathrin assembly protein

PICALM

0.62

0.41

0.127

0.043

protein complex assembly,receptor-mediated endocyt...

protein binding,1-phosphatidylinositol binding,cla...

nucleus,Golgi apparatus,clathrin-coated pit,cell-c...

3

26

37

ATTLSNAVSSLASTGLSLTK.3|ATTLSNAVSSLASTGLSLTK.2|EKQA...

SEN / CTL

Q14914

Prostaglandin reductase 1

PTGR1

0.61

0.25

7.18e-12

3.08e-11

leukotriene metabolic process,prostaglandin metabo...

zinc ion binding,2-alkenal reductase [NAD(P)] acti...

cytoplasm,extracellular exosome

27

22

35

MEAFVVYR.2|IAIC[CAM]GAISTYNR.2|LGFDVVFNYK.2|HFVGYP...

SEN / CTL

P16152

Carbonyl reductase [NADPH] 1

CBR1

0.61

0.36

9.94e-10

2.98e-9

drug metabolic process,cyclooxygenase pathway,epit...

carbonyl reductase (NADPH) activity,oxidoreductase...

cytosol,extracellular exosome,extracellular vesicl...

30

26

43

LFSGDVVLTAR.2|FHQLDIDDLQSIR.3|FHQLDIDDLQSIR.2|DVC[...

SEN / CTL

P07585

Decorin

DCN

0.61

0.48

1.45e-9

4.21e-9

kidney development,placenta development,negative r...

protein kinase inhibitor activity,protein binding,...

extracellular region,collagen type VI trimer,extra...

42

22

33

NLHALILVNNK.3|NLHALILVNNK.2|VSPGAFTPLVKLER.3|KVTFN...

SEN / CTL

P62136

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

PPP1CA

0.61

0.42

6.01e-7

0.00000105

glycogen metabolic process,regulation of glycogen ...

phosphoprotein phosphatase activity,protein serine...

protein phosphatase type 1 complex,nucleus,nucleop...

24

29

46

IKYPENFFLLR.3|AHQVVEDGYEFFAKR.3|AHQVVEDGYEFFAKR.4|...

SEN / CTL

P35754

Glutaredoxin-1

GLRX

0.61

0.35

9.98e-7

0.00000167

nucleobase-containing small molecule interconversi...

electron carrier activity,glutathione disulfide ox...

nucleus,mitochondrion,cytosol,extracellular exosom...

18

7

11

AQEILSQLPIK.2|RAQEILSQLPIK.3|RAQEILSQLPIK.2|QGLLEF...

SEN / CTL

P62424

60S ribosomal protein L7a

RPL7A

0.61

0.65

0.000181

0.000172

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,nucleolus,cytoplasm,cytosol,cell-cell adhe...

15

31

43

AQLVVIAHDVDPIELVVFLPALC[CAM]R.3|AQLVVIAHDVDPIELVVF...

SEN / CTL

Q9BQE3

Tubulin alpha-1C chain

TUBA1C

0.61

0.23

0.000991

0.000756

cytoskeleton organization,microtubule-based proces...

GTPase activity,structural molecule activity,struc...

nucleus,cytoplasm,microtubule,vesicle

6

3

10

AVC[CAM]MLSNTTAVAEAWAR.3|AVC[CAM]MLSNTTAVAEAWAR.2|...

SEN / CTL

P36957

Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial

DLST

0.61

0.96

0.00125

0.00092

generation of precursor metabolites and energy,tri...

dihydrolipoyllysine-residue succinyltransferase ac...

nucleus,mitochondrial matrix,membrane,myelin sheat...

18

27

40

LGFMSAFVK.2|LGFM[Oxi]SAFVK.2|GLVVPVIR.2|TPAFAESVTE...

SEN / CTL

O43790

P78385

Q14533

Keratin, type II cuticular Hb6;Keratin, type II cuticular Hb3;Keratin, type II cuticular Hb1

KRT86

KRT83

KRT81

0.61

2.27

0.00462

0.00279

;aging,epidermis development,hair cycle;

structural molecule activity,protein binding;struc...

extracellular space,keratin filament,extracellular...

18

6

6

LGLDIEIATYR.2|DVDC[CAM]AYLR.2|ATAENEFVALKK.3|FAAFI...

SEN / CTL

P40121

Macrophage-capping protein

CAPG

0.59

0.8

0.0000674

0.0000703

protein complex assembly,barbed-end actin filament...

actin binding,protein binding,protein domain speci...

nucleus,nucleoplasm,nucleolus,cytoplasm,centriole,...

33

22

39

QAALQVAEGFISR.2|QAALQVAEGFISR.3|VADSSPFALELLISDDC[...

SEN / CTL

P0CG39

POTE ankyrin domain family member J

POTEJ

0.59

0.12

0.0138

0.00687

retina homeostasis

extracellular space,extracellular exosome

3

2

3

LC[CAM]YVALDFEQEMAMVASSSSLEK.3|LC[CAM]YVALDFEQEMAM...

SEN / CTL

Q96BW5

Phosphotriesterase-related protein

PTER

0.59

1.58

0.0454

0.0185

catabolic process,epithelial cell differentiation

molecular_function,zinc ion binding,hydrolase acti...

extracellular exosome

36

18

21

VQTVLGLVEPSKLGR.3|AMSVEQLTDVLMNEILHGADGTSIK.3|ILQE...

SEN / CTL

Q92542

Nicastrin

NCSTN

0.59

0.83

0.0714

0.027

myeloid cell homeostasis,proteolysis,membrane prot...

endopeptidase activity,protein binding

lysosomal membrane,endoplasmic reticulum,Golgi app...

6

10

12

LLYGFLIK.2|ALADVATVLGR.2|APDVTTLPR.2|ADVLFIAPR.2|S...

SEN / CTL

Q09666

Neuroblast differentiation-associated protein AHNAK

AHNAK

0.58

0.75

1.22e-32

4.11e-31

regulation of RNA splicing,protein oligomerization...

protein binding,S100 protein binding,poly(A) RNA b...

nucleus,cytoplasm,lysosomal membrane,cytosol,plasm...

447

433

666

ISMPDLDLNLKGPK.3|ISMPDLDLNLKGPK.2|ISIPDVDLDLKGPK.3...

SEN / CTL

P17987

T-complex protein 1 subunit alpha

TCP1

0.58

0.32

2.56e-10

8.86e-10

protein folding,tubulin complex assembly,binding o...

protein binding,ATP binding,ubiquitin protein liga...

pericentriolar material,acrosomal vesicle,zona pel...

48

42

75

EQLAIAEFAR.2|TSASIILR.2|IAC[CAM]LDFSLQK.2|IC[CAM]D...

SEN / CTL

Q9Y678

Coatomer subunit gamma-1

COPG1

0.58

0.39

0.0000403

0.0000438

intracellular protein transport,ER to Golgi vesicl...

structural molecule activity

Golgi membrane,endoplasmic reticulum membrane,Golg...

15

60

99

TLEEAVGNIVK.2|SIATLAITTLLK.2|SIATLAITTLLK.3|FGAQNE...

SEN / CTL

Q9Y6U3

Adseverin

SCIN

0.58

0.93

0.00386

0.00242

negative regulation of cell proliferation,calcium ...

phosphatidylserine binding,actin binding,calcium i...

cytoplasm,cytoskeleton,brush border,cell cortex,pr...

12

34

43

LYMVSDASGSMR.2|GASQEEEKGAEYVASVLK.3|NTQIQVLPEGGETP...

SEN / CTL

P15289

Arylsulfatase A

ARSA

0.57

0.26

3.6e-8

7.98e-8

glycosphingolipid metabolic process,post-translati...

arylsulfatase activity,cerebroside-sulfatase activ...

lysosome,endoplasmic reticulum lumen,lysosomal lum...

18

9

16

GGLPLEEVTVAEVLAAR.2|GGLPLEEVTVAEVLAAR.3|QSLFFYPSYP...

SEN / CTL

O00154

Cytosolic acyl coenzyme A thioester hydrolase

ACOT7

0.57

0.3

0.00000171

0.00000269

coenzyme A biosynthetic process,long-chain fatty-a...

fatty-acyl-CoA binding,protein binding,palmitoyl-C...

nucleoplasm,cytoplasm,mitochondrion,cytosol,extrac...

18

22

42

ATLWYVPLSLK.2|MIEEAGAIISTR.2|MIEEAGAIISTR.3|M[Oxi]...

SEN / CTL

P54136

Arginine--tRNA ligase, cytoplasmic

RARS

0.57

0.74

0.00000909

0.0000119

tRNA aminoacylation for protein translation,arginy...

tRNA binding,arginine-tRNA ligase activity,protein...

nucleoplasm,cytoplasm,mitochondrion,cytosol,cell-c...

27

61

93

IVFVPGC[CAM]SIPLTIVK.2|IVFVPGC[CAM]SIPLTIVK.3|LMDL...

SEN / CTL

O75348

V-type proton ATPase subunit G 1

ATP6V1G1

0.57

0.36

0.0000729

0.0000751

insulin receptor signaling pathway,regulation of m...

protein binding,hydrogen-exporting ATPase activity...

lysosomal membrane,cytosol,plasma membrane,vacuola...

9

8

13

MTILQTYFR.2|M[Oxi]TILQTYFR.2|QNRDEVLDNLLAFVC[CAM]D...

SEN / CTL

P62140

Serine/threonine-protein phosphatase PP1-beta catalytic subunit

PPP1CB

0.57

0.31

0.0115

0.00598

G2/M transition of mitotic cell cycle,glycogen met...

protein binding,phosphatase activity,myosin phosph...

protein phosphatase type 1 complex,nucleus,nucleop...

6

11

14

IVQMTEAEVR.2|IVQM[Oxi]TEAEVR.2|FLNRHDLDLIC[CAM]R.3...

SEN / CTL

P22307

Non-specific lipid-transfer protein

SCP2

0.57

0.96

0.0341

0.0146

bile acid biosynthetic process,peroxisome organiza...

fatty-acyl-CoA binding,receptor binding,protein bi...

nucleoplasm,cytoplasm,mitochondrion,peroxisome,per...

6

34

57

IGGIFAFK.2|EATWVVDVK.2|DYPDLAEEAGKK.3|DYPDLAEEAGKK...

SEN / CTL

P55084

Trifunctional enzyme subunit beta, mitochondrial

HADHB

0.56

0.41

0.0000173

0.0000207

fatty acid beta-oxidation,cardiolipin acyl-chain r...

3-hydroxyacyl-CoA dehydrogenase activity,acetyl-Co...

mitochondrion,mitochondrial envelope,mitochondrial...

15

41

75

LAAAFAVSR.2|FNNWGGSLSLGHPFGATGC[CAM]R.3|FNNWGGSLSL...

SEN / CTL

P50991

T-complex protein 1 subunit delta

CCT4

0.56

0.79

0.0000697

0.0000723

protein folding,binding of sperm to zona pellucida...

ATP binding,poly(A) RNA binding,unfolded protein b...

zona pellucida receptor complex,nucleoplasm,cytopl...

51

44

86

VIDPATATSVDLRDIK.3|ALIAGGGAPEIELALR.2|ALIAGGGAPEIE...

SEN / CTL

P28482

Mitogen-activated protein kinase 1

MAPK1

0.56

0.28

0.000168

0.000161

MAPK cascade,activation of MAPK activity,MAPK impo...

phosphotyrosine binding,DNA binding,protein serine...

nucleus,nucleoplasm,cytoplasm,mitochondrion,early ...

12

27

46

LKELIFEETAR.3|LKELIFEETAR.2|VADPDHDHTGFLTEYVATR.4|...

SEN / CTL

P36542

ATP synthase subunit gamma, mitochondrial

ATP5C1

0.56

1.45

0.00446

0.0027

oxidative phosphorylation,ATP biosynthetic process...

transmembrane transporter activity,poly(A) RNA bin...

mitochondrial proton-transporting ATP synthase com...

15

21

34

IYGLGSLALYEK.2|IYGLGSLALYEK.3|EVMLVGIGDKIR.3|THSDQ...

SEN / CTL

P22392

Nucleoside diphosphate kinase B

NME2

0.56

0.55

0.0864

0.0319

negative regulation of myeloid leukocyte different...

DNA binding,transcription factor activity, sequenc...

ruffle,nucleus,cytoplasm,cytosol,intermediate fila...

18

19

36

GDFC[CAM]IQVGR.2|SC[CAM]AHDWVYE.2|SAEKEISLWFKPEELV...

SEN / CTL

Q14764

Major vault protein

MVP

0.55

0.75

7.9e-15

4.54e-14

protein transport,negative regulation of signaling...

protein binding,protein kinase binding,protein pho...

nucleus,nuclear pore,cytoplasm,cytoskeleton,membra...

168

78

128

SFFLQPGEQLEQGIQDVYVLSEQQGLLLR.3|SFFLQPGEQLEQGIQDVY...

SEN / CTL

Q7KZF4

Staphylococcal nuclease domain-containing protein 1

SND1

0.55

0.55

0.0000272

0.0000309

osteoblast differentiation,transcription, DNA-temp...

transcription cofactor activity,nuclease activity,...

nucleus,cytoplasm,mitochondrion,cell-cell adherens...

39

71

115

QFLPFLQR.2|ETC[CAM]LITFLLAGIEC[CAM]PR.3|ETC[CAM]LI...

SEN / CTL

P62879

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

GNB2

0.55

0.26

0.00112

0.000834

protein folding,G-protein coupled receptor signali...

GTPase activity,signal transducer activity,calcium...

extracellular space,lysosomal membrane,cytosol,pla...

9

15

25

TFVSGAC[CAM]DASIK.2|KAC[CAM]GDSTLTQITAGLDPVGR.3|KA...

SEN / CTL

P08670

Vimentin

VIM

0.54

1.17

2.04e-19

2.12e-18

movement of cell or subcellular component,positive...

glycoprotein binding,double-stranded RNA binding,s...

cytoplasm,peroxisome,cytosol,cytoskeleton,intermed...

336

92

187

ILLAELEQLKGQGK.3|ILLAELEQLKGQGK.2|ISLPLPNFSSLNLR.2...

SEN / CTL

P51452

Dual specificity protein phosphatase 3

DUSP3

0.54

0.33

0.0000113

0.0000145

inactivation of MAPK activity,in utero embryonic d...

protein tyrosine phosphatase activity,protein tyro...

immunological synapse,nucleus,nucleoplasm,cytoplas...

12

10

15

LGITHVLNAAEGR.3|LGITHVLNAAEGR.2|SPTLVIAYLMMR.2|SPT...

SEN / CTL

P04843

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1

RPN1

0.54

1.21

0.000817

0.00064

cellular protein modification process,protein N-li...

protein binding,poly(A) RNA binding,dolichyl-dipho...

endoplasmic reticulum membrane,rough endoplasmic r...

21

48

79

ALTSEIALLQSR.2|ALTSEIALLQSR.3|FFTVKLPVALDPGAK.3|ID...

SEN / CTL

Q13596

Sorting nexin-1

SNX1

0.54

0.23

0.000969

0.00075

intracellular protein transport,vesicle organizati...

epidermal growth factor receptor binding,insulin r...

cytoplasm,Golgi apparatus,cytosol,cell-cell adhere...

6

24

29

YWEAFLPEAK.2|AVGTQTLSGAGLLK.2|VKVGKEDSSSAEFLEK.4|V...

SEN / CTL

O14936

Peripheral plasma membrane protein CASK

CASK

0.54

0.8

0.00694

0.00396

negative regulation of cell-matrix adhesion,protei...

guanylate kinase activity,protein serine/threonine...

basement membrane,nuclear lamina,nucleolus,cytopla...

9

32

43

ITVYEALNHPWLK.3|ITVYEALNHPWLK.2|IHEQGLIAILDVEPQALK...

SEN / CTL

P63167

Q96FJ2

Dynein light chain 1, cytoplasmic;Dynein light chain 2, cytoplasmic

DYNLL1

DYNLL2

0.54

0.19

0.0255

0.0116

G2/M transition of mitotic cell cycle,transcriptio...

motor activity,protein binding;motor activity,cyto...

kinetochore,nucleus,cytoplasm,mitochondrion,centro...

3

1

2

YNPTWHC[CAM]IVGR.3|YNPTWHC[CAM]IVGR.2

SEN / CTL

P10301

Ras-related protein R-Ras

RRAS

0.54

0.69

0.146

0.0479

leukocyte differentiation,Ras protein signal trans...

GTPase activity,protein binding,GTP binding,GDP bi...

intracellular,plasma membrane,focal adhesion,extra...

9

13

15

LVVVGGGGVGK.2|LNVDEAFEQLVR.2|SEASAFGASHHVAYFEASAK....

SEN / CTL

P30085

UMP-CMP kinase

CMPK1

0.53

0.5

0.00000106

0.00000176

nucleoside diphosphate phosphorylation,'de novo' p...

cytidylate kinase activity,nucleoside diphosphate ...

nucleus,cytoplasm,cytosol,extracellular exosome

30

19

38

FLIDGFPR.2|IVPVEITISLLKR.3|IVPVEITISLLKR.2|SVDEVFD...

SEN / CTL

Q2TAA2

Isoamyl acetate-hydrolyzing esterase 1 homolog

IAH1

0.53

0.27

0.00058

0.000474

lipid catabolic process

hydrolase activity

extracellular exosome

9

7

10

VSSLPLLLPYWR.2|DVAEAKPELSLLGDGDH.3|DVAEAKPELSLLGDG...

SEN / CTL

Q9UEY8

Gamma-adducin

ADD3

0.53

0.47

0.00233

0.00157

cytoskeleton organization,transmembrane transport

actin binding,structural constituent of cytoskelet...

condensed nuclear chromosome,nucleoplasm,cytoplasm...

9

31

36

GLSFSEATASNLVK.2|VGEIEFEGLMR.2|YFDRINENDPEYIRER.4|...

SEN / CTL

Q06323

Proteasome activator complex subunit 1

PSME1

0.52

0.65

0.00000115

0.00000189

MAPK cascade,protein polyubiquitination,stimulator...

endopeptidase activator activity

proteasome complex,nucleoplasm,cytoplasm,cytosol,p...

42

26

39

IEDGNNFGVAVQEK.2|TENLLGSYFPK.2|IVVLLQR.2|QLVHELDEA...

SEN / CTL

Q99439

Calponin-2

CNN2

0.52

0.47

0.00000192

0.00000298

cytoskeleton organization,actomyosin structure org...

actin binding,calmodulin binding,cadherin binding ...

stress fiber,cytoskeleton,cell-cell junction,cell-...

24

17

33

TWIEGLTGLSIGPDFQK.2|TWIEGLTGLSIGPDFQK.3|GLKDGTILC[...

SEN / CTL

A6NGU5

P19440

P36268

Putative gamma-glutamyltranspeptidase 3;Gamma-glutamyltranspeptidase 1;Inactive gamma-glutamyltranspeptidase 2

GGT3P

GGT1

GGT2

0.52

0.48

0.00154

0.00111

proteolysis,glutathione metabolic process,glutathi...

gamma-glutamyltransferase activity,glutathione hyd...

integral component of membrane,anchored component ...

9

3

3

LFQPSIQLAR.2|NIDQAVTAALETR.2|FVDVTEVVR.2

SEN / CTL

Q14344

Guanine nucleotide-binding protein subunit alpha-13

GNA13

0.52

0.26

0.00418

0.00256

patterning of blood vessels,in utero embryonic dev...

GTPase activity,signal transducer activity,protein...

nucleus,cytoplasm,heterotrimeric G-protein complex...

6

19

25

ILLLGAGESGK.2|VFLQYLPAIR.2|IIHGQDFDQR.3|IIHGQDFDQR...

SEN / CTL

P36776

Lon protease homolog, mitochondrial

LONP1

0.52

1.23

0.00683

0.00392

mitochondrial genome maintenance,response to hypox...

single-stranded DNA binding,single-stranded RNA bi...

nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch...

12

52

82

ILC[CAM]FYGPPGVGK.2|LSSDVLTLLIK.2|ILEFIAVSQLR.2|IL...

SEN / CTL

P20674

Cytochrome c oxidase subunit 5A, mitochondrial

COX5A

0.52

0.42

0.0179

0.00856

mitochondrial electron transport, cytochrome c to ...

cytochrome-c oxidase activity,electron carrier act...

mitochondrial inner membrane,mitochondrial respira...

6

11

21

WVTYFNKPDIDAWELRK.4|WVTYFNKPDIDAWELRK.3|WVTYFNKPDI...

SEN / CTL

P31040

Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SDHA

0.52

0.59

0.0987

0.0354

tricarboxylic acid cycle,succinate metabolic proce...

protein binding,succinate dehydrogenase (ubiquinon...

mitochondrion,mitochondrial inner membrane,mitocho...

9

38

71

LGANSLLDLVVFGR.2|LGANSLLDLVVFGR.3|TYFSC[CAM]TSAHTS...

SEN / CTL

P32119

Peroxiredoxin-2

PRDX2

0.51

0.52

9.74e-10

2.98e-9

response to reactive oxygen species,response to ox...

thioredoxin peroxidase activity,antioxidant activi...

cytoplasm,cytosol,extracellular exosome

57

24

40

GLFIIDGK.2|LSEDYGVLKTDEGIAYR.3|KEGGLGPLNIPLLADVTR....

SEN / CTL

P07339

Cathepsin D

CTSD

0.51

0.81

0.00000927

0.000012

proteolysis,autophagy,antigen processing and prese...

aspartic-type endopeptidase activity,cysteine-type...

extracellular region,extracellular space,lysosome,...

42

30

62

VSTLPAITLK.2|FDGILGMAYPR.2|FDGILGM[Oxi]AYPR.2|QVFG...

SEN / CTL

P21281

V-type proton ATPase subunit B, brain isoform

ATP6V1B2

0.51

0.47

0.0000187

0.0000222

insulin receptor signaling pathway,ATP hydrolysis ...

ATP binding,hydrogen ion transmembrane transporter...

ruffle,lysosomal membrane,cytosol,plasma membrane,...

24

28

43

IYPEEMIQTGISAIDGMNSIAR.3|TVFETLDIGWQLLR.2|TVFETLDI...

SEN / CTL

O43776

Asparagine--tRNA ligase, cytoplasmic

NARS

0.51

0.79

0.0017

0.0012

tRNA aminoacylation for protein translation,aspara...

nucleic acid binding,asparagine-tRNA ligase activi...

cytoplasm,mitochondrion,cytosol,extracellular exos...

21

33

60

FLTWILNR.2|IFDSEEILAGYKR.3|IFDSEEILAGYKR.2|NLMFLVL...

SEN / CTL

Q8NHP8

Putative phospholipase B-like 2

PLBD2

0.51

1.72

0.0502

0.0201

lipid catabolic process

hydrolase activity

lysosomal lumen,extracellular exosome

15

15

20

YNDFLHDPLSLC[CAM]K.3|YNDFLHDPLSLC[CAM]K.2|LASDGATW...

SEN / CTL

Q9Y2Q5

Ragulator complex protein LAMTOR2

LAMTOR2

0.51

0.17

0.0511

0.0204

MAPK cascade,activation of MAPKK activity,cell cyc...

protein binding,guanyl-nucleotide exchange factor ...

lysosomal membrane,late endosome,endosome membrane...

3

9

12

FILMDC[CAM]MEGR.2|ETVGFGMLK.2|VTAAIASNIWAAYDR.3|VT...

SEN / CTL

Q9NR28

Diablo homolog, mitochondrial

DIABLO

0.51

0.98

0.0878

0.0322

apoptotic process,activation of cysteine-type endo...

protein binding

mitochondrion,mitochondrial intermembrane space,cy...

12

12

19

AVYTLTSLYR.2|LQVEEVHQLSR.3|LQVEEVHQLSR.2|TQEEGEER....

SEN / CTL

P62266

40S ribosomal protein S23

RPS23

0.51

0.35

0.124

0.0422

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,protein binding...

nucleoplasm,nucleolus,cytoplasm,cytosol,ribosome,m...

3

11

14

VANVSLLALYK.2|AHLGTALK.2|KGHAVGDIPGVR.3|KGHAVGDIPG...

SEN / CTL

Q92599

Septin-8

8-Sep

0.51

0.58

0.134

0.0448

protein binding,GTP binding

cytoplasm,cytoskeleton,myelin sheath

9

17

23

VNIIPIIAK.2|LRPQTYDLQESNVQLK.3|LRPQTYDLQESNVQLK.2|...

SEN / CTL

P07384

Calpain-1 catalytic subunit

CAPN1

0.5

0.4

1.78e-8

4.36e-8

proteolysis,positive regulation of cell proliferat...

calcium-dependent cysteine-type endopeptidase acti...

cytoplasm,mitochondrion,lysosome,cytosol,plasma me...

54

51

72

EFTRLEIC[CAM]NLTPDALK.3|LYELIITR.2|DFFLANASR.2|YLG...

SEN / CTL

P35580

Myosin-10

MYH10

0.5

0.76

0.00000281

0.0000042

mitotic cytokinesis,in utero embryonic development...

microfilament motor activity,actin binding,protein...

stress fiber,nucleus,cytoplasm,mitochondrion,spind...

60

183

307

AGKLDPHLVLDQLR.3|AGKLDPHLVLDQLR.2|LDPHLVLDQLR.2|LD...

SEN / CTL

Q9BUL8

Programmed cell death protein 10

PDCD10

0.5

0.15

0.000656

0.00053

angiogenesis,positive regulation of cell prolifera...

protein binding,protein kinase binding,protein hom...

Golgi membrane,cytoplasm,Golgi apparatus,cytosol,p...

6

12

17

VNLSAAQTLR.2|SVEVNFTESLLR.2|ELLDTVNNVFKK.3|ELLDTVN...

SEN / CTL

O00232

26S proteasome non-ATPase regulatory subunit 12

PSMD12

0.5

0.73

0.00249

0.00165

MAPK cascade,protein polyubiquitination,stimulator...

proteasome complex,nucleoplasm,cytoplasm,cytosol,p...

15

37

54

IYVEIER.2|LFTTMELMR.2|LQEVIETLLSLEK.2|LQEVIETLLSLE...

SEN / CTL

P15880

40S ribosomal protein S2

RPS2

0.5

0.37

0.0319

0.0139

nuclear-transcribed mRNA catabolic process, nonsen...

mRNA binding,structural constituent of ribosome,pr...

nucleus,nucleoplasm,cytoplasm,cytosol,cell-cell ad...

6

20

34

TYSYLTPDLWK.2|KLLMMAGIDDC[CAM]YTSAR.3|KLLMM[Oxi]AG...

SEN / CTL

Q9NRX4

14 kDa phosphohistidine phosphatase

PHPT1

0.5

0.38

0.0368

0.0154

protein dephosphorylation,positive regulation of i...

phosphoprotein phosphatase activity,phosphohistidi...

cytosol,extracellular exosome

9

8

18

AKYPDYEVTWANDGY.2|IHVYGYSMAYGPAQHAISTEK.4|IHVYGYSM...

SEN / CTL

P08727

Keratin, type I cytoskeletal 19

KRT19

0.49

0.6

6.17e-11

2.35e-10

Notch signaling pathway,viral process,response to ...

structural constituent of cytoskeleton,protein bin...

intermediate filament,plasma membrane,dystrophin-a...

90

47

93

IVLQIDNAR.2|DAEAWFTSR.2|VLDELTLAR.2|FGAQLAHIQALISG...

SEN / CTL

Q14315

Filamin-C

FLNC

0.49

1.01

0.0000027

0.00000408

cell junction assembly,muscle fiber development

protein binding,cytoskeletal protein binding,ankyr...

cytoplasm,cytosol,cytoskeleton,plasma membrane,foc...

36

144

206

YGGDEIPYSPFR.2|VAVGQEQAFSVNTR.2|GVAGVPAEFSIWTR.2|G...

SEN / CTL

P53618

Coatomer subunit beta

COPB1

0.49

0.34

0.0000114

0.0000145

intracellular protein transport,ER to Golgi vesicl...

structural molecule activity,protein binding

Golgi membrane,cytoplasm,endoplasmic reticulum mem...

15

73

120

LKEAELLEPLMPAIR.3|LKEAELLEPLM[Oxi]PAIR.3|VLQDLVMDI...

SEN / CTL

P11142

Heat shock cognate 71 kDa protein

HSPA8

0.49

0.89

0.000244

0.000221

mRNA splicing, via spliceosome,transcription, DNA-...

G-protein coupled receptor binding,phosphatidylser...

Prp19 complex,extracellular space,intracellular,nu...

144

54

126

SQIHDIVLVGGSTR.3|SQIHDIVLVGGSTR.2|QATKDAGTIAGLNVLR...

SEN / CTL

Q92878

DNA repair protein RAD50

RAD50

0.49

0.13

0.119

0.041

regulation of mitotic recombination,telomere maint...

DNA binding,double-stranded telomeric DNA binding,...

nuclear chromosome, telomeric region,nuclear chrom...

3

75

89

VLASLIIR.2|TTELVNK.2|LEENIDNIKR.3|GYEEEIIHFK.3|NHN...

SEN / CTL

P19367

Hexokinase-1

HK1

0.48

0.48

1.05e-10

3.95e-10

cellular glucose homeostasis,glycolytic process,gl...

glucokinase activity,hexokinase activity,ATP bindi...

mitochondrion,mitochondrial outer membrane,cytosol...

63

46

62

SANLVAATLGAILNR.2|SANLVAATLGAILNR.3|TTVGVDGSLYK.2|...

SEN / CTL

Q15181

Inorganic pyrophosphatase

PPA1

0.48

0.43

8.74e-7

0.00000149

tRNA aminoacylation for protein translation,phosph...

magnesium ion binding,inorganic diphosphatase acti...

cytoplasm,cytosol,extracellular exosome

45

30

65

AAPFSLEYR.2|LKPGYLEATVDWFRR.3|LKPGYLEATVDWFRR.4|YV...

SEN / CTL

Q9NQR4

Omega-amidase NIT2

NIT2

0.48

0.37

0.00000133

0.00000217

oxaloacetate metabolic process,asparagine metaboli...

omega-amidase activity

cytoplasm,mitochondrion,centrosome,extracellular e...

30

28

39

FAELAQIYAQR.2|FAELAQIYAQR.3|VGLGIC[CAM]YDMR.2|IVSL...

SEN / CTL

P61204

P84077

ADP-ribosylation factor 3;ADP-ribosylation factor 1

ARF3

ARF1

0.48

0.47

0.00435

0.00265

phosphatidylinositol biosynthetic process,retrogra...

GTPase activity,GTP binding;magnesium ion binding,...

Golgi membrane,perinuclear region of cytoplasm,ext...

9

3

10

ILMVGLDAAGK.2|ILM[Oxi]VGLDAAGK.2|NISFTVWDVGGQDKIRP...

SEN / CTL

P49591

Serine--tRNA ligase, cytoplasmic

SARS

0.48

1.29

0.0303

0.0133

translation,tRNA aminoacylation for protein transl...

RNA binding,serine-tRNA ligase activity,ATP bindin...

cytoplasm,cytosol,extracellular exosome

21

41

63

VLDLDLFR.2|LLIDEAILK.2|KLDLEAWFPGSGAFR.3|KLDLEAWFP...

SEN / CTL

Q9UNF0

Protein kinase C and casein kinase substrate in neurons protein 2

PACSIN2

0.48

1.21

0.0599

0.0235

actin cytoskeleton organization,regulation of endo...

transporter activity,protein binding,cytoskeletal ...

nucleoplasm,cytoplasm,early endosome,cytosol,cytos...

21

22

29

AYAQQLTEWAR.2|AIYHDLEQSIR.3|AIYHDLEQSIR.2|HLDLSNVA...

SEN / CTL

P06730

Eukaryotic translation initiation factor 4E

EIF4E

0.48

0.51

0.0968

0.0347

G1/S transition of mitotic cell cycle,nuclear-tran...

RNA cap binding,translation initiation factor acti...

cytoplasmic mRNA processing body,cytoplasm,cytosol...

6

10

12

WLITLNK.2|IAIWTTEC[CAM]ENR.2|EAVTHIGR.2|TWQANLR.2|...

SEN / CTL

P41250

Glycine--tRNA ligase

GARS

0.47

0.39

3.07e-8

6.98e-8

tRNA aminoacylation for protein translation,glycyl...

bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) ...

nucleoplasm,cytoplasm,mitochondrial matrix,cytosol...

27

46

82

LLEFNQGKLPFAAAQIGNSFR.3|TFFSFPAVVAPFK.2|TFFSFPAVVA...

SEN / CTL

Q9UJZ1

Stomatin-like protein 2, mitochondrial

STOML2

0.47

0.28

0.000399

0.000341

mitochondrial calcium ion transport,cellular calci...

receptor binding,protein binding,GTPase binding,ca...

mitochondrial inner membrane,mitochondrial interme...

12

28

44

ILEPGLNILIPVLDR.2|ILEPGLNILIPVLDR.3|ESLNASIVDAINQA...

SEN / CTL

P49773

Histidine triad nucleotide-binding protein 1

HINT1

0.47

0.74

0.00212

0.00145

transcription, DNA-templated,regulation of transcr...

nucleotide binding,protein kinase C binding,hydrol...

histone deacetylase complex,nucleus,cytoplasm,cyto...

21

13

35

AQVARPGGDTIFGK.3|AQVARPGGDTIFGK.2|IIFEDDRC[CAM]LAF...

SEN / CTL

P62491

Q15907

Ras-related protein Rab-11A;Ras-related protein Rab-11B

RAB11A

RAB11B

0.47

0.26

0.00249

0.00165

cytokinesis,renal water homeostasis,mitotic metaph...

GTPase activity,protein binding,GTP binding,microt...

spindle pole,mitochondrion,multivesicular body,Gol...

9

3

4

STIGVEFATR.2|VVLIGDSGVGK.2|GAVGALLVYDIAK.2|GAVGALL...

SEN / CTL

P31930

Cytochrome b-c1 complex subunit 1, mitochondrial

UQCRC1

0.47

0.97

0.00665

0.00384

oxidative phosphorylation,mitochondrial electron t...

metalloendopeptidase activity,ubiquinol-cytochrome...

mitochondrion,mitochondrial inner membrane,mitocho...

9

36

66

IAEVDASVVR.2|ADLTEYLSTHYKAPR.4|ADLTEYLSTHYKAPR.3|N...

SEN / CTL

P35579

Myosin-9

MYH9

0.46

0.86

1.51e-19

1.69e-18

meiotic spindle organization,cytokinesis,angiogene...

microfilament motor activity,motor activity,actin ...

stress fiber,ruffle,uropod,nucleus,cytoplasm,spind...

609

240

477

LQQELDDLLVDLDHQR.3|LQQELDDLLVDLDHQR.2|VSHLLGINVTDF...

SEN / CTL

Q14847

LIM and SH3 domain protein 1

LASP1

0.46

0.37

3.66e-7

6.72e-7

ion transport,positive regulation of signal transd...

SH3/SH2 adaptor activity,protein binding,zinc ion ...

cytoplasm,cell-cell adherens junction,focal adhesi...

36

20

35

GKGFSVVADTPELQR.3|RPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGG...

SEN / CTL

P06756

Integrin alpha-V

ITGAV

0.46

0.5

0.0011

0.000827

angiogenesis,antigen processing and presentation o...

virus receptor activity,fibronectin binding,protea...

plasma membrane,integral component of plasma membr...

30

49

56

ILAC[CAM]APLYHWR.3|IYIGDDNPLTLIVK.2|GATDIDKNGYPDLI...

SEN / CTL

Q5JTV8

Torsin-1A-interacting protein 1

TOR1AIP1

0.46

0.35

0.00274

0.0018

positive regulation of ATPase activity,protein loc...

ATPase activator activity,lamin binding,cytoskelet...

nucleus,nuclear inner membrane,integral component ...

9

21

26

SQPAILLLTAAR.2|SIQEAPVSEDLVIR.2|ISHLVLPVQPENALKR.4...

SEN / CTL

Q9ULV4

Coronin-1C

CORO1C

0.46

0.88

0.00447

0.0027

neural crest cell migration,regulation of protein ...

protein binding,Rac GTPase binding,actin filament ...

cytoplasm,focal adhesion,actin cytoskeleton,latera...

27

36

54

VTWDSSFC[CAM]AVNPR.2|NADPILISLK.2|AIFLADGNVFTTGFSR...

SEN / CTL

P62495

Eukaryotic peptide chain release factor subunit 1

ETF1

0.46

0.42

0.00519

0.0031

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,translation release factor activity,pr...

cytoplasm,cytosol,nucleus

9

35

53

LSVLGAITSVQQR.2|LSVLGAITSVQQR.3|GFGGIGGILR.2|FTVDL...

SEN / CTL

Q9UHL4

Dipeptidyl peptidase 2

DPP7

0.46

1.04

0.0412

0.017

proteolysis

serine-type carboxypeptidase activity,serine-type ...

lysosome,Golgi apparatus,cytosol,cytoplasmic, memb...

15

18

27

GHTELLTVEQALADFAELLR.3|DVTADFEGQSPK.2|KLEATIIGEWVK...

SEN / CTL

P29218

Inositol monophosphatase 1

IMPA1

0.46

1.3

0.0658

0.0252

inositol metabolic process,inositol biosynthetic p...

magnesium ion binding,inositol monophosphate 1-pho...

cytoplasm,cytosol,extracellular exosome

9

16

22

LFC[CAM]IPVHGIR.3|LFC[CAM]IPVHGIR.2|EIQVIPLQRDDED....

SEN / CTL

P62333

26S protease regulatory subunit 10B

PSMC6

0.45

0.35

0.0000027

0.00000408

MAPK cascade,protein polyubiquitination,stimulator...

protein binding,ATP binding,ATPase activity,TBP-cl...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

21

28

44

ELREVIELPLTNPELFQR.3|VVSSSIVDKYIGESAR.3|HGEIDYEAIV...

SEN / CTL

Q99460

26S proteasome non-ATPase regulatory subunit 1

PSMD1

0.45

0.38

0.00000279

0.00000418

MAPK cascade,protein polyubiquitination,stimulator...

enzyme regulator activity,endopeptidase activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

30

60

102

QAIGIALETR.2|VSTAVLSITAK.2|AAVESLGFILFR.2|AAVESLGF...

SEN / CTL

P30041

Peroxiredoxin-6

PRDX6

0.45

0.7

0.000261

0.000235

response to reactive oxygen species,lipid cataboli...

glutathione peroxidase activity,protein binding,hy...

extracellular space,cytoplasm,lysosome,cytosol,cel...

45

31

62

NFDEILR.2|FHDFLGDSWGILFSHPR.3|FHDFLGDSWGILFSHPR.4|...

SEN / CTL

Q92597

Protein NDRG1

NDRG1

0.45

0.73

0.00586

0.00345

negative regulation of cell proliferation,response...

protein binding,microtubule binding,Rab GTPase bin...

nucleus,cytoplasm,centrosome,cytosol,microtubule,p...

15

18

49

SIIGMGTGAGAYILTR.2|SIIGMGTGAGAYILTR.3|SIIGM[Oxi]GT...

SEN / CTL

Q9UHD8

Septin-9

9-Sep

0.45

1.55

0.0268

0.0121

cell cycle,protein heterooligomerization,cell divi...

GTPase activity,protein binding,GTP binding,cadher...

stress fiber,cytoplasm,microtubule,cell-cell adher...

30

46

76

YLQEEVNINR.2|STLINTLFK.2|ADTLTLEER.2|RTELSIDISSK.2...

SEN / CTL

Q15019

Septin-2

2-Sep

0.44

0.37

4.25e-14

2.25e-13

regulation of L-glutamate transport,mitotic nuclea...

protein binding,GTP binding,enzyme regulator activ...

exocyst,condensed chromosome kinetochore,nucleus,n...

57

30

53

STLINSLFLTDLYPER.2|STLINSLFLTDLYPER.3|TIISYIDEQFER...

SEN / CTL

P49368

T-complex protein 1 subunit gamma

CCT3

0.44

0.69

1.41e-7

2.74e-7

protein folding,binding of sperm to zona pellucida...

protein binding,ATP binding,protein binding involv...

zona pellucida receptor complex,cytoplasm,cytosol,...

72

49

102

TAVETAVLLLR.2|IVLLDSSLEYK.2|AVAQALEVIPR.2|ELGIWEPL...

SEN / CTL

P46782

40S ribosomal protein S5

RPS5

0.44

0.36

0.000311

0.000274

ribosomal small subunit assembly,nuclear-transcrib...

RNA binding,mRNA binding,structural constituent of...

nucleoplasm,cytosol,focal adhesion,membrane,cytoso...

12

15

20

TIAEC[CAM]LADELINAAK.2|TIAEC[CAM]LADELINAAK.3|VNQA...

SEN / CTL

Q9C0C2

182 kDa tankyrase-1-binding protein

TNKS1BP1

0.44

0.58

0.00373

0.00238

nuclear-transcribed mRNA poly(A) tail shortening,D...

enzyme binding,ankyrin binding,cadherin binding in...

nucleus,nucleoplasm,nuclear telomeric heterochroma...

21

62

73

FAATTVEEILAK.2|SQEADVQDWEFR.2|EMEEELVPTGSEPGDTR.2|...

SEN / CTL

O75340

Programmed cell death protein 6

PDCD6

0.44

0.69

0.0177

0.0085

angiogenesis,positive regulation of endothelial ce...

calcium-dependent cysteine-type endopeptidase acti...

nucleus,cytoplasm,endosome,endoplasmic reticulum,e...

9

13

19

AGVNFSEFTGVWK.2|LSDQFHDILIR.3|LSDQFHDILIR.2|SIISMF...

SEN / CTL

Q07812

Apoptosis regulator BAX

BAX

0.44

0.46

0.0185

0.00884

ovarian follicle development,neuron migration,T ce...

protein binding,lipid binding,channel activity,ide...

nucleus,nuclear envelope,cytoplasm,mitochondrion,m...

9

8

14

TGALLLQGFIQDR.2|IGDELDSNMELQR.2|IGDELDSNM[Oxi]ELQR...

SEN / CTL

P63010

AP-2 complex subunit beta

AP2B1

0.43

0.43

1.01e-11

4.2e-11

ventricular septum development,intracellular prote...

signal sequence binding,protein binding,protein tr...

trans-Golgi network,cytosol,plasma membrane,membra...

42

43

83

IQPGNPNYTLSLK.2|LASQANIAQVLAELKEYATEVDVDFVR.4|LASQ...

SEN / CTL

P46821

Microtubule-associated protein 1B

MAP1B

0.43

0.51

3.6e-9

1.01e-8

microtubule bundle formation,cellular process,dend...

structural molecule activity,protein binding,micro...

photoreceptor outer segment,cytoplasm,cytosol,micr...

63

110

158

TPEEGGYSYDISEK.2|AIGNIELGIR.2|SVNFSLTPNEIK.2|TPEDG...

SEN / CTL

P26373

60S ribosomal protein L13

RPL13

0.43

0.49

0.00861

0.00475

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,cytosol,membrane,cytosolic large ribosomal...

9

22

35

TIGISVDPR.2|GFSLEELR.2|KGDSSAEELKLATQLTGPVMPVR.4|K...

SEN / CTL

O60506

Heterogeneous nuclear ribonucleoprotein Q

SYNCRIP

0.43

0.77

0.0147

0.00728

mRNA splicing, via spliceosome,osteoblast differen...

nucleotide binding,RNA binding,poly(A) binding,pol...

nucleus,nucleoplasm,endoplasmic reticulum,membrane...

33

48

77

GYAFVTFC[CAM]TK.2|DLFEDELVPLFEK.2|DLFEDELVPLFEK.3|...

SEN / CTL

O76054

Q9UDX4

SEC14-like protein 2;SEC14-like protein 3

SEC14L2

SEC14L3

0.43

0.1

0.0154

0.00758

transcription, DNA-templated,transport,regulation ...

transporter activity,phospholipid binding,vitamin ...

nucleus,cytoplasm,integral component of membrane,e...

3

1

1

FRENVQDVLPALPNPDDYFLLR.3

SEN / CTL

P49748

Very long-chain specific acyl-CoA dehydrogenase, mitochondrial

ACADVL

0.43

1.03

0.0233

0.0108

temperature homeostasis,fatty acid beta-oxidation,...

fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti...

nucleus,nucleolus,cytoplasm,mitochondrion,mitochon...

12

44

76

ITAFVVER.2|GIVNEQFLLQR.2|GIVNEQFLLQR.3|IFEGTNDILR....

SEN / CTL

Q99426

Tubulin-folding cofactor B

TBCB

0.43

0.52

0.0297

0.0132

nervous system development,cell differentiation

protein binding

nucleoplasm,cytoplasm,microtubule,microtubule cyto...

6

20

26

RGTVMYVGLTDFKPGYWIGVR.4|YTISQEAYDQRQDTVR.3|SLTIAEF...

SEN / CTL

Q04917

14-3-3 protein eta

YWHAH

0.43

0.53

0.0587

0.0231

regulation of sodium ion transport,glucocorticoid ...

actin binding,insulin-like growth factor receptor ...

cytoplasm,mitochondrion,cytosol,plasma membrane,in...

18

18

35

AVTELNEPLSNEDRNLLSVAYK.3|LAEQAERYDDMASAMK.3|LAEQAE...

SEN / CTL

Q15366

Poly(rC)-binding protein 2

PCBP2

0.43

1.07

0.0928

0.0336

mRNA splicing, via spliceosome,gene expression,mRN...

RNA binding,protein binding,enzyme binding,ubiquit...

nucleus,nucleoplasm,cytoplasm,cytosol,focal adhesi...

24

23

57

AITIAGIPQSIIEC[CAM]VK.2|AITIAGIPQSIIEC[CAM]VK.3|II...

SEN / CTL

P18124

60S ribosomal protein L7

RPL7

0.42

0.36

0.0007

0.000561

nuclear-transcribed mRNA catabolic process, nonsen...

DNA binding,RNA binding,mRNA binding,structural co...

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion...

12

24

42

IALTDNALIAR.2|IVEPYIAWGYPNLK.2|IVEPYIAWGYPNLK.3|FK...

SEN / CTL

Q7Z304

MAM domain-containing protein 2

MAMDC2

0.42

0.2

0.0852

0.0315

proteinaceous extracellular matrix,endoplasmic ret...

3

1

1

AGDHTTGLGYYLLANTK.3

SEN / CTL

P32969

60S ribosomal protein L9

RPL9

0.42

1.02

0.131

0.0443

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,nucleolus,cytoplasm,cytosol,ribosome,focal...

6

15

30

FLDGIYVSEK.2|DFNHINVELSLLGK.3|DFNHINVELSLLGK.2|GTV...

SEN / CTL

P02545

Prelamin-A/C

LMNA

0.41

1.29

1.28e-9

3.75e-9

mitotic nuclear envelope disassembly,mitotic nucle...

structural molecule activity,protein binding

nucleus,nuclear envelope,lamin filament,nucleoplas...

144

85

142

VAVEEVDEEGKFVR.3|VAVEEVDEEGKFVR.2|LADALQELR.2|EAAL...

SEN / CTL

P08865

40S ribosomal protein SA

RPSA

0.41

0.34

0.0000149

0.000018

ribosomal small subunit assembly,nuclear-transcrib...

virus receptor activity,structural constituent of ...

nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr...

21

21

46

AIVAIENPADVSVISSR.2|AIVAIENPADVSVISSR.3|FTPGTFTNQI...

SEN / CTL

Q58FF8

Putative heat shock protein HSP 90-beta 2

HSP90AB2P

0.41

0.25

0.00195

0.00135

protein folding,response to stress,biological_proc...

molecular_function,ATP binding,unfolded protein bi...

cytoplasm,extracellular exosome

9

2

6

HSQFLGYPITLYLEKER.4|HSQFLGYPITLYLEKER.3|HSQFLGYPIT...

SEN / CTL

Q92973

Transportin-1

TNPO1

0.41

0.32

0.00394

0.00244

protein import into nucleus, docking,protein impor...

protein binding,nuclear localization sequence bind...

nucleus,cytoplasm,cytosol,nuclear membrane,nuclear...

9

43

65

TLLENTAITIGR.2|QSSFALLGDLTK.2|ALVMLLEVR.2|ATVGILIT...

SEN / CTL

Q99733

Nucleosome assembly protein 1-like 4

NAP1L4

0.41

0.26

0.00988

0.00526

nucleosome assembly

poly(A) RNA binding,unfolded protein binding

nucleus,cytoplasm

9

18

26

GIPEFWFTIFR.2|YAALYQPLFDK.2|NVDMLSELVQEYDEPILK.3|N...

SEN / CTL

Q01082

Spectrin beta chain, non-erythrocytic 1

SPTBN1

0.4

0.61

3.37e-23

5.35e-22

MAPK cascade,mitotic cytokinesis,ER to Golgi vesic...

actin binding,Ras guanyl-nucleotide exchange facto...

nucleolus,cytoplasm,cytosol,cell-cell adherens jun...

294

217

362

SQNIVTDSSSLSAEAIR.3|SQNIVTDSSSLSAEAIR.2|LTTLELLEVR...

SEN / CTL

P23381

Tryptophan--tRNA ligase, cytoplasmic

WARS

0.4

0.54

3.96e-7

7.13e-7

angiogenesis,translation,tRNA aminoacylation for p...

tryptophan-tRNA ligase activity,protein binding,AT...

nucleus,cytoplasm,cytosol,extracellular exosome

36

36

61

GIFGFTDSDC[CAM]IGK.2|ALIEVLQPLIAEHQAR.3|ALIEVLQPLI...

SEN / CTL

P47755

F-actin-capping protein subunit alpha-2

CAPZA2

0.4

0.27

0.0000359

0.0000393

protein complex assembly,movement of cell or subce...

actin binding

extracellular region,cytosol,brush border,F-actin ...

15

16

29

FTITPSTTQVVGILK.2|FTITPSTTQVVGILK.3|EATDPRPC[CAM]E...

SEN / CTL

Q14651

Plastin-1

PLS1

0.4

0.36

0.000737

0.000582

intestinal D-glucose absorption,regulation of micr...

structural constituent of cytoskeleton,calcium ion...

cytoplasm,actin filament,brush border,actin filame...

15

37

50

SISTSLPVLDLIDAIAPNAVR.3|SISTSLPVLDLIDAIAPNAVR.2|MI...

SEN / CTL

Q14203

Dynactin subunit 1

DCTN1

0.4

1.54

0.0101

0.00536

G2/M transition of mitotic cell cycle,ER to Golgi ...

motor activity,protein binding,microtubule binding...

kinetochore,spindle pole,nuclear envelope,cytoplas...

24

74

109

WVGVILDEAK.2|VTFSC[CAM]AAGFGQR.2|VTFSC[CAM]AAGFGQR...

SEN / CTL

P07900

Heat shock protein HSP 90-alpha

HSP90AA1

0.4

0.8

0.144

0.0473

G2/M transition of mitotic cell cycle,neuron migra...

nucleotide binding,glycoprotein binding,UTP bindin...

extracellular region,nucleus,nucleoplasm,cytoplasm...

105

69

151

ALLFVPR.2|NPDDITNEEYGEFYK.2|NPDDITNEEYGEFYK.3|ELIS...

SEN / CTL

P59998

Actin-related protein 2/3 complex subunit 4

ARPC4

0.39

0.34

0.0000102

0.0000131

actin filament polymerization,Arp2/3 complex-media...

structural constituent of cytoskeleton,protein bin...

cytosol,Arp2/3 protein complex,cell projection,ext...

21

12

18

VLIEGSINSVR.2|AENFFILR.2|IVAEEFLK.2|ELLLQPVTISR.2|...

SEN / CTL

Q96IU4

Alpha/beta hydrolase domain-containing protein 14B

ABHD14B

0.39

0.29

0.0000103

0.0000132

positive regulation of transcription from RNA poly...

protein binding,hydrolase activity

nucleus,nucleolus,cytoplasm,cytosol,extracellular ...

18

9

14

FSVLLLHGIR.2|FSSETWQNLGTLHR.3|FSSETWQNLGTLHR.2|AVA...

SEN / CTL

Q16181

Septin-7

7-Sep

0.39

0.46

0.0000127

0.0000158

cytokinesis,mitotic nuclear division,regulation of...

structural molecule activity,protein binding,GTP b...

condensed chromosome kinetochore,stress fiber,nucl...

27

39

59

VNIIPLIAK.2|THMQDLKDVTNNVHYENYR.4|STLINSLFLTDLYSPE...

SEN / CTL

Q08257

Quinone oxidoreductase

CRYZ

0.39

1.08

0.000225

0.000208

visual perception,xenobiotic catabolic process,pro...

mRNA 3'-UTR binding,NADPH:quinone reductase activi...

cytoplasm,cytosol,extracellular exosome

48

32

52

VFEFGGPEVLK.2|VHAC[CAM]GVNPVETYIR.3|VHAC[CAM]GVNPV...

SEN / CTL

Q92499

ATP-dependent RNA helicase DDX1

DDX1

0.39

0.21

0.00198

0.00137

spliceosomal complex assembly,double-strand break ...

DNA binding,chromatin binding,transcription cofact...

nucleus,nucleoplasm,cytoplasm,cytoplasmic stress g...

9

56

98

ELLIIGGVAAR.2|FLIC[CAM]TDVAAR.2|FLVLDEADGLLSQGYSDF...

SEN / CTL

O95394

Phosphoacetylglucosamine mutase

PGM3

0.39

0.04

0.006

0.00353

carbohydrate metabolic process,glucosamine metabol...

magnesium ion binding,phosphoacetylglucosamine mut...

cellular_component,cytosol

3

32

47

MGLLAVLR.2|AFVELTK.2|AFVELTK.1|AEHLDHVMFR.3|AEHLDH...

SEN / CTL

P24821

Tenascin

TNC

0.39

1

0.0181

0.00865

osteoblast differentiation,cell adhesion,negative ...

syndecan binding

extracellular region,basement membrane,interstitia...

18

77

105

VSIYGVIR.2|ITAQGQYELR.2|TAHISGLPPSTDFIVYLSGLAPSIR....

SEN / CTL

O43813

LanC-like protein 1

LANCL1

0.39

0.38

0.112

0.0389

G-protein coupled receptor signaling pathway

catalytic activity,G-protein coupled receptor acti...

cytoplasm,extracellular exosome,integral component...

9

22

31

SLAEGYFDAAGR.2|ARFPAFEL.2|IPQSHIQQIC[CAM]ETILTSGEN...

SEN / CTL

Q9BSJ8

Extended synaptotagmin-1

ESYT1

0.38

0.62

7.91e-7

0.00000137

lipid transport

lipid binding,metal ion binding

plasma membrane,membrane,integral component of end...

39

52

75

LTLWYYSEER.2|LTTVLNSGFLDEWLTLEDVPSGR.3|VQLDLAETDLS...

SEN / CTL

P83731

60S ribosomal protein L24

RPL24

0.38

0.19

0.000203

0.00019

ribosomal large subunit assembly,nuclear-transcrib...

RNA binding,structural constituent of ribosome,pro...

cytoplasm,cytosol,cell-cell adherens junction,memb...

9

10

16

QINWTVLYR.2|AITGASLADIMAK.2|AITGASLADIMAK.3|AITGAS...

SEN / CTL

Q16658

Fascin

FSCN1

0.38

0.53

0.000228

0.000208

cell-cell junction assembly,cell proliferation,ana...

actin binding,drug binding,protein binding, bridgi...

stress fiber,ruffle,podosome,cytoplasm,cytosol,cyt...

48

44

69

YLTAEAFGFK.2|NASC[CAM]YFDIEWR.2|VGKDELFALEQSC[CAM]...

SEN / CTL

P0DJI9

Serum amyloid A-2 protein

SAA2

0.38

0.35

0.123

0.042

acute-phase response,positive chemotaxis,cell chem...

chemoattractant activity

extracellular space,high-density lipoprotein parti...

3

2

3

RGPGGAWAAEVISNAR.3|RGPGGAWAAEVISNAR.2|GPGGAWAAEVIS...

SEN / CTL

P40227

T-complex protein 1 subunit zeta

CCT6A

0.37

0.71

0.00000155

0.00000247

protein folding,positive regulation of telomere ma...

protein binding,ATP binding,protein binding involv...

cytoplasm,cytosol,chaperonin-containing T-complex,...

63

42

77

ALQFLEEVKVSR.3|VLAQNSGFDLQETLVK.3|VLAQNSGFDLQETLVK...

SEN / CTL

Q96HE7

ERO1-like protein alpha

ERO1L

0.37

0.53

0.000861

0.000672

response to reactive oxygen species,protein foldin...

protein disulfide isomerase activity,protein disul...

endoplasmic reticulum,endoplasmic reticulum lumen,...

21

31

49

LLESDYFR.2|LGAVDESLSEETQK.2|YSEEANNLIEEC[CAM]EQAER...

SEN / CTL

Q15691

Microtubule-associated protein RP/EB family member 1

MAPRE1

0.37

0.38

0.00185

0.00129

G2/M transition of mitotic cell cycle,sister chrom...

protein binding,protein C-terminus binding,identic...

cytoplasm,Golgi apparatus,centrosome,cytosol,micro...

18

24

48

FFDANYDGKDYDPVAAR.3|FFDANYDGKDYDPVAAR.2|NIELIC[CAM...

SEN / CTL

P61158

Actin-related protein 3

ACTR3

0.37

0.47

0.0121

0.00623

movement of cell or subcellular component,establis...

structural constituent of cytoskeleton,ATP binding...

cytosol,Arp2/3 protein complex,brush border,cell-c...

48

34

61

LKLSEELSGGR.2|LKPKPIDVQVITHHMQR.5|LKPKPIDVQVITHHMQ...

SEN / CTL

Q5TZA2

Rootletin

CROCC

0.37

0.08

0.0167

0.00816

cell cycle,protein localization,centriole-centriol...

actin binding,structural molecule activity,protein...

photoreceptor inner segment,cytoplasm,centrosome,c...

3

10

11

LALLEEAR.2|HSLATISLEMER.3|HSLATISLEMER.2|AEVAEALTK...

SEN / CTL

P60842

Eukaryotic initiation factor 4A-I

EIF4A1

0.37

1.1

0.0422

0.0173

nuclear-transcribed mRNA poly(A) tail shortening,t...

RNA cap binding,double-stranded RNA binding,mRNA b...

cytoplasm,cytosol,membrane,eukaryotic translation ...

51

39

86

VLITTDLLAR.2|AEVQKLQMEAPHIIVGTPGR.4|GIYAYGFEKPSAIQ...

SEN / CTL

Q15233

Non-POU domain-containing octamer-binding protein

NONO

0.37

0.66

0.0664

0.0254

mRNA splicing, via spliceosome,DNA repair,DNA reco...

nucleotide binding,transcription regulatory region...

nucleus,nucleoplasm,nucleolus,membrane,nuclear mat...

12

43

99

NLPQYVSNELLEEAFSVFGQVER.3|FAC[CAM]HSASLTVR.3|FAC[C...

SEN / CTL

Q02878

60S ribosomal protein L6

RPL6

0.37

0.54

0.0681

0.0259

ribosomal large subunit assembly,nuclear-transcrib...

DNA binding,RNA binding,structural constituent of ...

nucleus,cytosol,cell-cell adherens junction,focal ...

12

30

42

AIPQLQGYLR.2|IKAIPQLQGYLR.3|HQEGEIFDTEKEKYEITEQR.4...

SEN / CTL

O75369

Filamin-B

FLNB

0.36

0.59

1.12e-17

9.14e-17

keratinocyte development,epithelial cell morphogen...

actin binding,protein binding,poly(A) RNA binding,...

stress fiber,cytoplasm,cytosol,plasma membrane,bru...

252

210

349

LIALLEVLSQK.2|SPFTVGVAAPLDLSK.2|SPFTVGVAAPLDLSK.3|...

SEN / CTL

Q9NQC3

Reticulon-4

RTN4

0.36

0.48

0.0000649

0.0000684

apoptotic process,axonal fasciculation,cerebral co...

protein binding,poly(A) RNA binding,cadherin bindi...

intracellular,nuclear envelope,endoplasmic reticul...

21

18

28

KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR.4|KPAAGLSAAPVPT...

SEN / CTL

Q9NVA2

Septin-11

11-Sep

0.36

0.53

0.00027

0.000242

cell cycle,protein heterooligomerization,cell divi...

protein binding,GTP binding

stress fiber,cytoplasm,cell junction,axon,dendriti...

18

27

44

STLMDTLFNTKFESDPATHNEPGVR.4|STLMDTLFNTKFESDPATHNEP...

SEN / CTL

Q9Y5K6

CD2-associated protein

CD2AP

0.36

0.46

0.00967

0.00517

protein complex assembly,substrate-dependent cell ...

vascular endothelial growth factor receptor bindin...

ruffle,nucleolus,cytoplasm,plasma membrane,cell-ce...

12

47

57

SVDFDSLTVR.2|LGLFPSNFVK.2|ANTTAFLTPLEIK.2|ISTYGLPA...

SEN / CTL

P17980

26S protease regulatory subunit 6A

PSMC3

0.36

0.91

0.0377

0.0157

MAPK cascade,protein polyubiquitination,blastocyst...

transcription coactivator activity,transcription c...

proteasome complex,cytoplasmic mRNA processing bod...

15

35

62

VIAATNRVDILDPALLR.3|VIAATNRVDILDPALLR.2|LLDSEIK.2|...

SEN / CTL

P62314

Small nuclear ribonucleoprotein Sm D1

SNRPD1

0.36

0.42

0.0728

0.0274

spliceosomal complex assembly,spliceosomal snRNP a...

RNA binding,protein binding,poly(A) RNA binding,U1...

commitment complex,nucleus,nucleoplasm,U5 snRNP,U1...

9

6

13

NREPVQLETLSIR.3|NREPVQLETLSIR.2|YFILPDSLPLDTLLVDVE...

SEN / CTL

Q14157

Ubiquitin-associated protein 2-like

UBAP2L

0.36

0.09

0.146

0.0479

binding of sperm to zona pellucida,hematopoietic s...

protein binding,poly(A) RNA binding

PcG protein complex,Ada2/Gcn5/Ada3 transcription a...

3

28

45

IDLAVLLGK.2|QRPQATAEQIR.3|QRPQATAEQIR.2|GFGDVGEAK....

SEN / CTL

P27487

Dipeptidyl peptidase 4

DPP4

0.35

0.48

0.000361

0.000314

behavioral fear response,response to hypoxia,prote...

virus receptor activity,protease binding,serine-ty...

lysosomal membrane,plasma membrane,focal adhesion,...

21

34

42

ISLQWLR.2|LNWATYLASTENIIVASFDGR.3|HSYTASYDIYDLNKR....

SEN / CTL

O75874

Isocitrate dehydrogenase [NADP] cytoplasmic

IDH1

0.35

0.5

0.00409

0.00252

glyoxylate cycle,tricarboxylic acid cycle,isocitra...

magnesium ion binding,isocitrate dehydrogenase (NA...

cytoplasm,mitochondrion,peroxisome,peroxisomal mat...

30

28

53

GWPLYLSTK.2|IIWELIK.2|LVSGWVKPIIIGR.3|LVSGWVKPIIIG...

SEN / CTL

P42224

Signal transducer and activator of transcription 1-alpha/beta

STAT1

0.35

0.53

0.00936

0.00505

negative regulation of transcription from RNA poly...

RNA polymerase II core promoter proximal region se...

nuclear chromatin,nucleus,nucleoplasm,nucleolus,cy...

9

47

63

ELSAVTFPDIIR.2|NLSFFLTPPC[CAM]AR.2|FHDLLSQLDDQYSR....

SEN / CTL

Q9Y265

RuvB-like 1

RUVBL1

0.35

0.39

0.0102

0.00539

box C/D snoRNP assembly,DNA repair,DNA recombinati...

DNA helicase activity,protein binding,ATP binding,...

Swr1 complex,nucleus,nucleoplasm,cytoplasm,Golgi a...

12

35

55

EAC[CAM]GVIVELIK.2|YSVQLLTPANLLAK.2|YSVQLLTPANLLAK...

SEN / CTL

Q6NZI2

Polymerase I and transcript release factor

PTRF

0.35

0.74

0.0359

0.0152

regulation of transcription, DNA-templated,transcr...

protein binding,rRNA primary transcript binding,po...

nucleus,nucleoplasm,cytoplasm,mitochondrion,endopl...

21

15

23

VMIYQDEVKLPAK.3|VM[Oxi]IYQDEVKLPAK.3|VMIYQDEVKLPAK...

SEN / CTL

P47756

F-actin-capping protein subunit beta

CAPZB

0.34

0.35

0.00000466

0.00000649

movement of cell or subcellular component,cytoskel...

actin binding,actin filament binding,cadherin bind...

cytosol,cytoskeleton,actin filament,cell-cell adhe...

36

22

40

STLNEIYFGK.2|LVEDMENKIR.3|SGSGTMNLGGSLTR.2|SGSGTM[...

SEN / CTL

Q14103

Heterogeneous nuclear ribonucleoprotein D0

HNRNPD

0.34

0.49

0.00716

0.00405

mRNA splicing, via spliceosome,liver development,t...

nucleotide binding,AT DNA binding,chromatin bindin...

nucleus,nucleoplasm,cytosol,intracellular ribonucl...

21

25

51

FGEVVDC[CAM]TLK.2|IFVGGLSPDTPEEK.2|IFVGGLSPDTPEEK....

SEN / CTL

P63244

Guanine nucleotide-binding protein subunit beta-2-like 1

GNB2L1

0.34

0.58

0.00748

0.00421

positive regulation of protein phosphorylation,apo...

protein kinase C binding,receptor binding,protein ...

phagocytic cup,nucleus,cytoplasm,mitochondrion,cyt...

24

30

51

VWQVTIGTR.2|LWDLTTGTTTR.2|YWLC[CAM]AATGPSIK.2|YWLC...

SEN / CTL

O00487

26S proteasome non-ATPase regulatory subunit 14

PSMD14

0.34

0.34

0.00808

0.00451

MAPK cascade,protein polyubiquitination,double-str...

protein binding,metallopeptidase activity,metal io...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

12

12

25

AVAVVVDPIQSVK.2|AVAVVVDPIQSVK.3|LINANMMVLGHEPR.3|L...

SEN / CTL

P30153

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

PPP2R1A

0.33

0.47

0.000203

0.00019

G2/M transition of mitotic cell cycle,nuclear-tran...

antigen binding,protein serine/threonine phosphata...

protein phosphatase type 2A complex,chromosome, ce...

42

41

75

QLSQSLLPAIVELAEDAKWR.3|TSAC[CAM]GLFSVC[CAM]YPR.2|A...

SEN / CTL

Q9UKK3

Poly [ADP-ribose] polymerase 4

PARP4

0.33

1.1

0.00259

0.00171

DNA repair,cellular protein modification process,p...

DNA binding,NAD+ ADP-ribosyltransferase activity,p...

nucleus,cytoplasm,spindle microtubule,membrane,int...

18

45

55

LGNVRPLLHGSPVQNIVGILC[CAM]R.4|QLLGLQPISTVSPLHR.3|S...

SEN / CTL

P26006

Integrin alpha-3

ITGA3

0.33

0.54

0.00389

0.00243

neuron migration,cell-matrix adhesion,integrin-med...

glycoprotein binding,fibronectin binding,protease ...

plasma membrane,focal adhesion,integrin complex,ex...

33

26

39

YLLLAGAPR.2|VNGWATLFLR.2|EAGNPGSLFGYSVALHR.3|EAGNP...

SEN / CTL

P50995

Annexin A11

ANXA11

0.33

0.54

0.00518

0.00309

phagocytosis,cell cycle,cell division,response to ...

calcium ion binding,protein binding,calcium-depend...

nuclear envelope,nucleoplasm,cytoplasm,spindle,mem...

21

29

45

SETDLLDIR.2|EAIKGVGTDEAC[CAM]LIEILASR.3|TPVLFDIYEI...

SEN / CTL

P40261

Nicotinamide N-methyltransferase

NNMT

0.33

0.34

0.0148

0.00735

response to organonitrogen compound,animal organ r...

nicotinamide N-methyltransferase activity,pyridine...

cytosol

15

13

20

C[CAM]DVTQSQPLGAVPLPPADC[CAM]VLSTLC[CAM]LDAAC[CAM]...

SEN / CTL

O00754

Lysosomal alpha-mannosidase

MAN2B1

0.33

0.41

0.0168

0.00818

mannose metabolic process,cellular protein modific...

alpha-mannosidase activity,zinc ion binding,carboh...

extracellular space,lysosomal lumen,extracellular ...

27

32

45

DLFSTFTITR.2|LQETTLVANQLR.2|FQVIVYNPLGR.2|ELVDYFLN...

SEN / CTL

P11279

Lysosome-associated membrane glycoprotein 1

LAMP1

0.33

0.83

0.0234

0.0108

autophagy,granzyme-mediated apoptotic signaling pa...

virus receptor activity,protein binding,enzyme bin...

cytoplasm,lysosome,lysosomal membrane,late endosom...

24

9

13

FFLQGIQLNTILPDARDPAFK.3|FFLQGIQLNTILPDARDPAFK.4|AL...

SEN / CTL

P09104

Gamma-enolase

ENO2

0.33

0.68

0.0289

0.0128

gluconeogenesis,canonical glycolysis

magnesium ion binding,phosphopyruvate hydratase ac...

phosphopyruvate hydratase complex,photoreceptor in...

39

20

33

VNQIGSVTEAIQAC[CAM]K.2|VNQIGSVTEAIQAC[CAM]K.3|LAMQ...

SEN / CTL

Q02218

2-oxoglutarate dehydrogenase, mitochondrial

OGDH

0.33

1.34

0.0333

0.0143

generation of precursor metabolites and energy,gly...

oxoglutarate dehydrogenase (succinyl-transferring)...

mitochondrion,mitochondrial matrix,mitochondrial m...

9

77

124

QILLPFR.2|SWDIFFR.2|DMVGQVAITR.2|DM[Oxi]VGQVAITR.2...

SEN / CTL

Q9UHA4

Ragulator complex protein LAMTOR3

LAMTOR3

0.33

0.46

0.0458

0.0186

MAPK cascade,activation of MAPKK activity,cell cyc...

protein binding,kinase activator activity,guanyl-n...

lysosomal membrane,focal adhesion,endosome membran...

6

5

12

ELAPLFEELR.2|VANDNAPEHALRPGFLSTFALATDQGSK.4|VANDNA...

SEN / CTL

O95782

AP-2 complex subunit alpha-1

AP2A1

0.33

0.6

0.13

0.0439

intracellular protein transport,Golgi to endosome ...

protein binding,protein C-terminus binding,protein...

cytosol,plasma membrane,membrane,basolateral plasm...

15

46

65

LVEC[CAM]LETVLNK.2|HLC[CAM]ELLAQQF.2|TC[CAM]VSLAVS...

SEN / CTL

Q01518

Adenylyl cyclase-associated protein 1

CAP1

0.32

0.63

3.7e-7

6.75e-7

cell morphogenesis,ameboidal-type cell migration,r...

actin binding,adenylate cyclase binding

plasma membrane,focal adhesion,cortical actin cyto...

63

51

99

C[CAM]VNTTLQIK.2|NSLDC[CAM]EIVSAK.2|LSDLLAPISEQIKE...

SEN / CTL

P00558

Phosphoglycerate kinase 1

PGK1

0.32

0.66

0.00000103

0.00000171

gluconeogenesis,phosphorylation,epithelial cell di...

phosphoglycerate kinase activity,ATP binding

cytosol,membrane,membrane raft,extracellular exoso...

162

59

126

AC[CAM]ANPAAGSVILLENLR.3|AC[CAM]ANPAAGSVILLENLR.2|...

SEN / CTL

O60784

Target of Myb protein 1

TOM1

0.32

0.18

0.0169

0.00818

intracellular protein transport,endocytosis,protei...

protein binding,clathrin binding

cytoplasm,endosome,early endosome,cytosol,membrane...

6

20

27

LRSELEMVSGNVR.3|LRSELEMVSGNVR.2|VLNLIQSWADAFR.2|VL...

SEN / CTL

O43504

Ragulator complex protein LAMTOR5

LAMTOR5

0.32

0.12

0.0622

0.0241

cell cycle arrest,regulation of cell size,response...

protein binding,guanyl-nucleotide exchange factor ...

lysosome,lysosomal membrane,cytosol,Ragulator comp...

3

4

6

GTLSDEHAGVISVLAQQAAK.3|GTLSDEHAGVISVLAQQAAK.2|HDGI...

SEN / CTL

Q9Y3C8

Ubiquitin-fold modifier-conjugating enzyme 1

UFC1

0.32

0.7

0.104

0.0368

response to endoplasmic reticulum stress,protein u...

protein binding,UFM1 transferase activity

cytoplasm,extracellular exosome

6

5

8

IC[CAM]LTDHFKPLWAR.3|IC[CAM]LTDHFKPLWAR.4|C[CAM]WY...

SEN / CTL

Q13753

Laminin subunit gamma-2

LAMC2

0.32

1.05

0.139

0.046

cell adhesion,positive regulation of cell prolifer...

heparin binding

extracellular region,laminin-2 complex,extracellul...

27

14

15

LDPVYFVAPAK.2|GGRHPSAHDVILEGAGLR.4|AQGGDGVVPDTELEG...

SEN / CTL

Q8WUM4

Programmed cell death 6-interacting protein

PDCD6IP

0.31

0.35

0.00000287

0.00000425

cell separation after cytokinesis,apoptotic proces...

protein binding,proteinase activated receptor bind...

immunological synapse,cytoplasm,microtubule organi...

54

63

96

FYNELTEILVR.2|LANQAADYFGDAFK.2|FIQQTYPSGGEEQAQYC[C...

SEN / CTL

O15144

Actin-related protein 2/3 complex subunit 2

ARPC2

0.31

0.66

0.0000326

0.000036

movement of cell or subcellular component,positive...

structural constituent of cytoskeleton,protein bin...

cytoplasm,endosome,Golgi apparatus,cytosol,Arp2/3 ...

33

36

60

ASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPR.5|ASHTAPQ...

SEN / CTL

P20073

Annexin A7

ANXA7

0.31

0.31

0.0000905

0.0000908

cellular calcium ion homeostasis,autophagy,hemosta...

integrin binding,calcium ion binding,protein bindi...

nucleus,nuclear envelope,endoplasmic reticulum mem...

30

23

33

VLIEILC[CAM]TR.2|EFSGYVESGLK.2|GFGTDEQAIVDVVANR.3|...

SEN / CTL

P13674

Prolyl 4-hydroxylase subunit alpha-1

P4HA1

0.31

0.37

0.00379

0.0024

peptidyl-proline hydroxylation to 4-hydroxy-L-prol...

procollagen-proline 4-dioxygenase activity,iron io...

mitochondrion,endoplasmic reticulum,endoplasmic re...

24

32

47

LTSTATKDPEGFVGHPVNAFK.4|LTSTATKDPEGFVGHPVNAFK.3|SA...

SEN / CTL

P04080

Cystatin-B

CSTB

0.31

0.35

0.0175

0.00842

adult locomotory behavior,negative regulation of p...

protease binding,endopeptidase inhibitor activity,...

extracellular space,nucleolus,cytoplasm,extracellu...

15

8

11

VHVGDEDFVHLR.3|VHVGDEDFVHLR.2|VFQSLPHENKPLTLSNYQTN...

SEN / CTL

P61019

Ras-related protein Rab-2A

RAB2A

0.31

0.75

0.0276

0.0124

Golgi organization,small GTPase mediated signal tr...

GTPase activity,protein binding,GTP binding,GDP bi...

Golgi membrane,nucleus,lysosomal membrane,endoplas...

12

17

32

LQIWDTAGQESFR.2|LQIWDTAGQESFR.3|GAAGALLVYDITRR.3|G...

SEN / CTL

P28838

Cytosol aminopeptidase

LAP3

0.31

0.46

0.109

0.038

proteolysis

aminopeptidase activity,metalloexopeptidase activi...

nucleus,nucleoplasm,cytoplasm,mitochondrion,trans-...

15

44

80

GITFDSGGISIK.2|TLIEFLLR.2|LNLPINIIGLAPLC[CAM]ENMPS...

SEN / CTL

P30048

Thioredoxin-dependent peroxide reductase, mitochondrial

PRDX3

0.3

0.26

0.00000162

0.00000258

response to reactive oxygen species,maternal place...

protein binding,protein C-terminus binding,thiored...

cytoplasm,mitochondrion,mitochondrial matrix,early...

30

19

41

GLFIIDPNGVIK.2|DYGVLLEGSGLALR.2|DYGVLLEGSGLALR.3|H...

SEN / CTL

P78371

T-complex protein 1 subunit beta

CCT2

0.3

0.66

0.0000336

0.0000369

protein folding,binding of sperm to zona pellucida...

protein binding,ATP binding,ubiquitin protein liga...

zona pellucida receptor complex,cytoplasm,cytosol,...

54

49

108

LAVEAVLR.2|LTSFIGAIAIGDLVK.2|LTSFIGAIAIGDLVK.3|GAT...

SEN / CTL

O95336

6-phosphogluconolactonase

PGLS

0.3

0.3

0.00062

0.000503

carbohydrate metabolic process,pentose-phosphate s...

6-phosphogluconolactonase activity

cytosol,extracellular exosome

33

19

31

TVIFVATGEGK.2|LC[CAM]WFLDEAAAR.2|WTLGFC[CAM]DER.2|...

SEN / CTL

Q13200

26S proteasome non-ATPase regulatory subunit 2

PSMD2

0.3

0.95

0.00604

0.00354

MAPK cascade,protein polyubiquitination,stimulator...

protein binding,enzyme regulator activity,endopept...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

27

63

112

LNILDTLSK.2|MLVTFDEELRPLPVSVR.3|M[Oxi]LVTFDEELRPLP...

SEN / CTL

Q9NYL9

Tropomodulin-3

TMOD3

0.3

0.44

0.0645

0.0248

muscle contraction,actin filament organization,myo...

actin binding,tropomyosin binding,cadherin binding...

striated muscle thin filament,cell-cell junction,c...

6

22

36

ILPVFDEPPNPTNVEESLKR.3|FGYQFTQQGPR.2|QKPVQTFTEEK.3...

SEN / CTL

P06576

ATP synthase subunit beta, mitochondrial

ATP5B

0.29

0.44

5.75e-8

1.22e-7

angiogenesis,osteoblast differentiation,generation...

transporter activity,protein binding,ATP binding,t...

nucleus,mitochondrion,mitochondrial proton-transpo...

120

47

115

AIAELGIYPAVDPLDSTSR.2|AIAELGIYPAVDPLDSTSR.3|AHGGYS...

SEN / CTL

P31939

Bifunctional purine biosynthesis protein PURH

ATIC

0.29

0.3

0.00000689

0.00000921

brainstem development,nucleobase-containing compou...

IMP cyclohydrolase activity,phosphoribosylaminoimi...

mitochondrion,cytosol,cell-cell adherens junction,...

27

53

87

LDFNLIR.2|TVASPGVTVEEAVEQIDIGGVTLLR.3|TVASPGVTVEEA...

SEN / CTL

Q04446

1,4-alpha-glucan-branching enzyme

GBE1

0.29

0.46

0.000997

0.000759

glycogen metabolic process,glycogen biosynthetic p...

1,4-alpha-glucan branching enzyme activity,hydrola...

cytosol,extracellular exosome

42

32

48

LITHGLGGEGYLNFM[Oxi]GNEFGHPEWLDFPR.4|LITHGLGGEGYLN...

SEN / CTL

P62263

40S ribosomal protein S14

RPS14

0.29

0.43

0.00126

0.000928

ribosomal small subunit assembly,negative regulati...

RNA binding,structural constituent of ribosome,pro...

nucleoplasm,nucleolus,cytoplasm,mitochondrion,cyto...

15

15

31

IGRIEDVTPIPSDSTR.3|IGRIEDVTPIPSDSTR.2|VKADRDESSPYA...

SEN / CTL

P50990

T-complex protein 1 subunit theta

CCT8

0.29

1.33

0.065

0.025

protein folding,binding of sperm to zona pellucida...

protein binding,ATP binding,ATPase activity, coupl...

zona pellucida receptor complex,nucleoplasm,cytopl...

60

59

110

FAEAFEAIPR.2|LATNAAVTVLR.2|DIDEVSSLLR.2|AIADTGANVV...

SEN / CTL

Q15642

Cdc42-interacting protein 4

TRIP10

0.29

0.49

0.1

0.0358

endocytosis,cell communication,signal transduction...

ARF guanyl-nucleotide exchange factor activity,GTP...

phagocytic cup,nucleoplasm,cytoplasm,lysosome,tran...

6

25

32

ELVAENLSVR.2|LGAGYGLLSEAELEVVPIIAK.3|LGAGYGLLSEAEL...

SEN / CTL

Q9NQW7

Xaa-Pro aminopeptidase 1

XPNPEP1

0.28

0.27

0.0000279

0.0000317

proteolysis,bradykinin catabolic process

aminopeptidase activity,manganese ion binding,prot...

cytoplasm,extracellular exosome

21

33

49

VGVDPLIIPTDYWK.2|QEALEWLIR.2|MGLKDTPTQEDWLVSVLPEGS...

SEN / CTL

P53621

Coatomer subunit alpha

COPA

0.28

0.46

0.000979

0.000751

intracellular protein transport,ER to Golgi vesicl...

hormone activity,structural molecule activity

Golgi membrane,extracellular space,cytoplasm,endop...

30

92

167

SSGLTAVWVAR.2|VTTVTEIGKDVIGLR.3|VTTVTEIGKDVIGLR.2|...

SEN / CTL

P62829

60S ribosomal protein L23

RPL23

0.28

0.43

0.00405

0.0025

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,poly(A) RNA bin...

nucleolus,cytoplasm,cytosol,ribosome,focal adhesio...

12

14

27

NLYIISVK.2|ISLGLPVGAVINC[CAM]ADNTGAK.2|ISLGLPVGAVI...

SEN / CTL

Q99798

Aconitate hydratase, mitochondrial

ACO2

0.28

0.61

0.00891

0.00488

generation of precursor metabolites and energy,tri...

aconitate hydratase activity,iron ion binding,3 ir...

nucleus,mitochondrion,mitochondrial matrix,myelin ...

42

75

142

VAGILTVK.2|NAVTQEFGPVPDTAR.2|NAVTQEFGPVPDTAR.3|WVV...

SEN / CTL

Q16698

2,4-dienoyl-CoA reductase, mitochondrial

DECR1

0.28

0.13

0.0263

0.0119

fatty acid beta-oxidation,protein homotetramerizat...

2,4-dienoyl-CoA reductase (NADPH) activity,oxidore...

nucleus,nucleoplasm,cytoplasm,mitochondrion,mitoch...

3

26

42

VAGHPNIVINNAAGNFISPTER.3|VAGHPNIVINNAAGNFISPTER.4|...

SEN / CTL

P32321

Deoxycytidylate deaminase

DCTD

0.28

0.34

0.134

0.0448

pyrimidine nucleotide metabolic process,nucleotide...

dCMP deaminase activity,protein binding,zinc ion b...

cytosol,extracellular exosome

9

11

17

LIIQAGIK.2|LLFNMAGVTFR.2|LLFNMAGVTFR.3|LLFNM[Oxi]A...

SEN / CTL

P26641

Elongation factor 1-gamma

EEF1G

0.27

0.37

0.000342

0.0003

translational elongation,glutathione metabolic pro...

translation elongation factor activity,glutathione...

nucleus,cytoplasm,cytosol,cell-cell adherens junct...

30

36

59

ILGLLDAYLK.2|ALIAAQYSGAQVR.2|ALIAAQYSGAQVR.3|STFVL...

SEN / CTL

Q13751

Laminin subunit beta-3

LAMB3

0.27

0.73

0.0476

0.0192

cell adhesion,epidermis development,extracellular ...

structural molecule activity,protein binding,prote...

extracellular region,laminin-5 complex

6

11

11

AHAVEGQVEDVVGNLR.3|C[CAM]LC[CAM]LPNVVGPK.2|C[CAM]D...

SEN / CTL

P23526

Adenosylhomocysteinase

AHCY

0.27

0.37

0.118

0.0407

sulfur amino acid metabolic process,response to hy...

adenosylhomocysteinase activity,protein binding,ad...

nucleus,cytoplasm,cytosol,melanosome,neuron projec...

30

34

62

VADIGLAAWGR.2|VAVVAGYGDVGKGC[CAM]AQALR.3|IILLAEGR....

SEN / CTL

P15144

Aminopeptidase N

ANPEP

0.26

0.74

0.0000786

0.0000801

angiogenesis,proteolysis,cell differentiation,pept...

virus receptor activity,aminopeptidase activity,re...

extracellular space,lysosomal membrane,endoplasmic...

102

60

99

ELWILNR.2|YRLPNTLKPDSYR.4|YRLPNTLKPDSYR.3|QQQDYWLI...

SEN / CTL

P08238

Heat shock protein HSP 90-beta

HSP90AB1

0.26

0.85

0.00498

0.00298

placenta development,protein folding,response to u...

glycoprotein binding,UTP binding,CTP binding,doubl...

nucleoplasm,cytoplasm,mitochondrion,lysosomal memb...

186

84

175

GVVDSEDLPLNISR.2|GVVDSEDLPLNISR.3|ELISNASDALDKIR.3...

SEN / CTL

O15145

Actin-related protein 2/3 complex subunit 3

ARPC3

0.26

1.66

0.0925

0.0336

movement of cell or subcellular component,Arp2/3 c...

structural constituent of cytoskeleton,protein bin...

cytosol,Arp2/3 protein complex,focal adhesion,acti...

18

16

27

AYLQQLR.2|PAYHSSLMDPDTKLIGNMALLPIR.4|ETKDTDIVDEAIY...

SEN / CTL

P05787

Keratin, type II cytoskeletal 8

KRT8

0.26

1.01

0.138

0.0458

viral process,tumor necrosis factor-mediated signa...

structural molecule activity,protein binding,prote...

nucleus,nucleoplasm,cytoplasm,intermediate filamen...

105

65

157

LALDIEIATYR.2|LSELEAALQR.2|ASLEAAIADAEQRGELAIKDANA...

SEN / CTL

Q13813

Spectrin alpha chain, non-erythrocytic 1

SPTAN1

0.25

0.68

2.5e-9

7.1e-9

MAPK cascade,ER to Golgi vesicle-mediated transpor...

actin binding,Ras guanyl-nucleotide exchange facto...

cytosol,cell-cell adherens junction,spectrin,micro...

225

282

447

ETENVKSSEEIESAFR.3|LQQLFRDVEDEETWIR.3|FLSDFRDLMSWI...

SEN / CTL

P55072

Transitional endoplasmic reticulum ATPase

VCP

0.25

0.44

0.0000123

0.0000153

DNA repair,double-strand break repair,NADH metabol...

protein binding,ATP binding,lipid binding,ATPase a...

proteasome complex,nucleus,nucleoplasm,cytoplasm,e...

201

94

187

ELQELVQYPVEHPDKFLK.4|ELQELVQYPVEHPDKFLK.3|LDQLIYIP...

SEN / CTL

Q96KP4

Cytosolic non-specific dipeptidase

CNDP2

0.25

0.75

0.0000304

0.0000339

sulfur amino acid metabolic process,proteolysis,gl...

carboxypeptidase activity,zinc ion binding,metallo...

nucleoplasm,cytoplasm,cytosol,extracellular exosom...

114

44

84

TVFGVEPDLTR.2|WVAIQSVSAWPEK.2|WVAIQSVSAWPEK.3|EGGS...

SEN / CTL

P13639

Elongation factor 2

EEF2

0.25

1.02

0.0000858

0.0000865

hematopoietic progenitor cell differentiation,resp...

p53 binding,translation elongation factor activity...

nucleus,cytoplasm,cytosol,plasma membrane,cell-cel...

144

84

183

VFSGLVSTGLK.2|EGIPALDNFLDKL.2|AYLPVNESFGFTADLR.3|A...

SEN / CTL

Q15365

Poly(rC)-binding protein 1

PCBP1

0.25

0.35

0.000236

0.000215

mRNA splicing, via spliceosome,gene expression,vir...

RNA polymerase II transcription factor activity, s...

nucleoplasm,cytoplasm,cell-cell adherens junction,...

30

15

49

AITIAGVPQSVTEC[CAM]VK.2|AITIAGVPQSVTEC[CAM]VK.3|II...

SEN / CTL

P50452

Serpin B8

SERPINB8

0.25

0.01

0.00246

0.00164

negative regulation of endopeptidase activity

serine-type endopeptidase inhibitor activity,prote...

extracellular space,cytosol,extracellular exosome

3

13

14

ISEVLDAGTVDPLTK.2|RLGMIDAFDEAK.3|TGTQYLLR.2|LEESYD...

SEN / CTL

Q00688

Peptidyl-prolyl cis-trans isomerase FKBP3

FKBP3

0.25

0.3

0.00346

0.00222

protein peptidyl-prolyl isomerization,chaperone-me...

peptidyl-prolyl cis-trans isomerase activity,recep...

nucleus,endoplasmic reticulum membrane

27

19

30

AWTVEQLRSEQLPK.3|ARLEIEPEWAYGK.3|ARLEIEPEWAYGK.2|V...

SEN / CTL

P06396

Gelsolin

GSN

0.25

1.24

0.0316

0.0138

phagocytosis, engulfment,positive regulation of ge...

actin binding,calcium ion binding,protein binding,...

podosome,extracellular region,extracellular space,...

51

53

102

QTQVSVLPEGGETPLFK.2|QTQVSVLPEGGETPLFK.3|FDLVPVPTNL...

SEN / CTL

P21333

Filamin-A

FLNA

0.25

1.06

0.0438

0.0179

platelet degranulation,adenylate cyclase-inhibitin...

G-protein coupled receptor binding,glycoprotein bi...

extracellular region,nucleus,nucleolus,cytoplasm,c...

453

207

388

YGGDEIPFSPYR.2|EATTEFSVDAR.2|FGGEHVPNSPFQVTALAGDQP...

SEN / CTL

Q9NZA1

Chloride intracellular channel protein 5

CLIC5

0.25

0.46

0.0547

0.0217

diet induced thermogenesis,transport,chloride tran...

voltage-gated ion channel activity,chloride channe...

Golgi apparatus,microtubule organizing center,cell...

15

13

16

FLDGDELTLADC[CAM]NLLPK.2|FLDGDELTLADC[CAM]NLLPK.3|...

SEN / CTL

P30837

Aldehyde dehydrogenase X, mitochondrial

ALDH1B1

0.25

0.41

0.059

0.0231

carbohydrate metabolic process,ethanol catabolic p...

aldehyde dehydrogenase (NAD) activity

nucleoplasm,mitochondrion,mitochondrial matrix,int...

21

31

51

YGLAAAVFTR.2|LAPALATGNTVVMK.2|LAPALATGNTVVM[Oxi]K....

SEN / CTL

P05023

Sodium/potassium-transporting ATPase subunit alpha-1

ATP1A1

0.24

0.77

0.000106

0.000105

regulation of the force of heart contraction,regul...

sodium:potassium-exchanging ATPase activity,protei...

endosome,endoplasmic reticulum,Golgi apparatus,pla...

39

62

112

IISANGC[CAM]KVDNSSLTGESEPQTR.3|AVAGDASESALLK.2|AVA...

SEN / CTL

P48444

Coatomer subunit delta

ARCN1

0.24

0.28

0.000164

0.000158

intracellular protein transport,ER to Golgi vesicl...

poly(A) RNA binding

Golgi membrane,cytoplasm,endoplasmic reticulum mem...

21

40

66

VLLAAAVC[CAM]TK.2|LYMVLITTK.2|LFTAESLIGLKNPEK.3|LF...

SEN / CTL

P30740

Leukocyte elastase inhibitor

SERPINB1

0.24

0.37

0.000384

0.000331

negative regulation of endopeptidase activity

serine-type endopeptidase inhibitor activity

extracellular space,cytoplasm,membrane,extracellul...

30

24

41

LGVQDLFNSSK.2|TFHFNTVEEVHSR.4|TFHFNTVEEVHSR.3|TYNF...

SEN / CTL

O43242

26S proteasome non-ATPase regulatory subunit 3

PSMD3

0.24

0.29

0.00124

0.00092

MAPK cascade,protein polyubiquitination,stimulator...

protein binding,enzyme regulator activity

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

18

43

64

VYEFLDKLDVVR.3|VYEFLDKLDVVR.2|HDADGQATLLNLLLR.3|HD...

SEN / CTL

Q13561

Dynactin subunit 2

DCTN2

0.24

0.37

0.00765

0.00428

G2/M transition of mitotic cell cycle,ER to Golgi ...

motor activity,protein binding,spectrin binding

kinetochore,cytoplasm,centrosome,cytosol,dynactin ...

36

28

43

LLLQLEATK.2|WSPIASTLPELVQR.2|LLGPDAAINLTDPDGALAKR....

SEN / CTL

P49588

Alanine--tRNA ligase, cytoplasmic

AARS

0.24

0.27

0.00864

0.00476

hair follicle development,tRNA modification,tRNA a...

tRNA binding,aminoacyl-tRNA editing activity,alani...

cytoplasm,cytosol,membrane,extracellular exosome,m...

18

62

112

NVGC[CAM]LQEALQLATSFAQLR.3|NVGC[CAM]LQEALQLATSFAQL...

SEN / CTL

P61421

V-type proton ATPase subunit d 1

ATP6V0D1

0.24

0.95

0.0111

0.00581

vacuolar transport,vacuolar acidification,brain de...

protein binding,hydrogen-exporting ATPase activity...

lysosomal membrane,early endosome,synaptic vesicle...

18

16

21

LYPEGLAQLAR.2|LYPEGLAQLAR.3|AKIDNYIPIF.2|NIVWIAEC[...

SEN / CTL

P38606

V-type proton ATPase catalytic subunit A

ATP6V1A

0.23

0.43

8.21e-7

0.00000141

transport,insulin receptor signaling pathway,ATP h...

ATP binding,proton-transporting ATPase activity, r...

mitochondrion,lysosomal membrane,cytosol,plasma me...

42

53

91

QVRPVTEKLPANHPLLTGQR.4|AKEILQEEEDLAEIVQLVGK.3|AKEI...

SEN / CTL

P54819

Adenylate kinase 2, mitochondrial

AK2

0.23

0.35

0.000712

0.000567

ADP biosynthetic process,nucleobase-containing sma...

adenylate kinase activity,ATP binding

mitochondrial inner membrane,mitochondrial interme...

39

28

55

NGFLLDGFPR.2|GIHSAIDASQTPDVVFASILAAFSK.3|GIHSAIDAS...

SEN / CTL

P29692

Elongation factor 1-delta

EEF1D

0.23

0.39

0.0171

0.00828

transcription, DNA-templated,regulation of transcr...

DNA binding,translation elongation factor activity...

nucleus,nucleolus,cytoplasm,cytosol,eukaryotic tra...

18

24

46

LVPVGYGIR.2|SIQLDGLVWGASK.2|SIQLDGLVWGASK.3|IASLEV...

SEN / CTL

O00622

Protein CYR61

CYR61

0.23

1.11

0.052

0.0207

regulation of cell growth,osteoblast differentiati...

integrin binding,insulin-like growth factor bindin...

proteinaceous extracellular matrix,extracellular m...

36

17

20

GLEC[CAM]NFGASSTALK.2|C[CAM]APGVGLVR.2|HQC[CAM]TC[...

SEN / CTL

Q9Y230

RuvB-like 2

RUVBL2

0.23

0.76

0.0856

0.0317

box C/D snoRNP assembly,DNA repair,DNA recombinati...

RNA polymerase II core promoter sequence-specific ...

Swr1 complex,intracellular,nucleus,nucleoplasm,nuc...

24

42

67

GLGLDDALEPR.2|IGLETSLR.2|ALESDMAPVLIMATNR.3|ALESDM...

SEN / CTL

P21589

5'-nucleotidase

NT5E

0.23

0.56

0.0889

0.0326

purine nucleotide catabolic process,AMP catabolic ...

nucleotide binding,5'-nucleotidase activity,metal ...

cytoplasm,plasma membrane,cell surface,membrane,an...

30

28

42

TIVYLDGSSQSC[CAM]R.2|EVPAGKYPFIVTSDDGR.3|VLPVGDEVV...

SEN / CTL

Q9UL46

Proteasome activator complex subunit 2

PSME2

0.23

0.96

0.102

0.0363

MAPK cascade,protein polyubiquitination,stimulator...

endopeptidase activator activity

proteasome complex,nucleoplasm,cytoplasm,cytosol,p...

36

23

36

QNLFQEAEEFLYR.2|QNLFQEAEEFLYR.3|ALVHERDEAAYGELR.4|...

SEN / CTL

P13489

Ribonuclease inhibitor

RNH1

0.23

0.7

0.131

0.0443

mRNA catabolic process,negative regulation of cata...

protein binding,ribonuclease inhibitor activity

nucleoplasm,cytoplasm,angiogenin-PRI complex,extra...

84

31

55

VNPALAELNLR.2|VNPALAELNLR.3|WAELLPLLQQC[CAM]QVVR.2...

SEN / CTL

P01024

Complement C3

C3

0.22

0.59

1.18e-7

2.33e-7

positive regulation of type IIa hypersensitivity,p...

serine-type endopeptidase activity,endopeptidase i...

extracellular region,extracellular space,plasma me...

153

130

202

LVAYYTLIGASGQR.3|LVAYYTLIGASGQR.2|QVREPGQDLVVLPLSI...

SEN / CTL

Q93052

Lipoma-preferred partner

LPP

0.22

0.69

0.0246

0.0113

cell adhesion,biological_process

protein binding,zinc ion binding

nucleus,cytoplasm,plasma membrane,focal adhesion

21

28

50

KTYITDPVSAPC[CAM]APPLQPK.3|METTHSFGNPSISVSTQQPPKK....

SEN / CTL

Q99832

T-complex protein 1 subunit eta

CCT7

0.22

0.75

0.152

0.0493

protein folding,binding of sperm to zona pellucida...

protein binding,ATP binding,identical protein bind...

zona pellucida receptor complex,cytoplasm,mitochon...

30

48

102

INALTAASEAAC[CAM]LIVSVDETIKNPR.3|INALTAASEAAC[CAM]...

SEN / CTL

P55268

Laminin subunit beta-2

LAMB2

0.21

0.49

0.00996

0.00529

cell adhesion,axon guidance,neuromuscular junction...

integrin binding,structural molecule activity

extracellular region,basement membrane,basal lamin...

15

53

60

SLADVDAILAR.2|TGGSAQPETPYSGPGLLIDSLVLLPR.3|GAVADTR...

SEN / CTL

P62888

60S ribosomal protein L30

RPL30

0.21

0.24

0.011

0.00574

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,cytoplasm,cytosol,focal adhesion,membrane,...

12

10

19

VC[CAM]TLAIIDPGDSDIIR.2|VC[CAM]TLAIIDPGDSDIIR.3|LV...

SEN / CTL

Q13011

Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial

ECH1

0.21

0.35

0.0302

0.0133

fatty acid beta-oxidation,fatty acid catabolic pro...

receptor binding,isomerase activity

mitochondrion,peroxisome,membrane,extracellular ex...

24

26

53

YQETFNVIER.2|VIGNQSLVNELAFTAR.2|VIGNQSLVNELAFTAR.3...

SEN / CTL

Q9H0E2

Toll-interacting protein

TOLLIP

0.21

0.77

0.036

0.0152

autophagy,inflammatory response,signal transductio...

signal transducer activity,interleukin-1, Type I r...

cytoplasm,cytosol,nuclear body,interleukin-18 rece...

9

10

12

GPVYIGELPQDFLR.2|LNITVVQAK.2|IAWTHITIPESLR.3|IAWTH...

SEN / CTL

O43390

Heterogeneous nuclear ribonucleoprotein R

HNRNPR

0.21

0.69

0.0887

0.0325

mRNA splicing, via spliceosome,mRNA processing,cir...

nucleotide binding,RNA binding,mRNA 3'-UTR binding...

nucleoplasm,spliceosomal complex,endoplasmic retic...

12

33

51

GYAFITFC[CAM]GK.2|NLATTVTEEILEK.2|NLATTVTEEILEK.3|...

SEN / CTL

Q8N2S1

Latent-transforming growth factor beta-binding protein 4

LTBP4

0.21

0.36

0.0947

0.0341

regulation of cell growth,protein folding,transmem...

transforming growth factor beta-activated receptor...

extracellular region,proteinaceous extracellular m...

15

10

11

GGYTC[CAM]VC[CAM]PDGFLLDSSR.2|IQQC[CAM]PGTETAEYQSL...

SEN / CTL

Q14554

Protein disulfide-isomerase A5

PDIA5

0.21

1.25

0.104

0.037

protein folding,response to endoplasmic reticulum ...

protein disulfide isomerase activity,oxidoreductas...

endoplasmic reticulum lumen,endoplasmic reticulum ...

6

26

32

GFPTIC[CAM]YFEK.2|FHISEFPTLK.3|FHISEFPTLK.2|VIPHFT...

SEN / CTL

O94760

N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

DDAH1

0.21

0.36

0.132

0.0444

citrulline metabolic process,regulation of systemi...

catalytic activity,dimethylargininase activity,ami...

mitochondrion,cytosol,extracellular exosome

9

21

37

QHQLYVGVLGSK.3|QHQLYVGVLGSK.2|GAEILADTFKDYAVSTVPVA...

SEN / CTL

P26885

Peptidyl-prolyl cis-trans isomerase FKBP2

FKBP2

0.2

0.22

0.0124

0.0064

protein peptidyl-prolyl isomerization,chaperone-me...

peptidyl-prolyl cis-trans isomerase activity,FK506...

endoplasmic reticulum,endoplasmic reticulum membra...

12

13

21

LVIPSELGYGER.2|GAPPKIPGGATLVFEVELLKIER.4|KLVIPSELG...

SEN / CTL

P21399

Cytoplasmic aconitate hydratase

ACO1

0.2

0.68

0.0194

0.00914

tricarboxylic acid cycle,citrate metabolic process...

RNA binding,aconitate hydratase activity,protein b...

cytoplasm,mitochondrion,endoplasmic reticulum,Golg...

54

42

66

VLLEAAIR.2|FVEFFGPGVAQLSIADR.2|FVEFFGPGVAQLSIADR.3...

SEN / CTL

P42766

60S ribosomal protein L35

RPL35

0.2

0.22

0.0478

0.0193

nuclear-transcribed mRNA catabolic process, nonsen...

mRNA binding,structural constituent of ribosome,po...

nucleolus,cytoplasm,cytosol,membrane,cytosolic lar...

6

8

10

QLDDLKVELSQLR.3|QLDDLKVELSQLR.2|KYKPLDLRPK.3|RLNKH...

SEN / CTL

Q9NR45

Sialic acid synthase

NANS

0.2

0.31

0.0604

0.0236

lipopolysaccharide biosynthetic process

N-acylneuraminate cytidylyltransferase activity,N-...

cytoplasm,cytosol,extracellular exosome

6

23

39

GSDHSASLEPGELAELVR.3|GSDHSASLEPGELAELVR.2|PLELELC[...

SEN / CTL

P46783

40S ribosomal protein S10

RPS10

0.2

0.39

0.1

0.0358

ribosomal small subunit assembly,nuclear-transcrib...

structural constituent of ribosome,protein binding...

nucleoplasm,nucleolus,cytosol,ribosome,focal adhes...

6

15

25

IAIYELLFK.2|KAEAGAGSATEFQFR.3|KAEAGAGSATEFQFR.2|HP...

SEN / CTL

P11216

Glycogen phosphorylase, brain form

PYGB

0.19

0.76

0.0000333

0.0000367

glycogen catabolic process

protein binding,glycogen phosphorylase activity,py...

cytoplasm,membrane,extracellular exosome

42

65

111

VIFLENYR.2|VLYPNDNFFEGK.2|LAAC[CAM]FLDSMATLGLAAYGY...

SEN / CTL

O15460

Prolyl 4-hydroxylase subunit alpha-2

P4HA2

0.19

0.33

0.00877

0.00482

peptidyl-proline hydroxylation,oxidation-reduction...

procollagen-proline 4-dioxygenase activity,iron io...

nucleus,cytoplasm,endoplasmic reticulum,endoplasmi...

18

21

24

SSWLEEDDDPVVAR.2|YYDVMSDEEIER.2|KGTAVFWYNLLR.3|SAA...

SEN / CTL

P09525

Annexin A4

ANXA4

0.19

0.73

0.0112

0.00586

regulation of transcription from RNA polymerase II...

phospholipase inhibitor activity,calcium ion bindi...

nucleus,cytoplasm,plasma membrane,cell surface,ves...

96

45

70

GLGTDEDAIISVLAYR.2|GLGTDEDAIISVLAYR.3|GAGTDEGC[CAM...

SEN / CTL

P48643

T-complex protein 1 subunit epsilon

CCT5

0.19

0.61

0.122

0.0419

protein folding,binding of sperm to zona pellucida...

protein binding,ATP binding,G-protein beta-subunit...

zona pellucida receptor complex,nucleolus,cytoplas...

45

49

103

AVTIFIR.2|WVGGPEIELIAIATGGR.2|WVGGPEIELIAIATGGR.3|...

SEN / CTL

P46781

40S ribosomal protein S9

RPS9

0.19

0.42

0.129

0.0438

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,protein binding...

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,ri...

9

19

26

QVVNIPSFIVR.2|QVVNIPSFIVR.3|KQVVNIPSFIVR.3|KQVVNIP...

SEN / CTL

P04899

Guanine nucleotide-binding protein G(i) subunit alpha-2

GNAI2

0.18

0.41

8.03e-8

1.63e-7

activation of MAPKK activity,adenosine receptor si...

G-protein coupled receptor binding,GTPase activity...

nucleoplasm,cytoplasm,centrosome,cytosol,heterotri...

33

27

44

IAQSDYIPTQQDVLR.2|IAQSDYIPTQQDVLR.3|AMGNLQIDFADPSR...

SEN / CTL

P31948

Stress-induced-phosphoprotein 1

STIP1

0.18

0.31

0.000798

0.000626

response to stress

protein C-terminus binding,Hsp70 protein binding,p...

nucleus,Golgi apparatus,myelin sheath,protein comp...

30

71

131

TLLSDPTYRELIEQLR.3|LMDVGLIAIR.2|LM[Oxi]DVGLIAIR.2|...

SEN / CTL

P37802

Transgelin-2

TAGLN2

0.18

0.56

0.0395

0.0163

epithelial cell differentiation,cell-cell adhesion

cadherin binding involved in cell-cell adhesion

cell-cell adherens junction,vesicle,extracellular ...

84

26

53

QYDADLEQILIQWITTQC[CAM]R.3|QYDADLEQILIQWITTQC[CAM]...

SEN / CTL

O60888

Protein CutA

CUTA

0.17

0.21

0.00126

0.000923

protein localization,response to metal ion

copper ion binding,enzyme binding

membrane,extracellular exosome

21

7

14

TQSSLVPALTDFVR.2|TQSSLVPALTDFVR.3|LAAC[CAM]VNLIPQI...

SEN / CTL

P61160

Actin-related protein 2

ACTR2

0.17

0.51

0.00678

0.00391

movement of cell or subcellular component,establis...

structural constituent of cytoskeleton,ATP binding...

cytoplasm,cytosol,Arp2/3 protein complex,focal adh...

54

23

52

VGNIEIKDLMVGDEASELR.3|GYAFNHSADFETVR.3|GYAFNHSADFE...

SEN / CTL

P62241

40S ribosomal protein S8

RPS8

0.17

0.44

0.00947

0.00509

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,poly(A) RNA bin...

nucleus,nucleoplasm,cytoplasm,cytosol,focal adhesi...

21

23

39

ELEFYLR.2|IIDVVYNASNNELVR.3|IIDVVYNASNNELVR.2|ISSL...

SEN / CTL

P17936

Insulin-like growth factor-binding protein 3

IGFBP3

0.17

0.41

0.033

0.0143

regulation of cell growth,osteoblast differentiati...

fibronectin binding,protein binding,insulin-like g...

extracellular region,extracellular space,nucleus,i...

9

10

13

C[CAM]QPSPDEARPLQALLDGR.3|FLNVLSPR.2|EMEDTLNHLK.3|...

SEN / CTL

Q14192

Four and a half LIM domains protein 2

FHL2

0.17

0.75

0.0579

0.0228

negative regulation of transcription from RNA poly...

transcription coactivator activity,protein binding...

nucleus,nucleoplasm,focal adhesion,actin cytoskele...

21

26

39

GFLTERDDILC[CAM]PDC[CAM]GKDI.3|SFIPKDNQNFC[CAM]VPC...

SEN / CTL

P50502

Hsc70-interacting protein

ST13

0.16

0.42

0.00415

0.00255

protein folding,protein homooligomerization,negati...

protein domain specific binding,Hsp70 protein bind...

cytoplasm,cytosol,protein complex,extracellular ex...

18

19

33

AIDLFTDAIK.2|AIDLFTDAIKLNPR.3|VAAIEALNDGELQK.2|AIE...

SEN / CTL

Q9UNH7

Sorting nexin-6

SNX6

0.16

0.67

0.0364

0.0153

intracellular protein transport,endocytosis,negati...

protein binding,dynactin binding,phosphatidylinosi...

intracellular,nucleus,cytoplasm,cytosol,cytoplasmi...

9

25

36

NLVELAELELK.2|SADGVIVSGVKDVDDFFEHER.4|SADGVIVSGVKD...

SEN / CTL

P54920

Alpha-soluble NSF attachment protein

NAPA

0.16

0.31

0.0894

0.0327

intracellular protein transport,ER to Golgi vesicl...

soluble NSF attachment protein activity,protein bi...

Golgi membrane,vacuolar membrane,cytosol,membrane,...

18

24

43

IEEAC[CAM]EIYAR.2|LAVQKYEELFPAFSDSR.3|LAVQKYEELFPA...

SEN / CTL

O95861

3'(2'),5'-bisphosphate nucleotidase 1

BPNT1

0.16

0.36

0.109

0.0383

nucleobase-containing compound metabolic process,n...

magnesium ion binding,3'(2'),5'-bisphosphate nucle...

cytoplasm,cytosol,extracellular exosome

15

19

27

RVIAEGDLGIVEK.3|RVIAEGDLGIVEK.2|LAQMSIC[CAM]SSLAR....

SEN / CTL

P17931

Galectin-3

LGALS3

0.15

0.33

0.00106

0.000802

monocyte chemotaxis,mRNA processing,RNA splicing,n...

protein binding,IgE binding,carbohydrate binding,c...

immunological synapse,extracellular space,nucleus,...

21

12

19

IALDFQR.2|MLITILGTVKPNANR.3|M[Oxi]LITILGTVKPNANR.3...

SEN / CTL

Q02952

A-kinase anchor protein 12

AKAP12

0.15

1.01

0.00685

0.00393

protein targeting,G-protein coupled receptor signa...

adenylate cyclase binding,protein kinase A binding

cytoplasm,cytoskeleton,plasma membrane,focal adhes...

81

84

109

VKEESQLPGTGGPEDVLQPVQR.3|LVQNIIQTAVDQFVR.2|LVQNIIQ...

SEN / CTL

Q9UNM6

26S proteasome non-ATPase regulatory subunit 13

PSMD13

0.15

0.72

0.11

0.0383

MAPK cascade,protein polyubiquitination,stimulator...

structural molecule activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

18

35

52

FLGC[CAM]VDIKDLPVSEQQER.3|ITVNEVELLVMK.2|ITVNEVELL...

SEN / CTL

P14868

Aspartate--tRNA ligase, cytoplasmic

DARS

0.15

1.07

0.115

0.0399

translation,tRNA aminoacylation for protein transl...

aminoacylase activity,aspartate-tRNA ligase activi...

cytoplasm,cytosol,membrane,extracellular exosome

24

43

70

IYVISLAEPR.2|IGSC[CAM]TQQDVELHVQK.3|IGSC[CAM]TQQDV...

SEN / CTL

P40926

Malate dehydrogenase, mitochondrial

MDH2

0.15

0.41

0.122

0.0419

gluconeogenesis,tricarboxylic acid cycle,oxaloacet...

L-malate dehydrogenase activity,protein self-assoc...

nucleus,nucleoplasm,mitochondrion,mitochondrial in...

93

31

62

SQETEC[CAM]TYFSTPLLLGK.2|SQETEC[CAM]TYFSTPLLLGK.3|...

SEN / CTL

Q9NYU2

UDP-glucose:glycoprotein glucosyltransferase 1

UGGT1

0.15

0.71

0.123

0.0421

protein N-linked glycosylation via asparagine,endo...

UDP-glucose:glycoprotein glucosyltransferase activ...

endoplasmic reticulum,endoplasmic reticulum lumen,...

12

68

110

LGIEGLSLHNVLK.3|LGIEGLSLHNVLK.2|ILETTTFFQR.2|IVPEW...

SEN / CTL

P52907

F-actin-capping protein subunit alpha-1

CAPZA1

0.14

0.46

0.0000425

0.0000459

protein complex assembly,movement of cell or subce...

actin binding,cadherin binding involved in cell-ce...

extracellular region,cytosol,cytoskeleton,cell-cel...

24

20

42

FTITPPTAQVVGVLK.2|FTITPPTAQVVGVLK.3|EASDPQPEEADGGL...

SEN / CTL

P23528

Cofilin-1

CFL1

0.14

0.73

0.0735

0.0276

cytoskeleton organization,Rho protein signal trans...

protein binding,actin filament binding

extracellular space,nucleus,cytoplasm,focal adhesi...

42

22

40

LGGSAVISLEGKPL.2|LGGSAVISLEGKPL.3|NIILEEGKEILVGDVG...

SEN / CTL

P50453

Serpin B9

SERPINB9

0.14

0.34

0.0938

0.0338

mast cell mediated immunity,apoptotic process,immu...

protease binding,serine-type endopeptidase inhibit...

extracellular space,intracellular,nucleus,cytoplas...

15

21

29

LVLVNAIYFK.2|AQLLELPYAR.2|FC[CAM]ADHPFLFFIR.3|FC[C...

SEN / CTL

P61353

60S ribosomal protein L27

RPL27

0.13

0.27

0.133

0.0446

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,poly(A) RNA bin...

nucleus,cytosol,ribosome,focal adhesion,membrane,c...

6

11

19

VVLVLAGR.2|NIDDGTSDRPYSHALVAGIDRYPR.5|NIDDGTSDRPYS...

SEN / CTL

P05556

Integrin beta-1

ITGB1

0.12

0.57

0.0103

0.00543

G1/S transition of mitotic cell cycle,in utero emb...

virus receptor activity,fibronectin binding,protea...

ruffle,cytoplasm,plasma membrane,cell-cell adheren...

45

36

53

LKPEDITQIQPQQLVLR.3|LKPEDITQIQPQQLVLR.2|LKPEDITQIQ...

SEN / CTL

P56537

Eukaryotic translation initiation factor 6

EIF6

0.12

0.4

0.0339

0.0145

ribosomal subunit export from nucleus,maturation o...

translation initiation factor activity,protein bin...

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pr...

24

13

23

HGLLVPNNTTDQELQHIR.4|HGLLVPNNTTDQELQHIR.3|TSIEDQDE...

SEN / CTL

Q9BTY2

Plasma alpha-L-fucosidase

FUCA2

0.12

0.3

0.0752

0.0282

fucose metabolic process,response to bacterium,gly...

alpha-L-fucosidase activity

extracellular space,extracellular exosome

21

12

14

LVYAIFLK.2|EAGISDYLTIEELVK.2|WPTSGQLFLGHPK.3|WPTSG...

SEN / CTL

P07602

Prosaposin

PSAP

0.12

1.36

0.091

0.0332

platelet degranulation,glycosphingolipid metabolic...

G-protein coupled receptor binding,protein binding...

extracellular region,extracellular space,cytoplasm...

51

30

59

SDVYC[CAM]EVC[CAM]EFLVK.2|SDVYC[CAM]EVC[CAM]EFLVK....

SEN / CTL

P15311

Ezrin

EZR

0.11

0.52

0.00897

0.0049

negative regulation of transcription from RNA poly...

actin binding,protein binding,microtubule binding,...

ruffle,immunological synapse,uropod,extracellular ...

72

50

90

QRIDEFEAL.2|GMLKDNAMLEYLK.3|GMLKDNAMLEYLK.2|SQEQLA...

SEN / CTL

Q99613

Eukaryotic translation initiation factor 3 subunit C

EIF3C

0.11

0.76

0.0504

0.0201

formation of translation preinitiation complex,tra...

translation initiation factor binding,poly(A) RNA ...

cytosol,eukaryotic translation initiation factor 3...

12

47

79

GC[CAM]ILTLVER.2|AKELLGQGLLLR.3|AKELLGQGLLLR.2|RLD...

SEN / CTL

P06737

Glycogen phosphorylase, liver form

PYGL

0.1

0.28

0.00113

0.000838

glycogen metabolic process,glycogen catabolic proc...

purine nucleobase binding,protein binding,ATP bind...

cytoplasm,cytosol,plasma membrane,extracellular ex...

36

51

80

LHSFLGDDVFLR.3|LHSFLGDDVFLR.2|IFVDIEKLPWSK.3|IFVDI...

SEN / CTL

Q96QK1

Vacuolar protein sorting-associated protein 35

VPS35

0.1

0.63

0.0909

0.0332

intracellular protein transport,Wnt signaling path...

protein binding,protein transporter activity,D1 do...

lysosomal membrane,endosome,early endosome,late en...

27

41

64

NIIIALIDR.2|IRFTLPPLVFAAYQLAFR.3|SEDPDQQYLILNTAR.2...

SEN / CTL

P52565

Rho GDP-dissociation inhibitor 1

ARHGDIA

0.09

0.4

0.000323

0.000284

movement of cell or subcellular component,negative...

Rho GDP-dissociation inhibitor activity,GTPase act...

cytosol,cytoskeleton,extracellular exosome

57

15

29

AEEYEFLTPVEEAPK.2|AEEYEFLTPVEEAPK.3|SIQEIQELDKDDES...

SEN / CTL

Q15084

Protein disulfide-isomerase A6

PDIA6

0.09

0.23

0.000397

0.00034

protein folding,response to endoplasmic reticulum ...

protein disulfide isomerase activity,protein bindi...

endoplasmic reticulum,endoplasmic reticulum lumen,...

69

32

56

TGEAIVDAALSALR.2|TGEAIVDAALSALR.3|NSYLEVLLK.2|GSFS...

SEN / CTL

P98160

Basement membrane-specific heparan sulfate proteoglycan core protein

HSPG2

0.09

0.82

0.00915

0.00497

retinoid metabolic process,angiogenesis,glycosamin...

calcium ion binding,protein binding,protein C-term...

extracellular region,basement membrane,extracellul...

390

163

239

LLSGPYFWSLPSR.2|LLSGPYFWSLPSR.3|AGLSSGFIGC[CAM]VR....

SEN / CTL

O00231

26S proteasome non-ATPase regulatory subunit 11

PSMD11

0.08

0.61

0.0022

0.0015

MAPK cascade,protein polyubiquitination,stimulator...

structural molecule activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

27

33

53

YQEALHLGSQLLR.3|YQEALHLGSQLLR.2|AQSLLSTDREASIDILHS...

SEN / CTL

P39060

Collagen alpha-1(XVIII) chain

COL18A1

0.08

0.36

0.111

0.0386

angiogenesis,endothelial cell morphogenesis,cell a...

structural molecule activity,metal ion binding

extracellular region,collagen trimer,basement memb...

60

31

46

LQDLYSIVR.2|IFSFDGKDVLR.3|DELLFPSWEALFSGSEGPLKPGAR...

SEN / CTL

P00749

Urokinase-type plasminogen activator

PLAU

0.07

0.24

0.121

0.0417

response to hypoxia,proteolysis,chemotaxis,signal ...

serine-type endopeptidase activity,protein binding

extracellular region,extracellular space,plasma me...

12

6

7

IIGGEFTTIENQPWFAAIYR.3|VSHFLPWIR.2|DYSADTLAHHNDIAL...

SEN / CTL

P13797

Plastin-3

PLS3

0.05

0.49

0.0561

0.0222

actin filament bundle assembly,actin filament netw...

calcium ion binding,actin filament binding

cytoplasm,actin filament,actin filament bundle

33

45

74

AYFHLLNQIAPK.3|AYFHLLNQIAPK.2|VYALPEDLVEVKPK.3|VYA...

SEN / CTL

Q15404

Ras suppressor protein 1

RSU1

0.03

0.53

0.0657

0.0252

signal transduction,positive regulation of cell-su...

protein binding

cytosol,focal adhesion,extracellular exosome

18

19

28

LQILSLRDNDLISLPK.3|LQILSLRDNDLISLPK.2|NLEVLNFFNNQI...

SEN / CTL

P35606

Coatomer subunit beta'

COPB2

0.03

0.56

0.0688

0.0262

intracellular protein transport,ER to Golgi vesicl...

structural molecule activity

Golgi membrane,endoplasmic reticulum membrane,cyto...

15

61

94

TFEVC[CAM]DLPVR.2|TFEVC[CAM]DLPVR.3|KNWVVTGADDMQIR...

SEN / CTL

Q02790

Peptidyl-prolyl cis-trans isomerase FKBP4

FKBP4

0.03

0.51

0.108

0.0378

protein peptidyl-prolyl isomerization,protein fold...

peptidyl-prolyl cis-trans isomerase activity,prote...

nucleoplasm,cytoplasm,mitochondrion,endoplasmic re...

15

58

112

RGEAHLAVNDFELAR.3|RGEAHLAVNDFELAR.4|RGEAHLAVNDFELA...

SEN / CTL

P52788

Spermine synthase

SMS

0.03

0.72

0.146

0.048

methionine metabolic process,polyamine metabolic p...

spermine synthase activity

cytosol,extracellular exosome

24

28

36

LILDLSMK.2|TC[CAM]GDVLDNLKGDC[CAM]YQVLIEDC[CAM]IPV...

SEN / CTL

Q12906

Interleukin enhancer-binding factor 3

ILF3

0.02

0.69

0.0188

0.00892

transcription, DNA-templated,protein phosphorylati...

DNA binding,RNA binding,double-stranded RNA bindin...

nucleus,nucleoplasm,nucleolus,cytoplasm,mitochondr...

21

70

118

SC[CAM]VIVIR.2|C[CAM]LAALASLR.2|HSSVYPTQEELEAVQNMV...

SEN / CTL

P07237

Protein disulfide-isomerase

P4HB

0.01

0.82

0.0137

0.00686

response to reactive oxygen species,peptidyl-proli...

protein disulfide isomerase activity,integrin bind...

extracellular region,endoplasmic reticulum,endopla...

156

62

113

ILFIFIDSDHTDNQR.3|ILFIFIDSDHTDNQR.2|VDATEESDLAQQYG...

SEN / CTL

P42574

Caspase-3

CASP3

0

0.72

0.13

0.044

response to hypoxia,apoptotic DNA fragmentation,pr...

protease binding,aspartic-type endopeptidase activ...

nucleus,nucleoplasm,cytosol,plasma membrane,death-...

12

16

19

LFIIQAC[CAM]R.2|QYADKLEFMHILTR.3|QYADKLEFMHILTR.4|...

SEN / CTL

P45974

Ubiquitin carboxyl-terminal hydrolase 5

USP5

-0.01

1.26

0.000149

0.000144

ubiquitin-dependent protein catabolic process,prot...

cysteine-type endopeptidase activity,thiol-depende...

lysosome

30

54

78

DGLGGLPDIVR.2|DGLGGLPDIVRDR.3|SAADSISESVPVGPK.2|SA...

SEN / CTL

P49720

Proteasome subunit beta type-3

PSMB3

-0.01

0.28

0.137

0.0454

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,m...

18

13

31

FGPYYTEPVIAGLDPK.2|FGPYYTEPVIAGLDPK.3|LYIGLAGLATDV...

SEN / CTL

Q15843

NEDD8

NEDD8

-0.03

0.59

0.0474

0.0192

regulation of transcription from RNA polymerase II...

protein binding,ubiquitin protein ligase binding

nucleus,cytosol,extracellular exosome

15

4

7

ILGGSVLHLVLALR.3|ILGGSVLHLVLALR.2|TLTGKEIEIDIEPTDK...

SEN / CTL

Q9NTK5

Obg-like ATPase 1

OLA1

-0.03

0.52

0.081

0.0301

ATP metabolic process,cell-cell adhesion

ATP binding,GTP binding,ATPase activity,ribosome b...

nucleolus,cytoplasm,centrosome,cell-cell adherens ...

9

38

62

IPAFLNVVDIAGLVK.2|IPAFLNVVDIAGLVK.3|NYIVEDGDIIFFK....

SEN / CTL

P63241

Q6IS14

Eukaryotic translation initiation factor 5A-1;Eukaryotic translation initiation factor 5A-1-like

EIF5A

EIF5AL1

-0.03

0.52

0.116

0.0401

mRNA export from nucleus,translational frameshifti...

RNA binding,translation elongation factor activity...

nucleus,annulate lamellae,nuclear pore,cytoplasm,e...

36

7

21

VHLVGIDIFTGK.3|VHLVGIDIFTGK.2|YDC[CAM]GEEILITVLSAM...

SEN / CTL

Q9H223

EH domain-containing protein 4

EHD4

-0.05

0.42

0.028

0.0125

pinocytosis,regulation of endocytosis,endocytic re...

nucleic acid binding,calcium ion binding,protein b...

nucleus,endoplasmic reticulum,plasma membrane,cell...

9

32

46

EYQISAGDFPEVK.2|EYQISAGDFPEVK.3|YLLEQDFPGMR.2|VYGA...

SEN / CTL

O75223

Gamma-glutamylcyclotransferase

GGCT

-0.05

0.06

0.107

0.0378

release of cytochrome c from mitochondria,glutathi...

gamma-glutamylcyclotransferase activity,protein ho...

cytosol,extracellular exosome

3

15

18

NPSAAFFC[CAM]VAR.2|NPSAAFFC[CAM]VAR.3|VSEEIEDIIKK....

SEN / CTL

P49458

Signal recognition particle 9 kDa protein

SRP9

-0.06

0.24

0.102

0.0362

SRP-dependent cotranslational protein targeting to...

RNA binding,signal recognition particle binding,pr...

signal recognition particle receptor complex,signa...

12

8

11

VTDDLVC[CAM]LVYK.2|PQYQTWEEFSR.2|PQYQTWEEFSR.3|VTD...

SEN / CTL

Q9HC38

Glyoxalase domain-containing protein 4

GLOD4

-0.06

0.32

0.151

0.049

cell-cell adhesion

cadherin binding involved in cell-cell adhesion

mitochondrion,cell-cell adherens junction,extracel...

15

22

35

ILTPLVSLDTPGK.2|ILTPLVSLDTPGK.3|SLNYWC[CAM]NLLGMK....

SEN / CTL

P34932

Heat shock 70 kDa protein 4

HSPA4

-0.07

0.34

0.00000177

0.00000276

response to unfolded protein,protein import into m...

protein binding,ATP binding

cytosol,extracellular exosome

66

85

157

EFSITDVVPYPISLR.2|EFSITDVVPYPISLR.3|AFSDPFVEAEKSNL...

SEN / CTL

Q9BZK3

Putative nascent polypeptide-associated complex subunit alpha-like protein

NACAP1

-0.07

0.13

0.0187

0.00892

12

3

7

IEDLSQEAQLAAAEK.2|IEDLSQEAQLAAAEK.3|NILFVITKPDVYK....

SEN / CTL

P20618

Proteasome subunit beta type-1

PSMB1

-0.07

0.32

0.0361

0.0152

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

24

17

37

LVKDVFISAAERDVYTGDALR.4|LVKDVFISAAERDVYTGDALR.3|LS...

SEN / CTL

P46108

Adapter molecule crk

CRK

-0.07

0.34

0.0621

0.0241

activation of MAPKK activity,regulation of transcr...

SH3/SH2 adaptor activity,protein binding,enzyme bi...

nucleus,cytoplasm,cytosol,plasma membrane,actin cy...

21

23

29

VSHYIINSSGPRPPVPPSPAQPPPGVSPSR.4|LSRQEAVALLQGQR.3|...

SEN / CTL

P09972

Fructose-bisphosphate aldolase C

ALDOC

-0.08

0.27

0.00157

0.00113

fructose metabolic process,gluconeogenesis,fructos...

fructose-bisphosphate aldolase activity,protein bi...

mitochondrion,cytosol,cytoskeleton,extracellular e...

30

27

42

VDKGVVPLAGTDGETTTQGLDGLSER.3|VDKGVVPLAGTDGETTTQGLD...

SEN / CTL

P61970

Nuclear transport factor 2

NUTF2

-0.08

0.2

0.0406

0.0168

protein import into nucleus, translocation,protein...

protein binding,protein transmembrane transporter ...

nuclear outer membrane,nucleoplasm,cytosol,nuclear...

12

8

20

NINDAWVC[CAM]TNDMFR.2|NINDAWVC[CAM]TNDMFR.3|NINDAW...

SEN / CTL

E9PAV3

Q13765

Nascent polypeptide-associated complex subunit alpha, muscle-specific form;Nascent polypeptide-associated complex subunit alpha

NACA

-0.08

0.13

0.0487

0.0196

transcription, DNA-templated,regulation of transcr...

DNA binding;

nucleus,cytoplasm;

9

2

4

IEDLSQQAQLAAAEK.3|IEDLSQQAQLAAAEK.2|SPASDTYIVFGEAK...

SEN / CTL

P52209

6-phosphogluconate dehydrogenase, decarboxylating

PGD

-0.08

0.4

0.106

0.0373

pentose-phosphate shunt,pentose-phosphate shunt, o...

phosphogluconate dehydrogenase (decarboxylating) a...

nucleus,cytosol,extracellular exosome

42

36

73

GILFVGSGVSGGEEGAR.2|GILFVGSGVSGGEEGAR.3|GTGKWTAISA...

SEN / CTL

O95757

Heat shock 70 kDa protein 4L

HSPA4L

-0.09

0.1

0.141

0.0467

protein folding,response to unfolded protein

ATP binding

nucleus,cytoplasm,cytosol

3

48

66

SGGIETIANEYSDR.2|QDLPPLDEKPR.3|SSGEM[Oxi]EVD.2|MQV...

SEN / CTL

P08133

Annexin A6

ANXA6

-0.1

0.34

0.00366

0.00234

calcium ion transport,regulation of muscle contrac...

calcium ion binding,protein binding,GTP binding,ca...

mitochondrion,lysosomal membrane,focal adhesion,me...

96

72

121

GFGSDKEAILDIITSR.3|GFGSDKEAILDIITSR.2|ALIEILATR.2|...

SEN / CTL

Q04837

Single-stranded DNA-binding protein, mitochondrial

SSBP1

-0.11

0.35

0.0561

0.0222

DNA replication,mitochondrion organization,positiv...

chromatin binding,single-stranded DNA binding,poly...

nucleus,mitochondrion,mitochondrial matrix,mitocho...

12

10

18

QVEGKNPVTIFSLATNEMWR.3|NPVTIFSLATNEMWR.3|NPVTIFSLA...

SEN / CTL

P50395

Rab GDP dissociation inhibitor beta

GDI2

-0.12

0.71

0.0333

0.0143

signal transduction,small GTPase mediated signal t...

Rab GDP-dissociation inhibitor activity,GTPase act...

cytoplasm,Golgi apparatus,cytosol,focal adhesion,m...

105

56

113

DLGTESQIFISR.2|TDDYLDQPC[CAM]YETINR.2|TDDYLDQPC[CA...

SEN / CTL

P31150

Rab GDP dissociation inhibitor alpha

GDI1

-0.12

0.38

0.0472

0.0191

signal transduction,protein transport,Rab protein ...

GDP-dissociation inhibitor activity,Rab GDP-dissoc...

cytoplasm,Golgi apparatus,cytosol,midbody,neuron p...

36

28

53

IIC[CAM]ILSHPIKNTNDANSC[CAM]QIIIPQNQVNR.4|TDDYLDQP...

SEN / CTL

P46976

Glycogenin-1

GYG1

-0.12

0.47

0.147

0.048

glycogen biosynthetic process,glycogen catabolic p...

protein binding,glycogenin glucosyltransferase act...

cytosol,membrane,lysosomal lumen,extracellular exo...

9

11

16

GALVLGSSLK.2|LVVLATPQVSDSMR.2|LVVLATPQVSDSMR.3|WEQ...

SEN / CTL

P55786

Puromycin-sensitive aminopeptidase

NPEPPS

-0.13

0.55

0.00251

0.00166

protein polyubiquitination,proteolysis,peptide cat...

aminopeptidase activity,zinc ion binding,peptide b...

nucleus,cytosol,plasma membrane,extracellular exos...

102

55

85

LNLGTVGFYR.2|LGLQNDLFSLAR.2|AGIISTVEVLK.2|AFPC[CAM...

SEN / CTL

P54802

Alpha-N-acetylglucosaminidase

NAGLU

-0.13

0.39

0.0324

0.014

glycosaminoglycan catabolic process,lysosome organ...

alpha-N-acetylglucosaminidase activity

lysosome,lysosomal lumen,extracellular exosome

30

21

31

ALAAKPGLDTYSLGGGGAAR.3|FLLGSWLEQAR.2|KDPVPDLAAWVTS...

SEN / CTL

P12956

X-ray repair cross-complementing protein 6

XRCC6

-0.13

0.51

0.112

0.0389

telomere maintenance,DNA ligation,double-strand br...

DNA binding,damaged DNA binding,double-stranded DN...

nuclear telomere cap complex,nuclear chromosome, t...

42

66

122

DSLIFLVDASK.2|SDSFENPVLQQHFR.3|SDSFENPVLQQHFR.2|NI...

SEN / CTL

Q9UHV9

Prefoldin subunit 2

PFDN2

-0.13

0.23

0.147

0.048

protein folding,positive regulation of cytoskeleto...

protein binding,protein binding involved in protei...

nucleus,nucleoplasm,nucleolus,cytoplasm,mitochondr...

12

9

15

GAVSAEQVIAGFNR.3|GAVSAEQVIAGFNR.2|IIETLTQQLQAK.2|I...

SEN / CTL

Q92945

Far upstream element-binding protein 2

KHSRP

-0.14

0.35

0.00666

0.00384

RNA splicing, via transesterification reactions,tr...

DNA binding,protein binding,mRNA 3'-UTR AU-rich re...

nucleoplasm,cytosol,cytoplasmic stress granule,mem...

18

42

79

IINDLLQSLR.2|IGGGIDVPVPR.2|MMLDDIVSR.2|M[Oxi]MLDDI...

SEN / CTL

Q15459

Splicing factor 3A subunit 1

SF3A1

-0.14

0.06

0.0208

0.00969

regulation of alternative mRNA splicing, via splic...

RNA binding,protein binding,poly(A) RNA binding

nucleoplasm,spliceosomal complex,U2-type spliceoso...

3

50

82

LTAQFVAR.2|GLVPEDDTKEK.3|IRQNEINNPK.3|IRQNEINNPK.2...

SEN / CTL

Q86V81

THO complex subunit 4

ALYREF

-0.14

0.18

0.123

0.042

regulation of DNA recombination,mRNA splicing, via...

nucleotide binding,protein binding,poly(A) RNA bin...

transcription export complex,nucleus,nucleoplasm,c...

6

12

20

SLGTADVHFER.3|SLGTADVHFER.2|LLVSNLDFGVSDADIQELFAEF...

SEN / CTL

P62993

Growth factor receptor-bound protein 2

GRB2

-0.15

0.41

0.0207

0.00966

MAPK cascade,epidermal growth factor receptor sign...

phosphotyrosine binding,SH3/SH2 adaptor activity,R...

nucleus,nucleoplasm,nucleolus,cytoplasm,endosome,G...

12

19

28

YFLWVVK.2|FNSLNELVDYHR.3|FNSLNELVDYHR.2|RGDFIHVMDN...

SEN / CTL

P05387

60S acidic ribosomal protein P2

RPLP2

-0.15

0.76

0.0746

0.028

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,large ribosomal...

cytosol,focal adhesion,membrane,cytosolic large ri...

45

13

30

NIEDVIAQGIGK.2|NIEDVIAQGIGK.3|ILDSVGIEADDDRLNK.3|I...

SEN / CTL

Q12765

Secernin-1

SCRN1

-0.15

0.48

0.0858

0.0317

proteolysis,exocytosis

molecular_function,dipeptidase activity

nucleus,cytoplasm,nuclear membrane

15

21

30

C[CAM]IC[CAM]SQLSLTTK.2|SIFKPFIFVDDVK.3|SIFKPFIFVD...

SEN / CTL

P31946

14-3-3 protein beta/alpha

YWHAB

-0.16

0.74

0.00317

0.00205

MAPK cascade,protein targeting,viral process,negat...

transcription corepressor activity,protein binding...

nucleus,cytoplasm,mitochondrion,cytosol,cell-cell ...

57

37

87

NLLSVAYK.2|NLLSVAYK.1|NLLSVAYKNVVGAR.3|NLLSVAYKNVV...

SEN / CTL

P51991

Heterogeneous nuclear ribonucleoprotein A3

HNRNPA3

-0.16

0.28

0.0302

0.0133

mRNA splicing, via spliceosome,gene expression,mRN...

nucleotide binding,RNA binding,mRNA binding,protei...

nucleus,nucleoplasm,cytoplasm,intracellular ribonu...

12

32

62

YGKIETIEVMEDR.3|YGKIETIEVMEDR.2|IETIEVMEDR.2|IETIE...

SEN / CTL

P11166

Solute carrier family 2, facilitated glucose transporter member 1

SLC2A1

-0.16

0.31

0.0359

0.0152

lactose biosynthetic process,protein complex assem...

glucose transmembrane transporter activity,protein...

Golgi membrane,female pronucleus,cytosol,plasma me...

9

10

17

TFDEIASGFR.2|VTILELFR.2|LRGTADVTHDLQEMKEESR.4|LRGT...

SEN / CTL

Q9HAT2

Sialate O-acetylesterase

SIAE

-0.16

0.3

0.0389

0.0162

regulation of immune system process,carbohydrate m...

sialate O-acetylesterase activity

extracellular space,lysosome,extracellular exosome

12

18

31

WHQTADFGYVPNPK.3|WHQTADFGYVPNPK.2|YMSAVC[CAM]WLFGR...

SEN / CTL

P18206

Vinculin

VCL

-0.17

0.9

0.0113

0.00589

morphogenesis of an epithelium,platelet degranulat...

dystroglycan binding,actin binding,structural mole...

extracellular region,cytosol,cytoskeleton,plasma m...

198

102

192

AIPDLTAPVAAVQAAVSNLVR.3|AIPDLTAPVAAVQAAVSNLVR.2|GW...

SEN / CTL

P09960

Leukotriene A-4 hydrolase

LTA4H

-0.17

0.7

0.0126

0.00644

proteolysis,leukotriene metabolic process,leukotri...

aminopeptidase activity,epoxide hydrolase activity...

nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr...

48

45

79

PEIVDTC[CAM]SLASPASVC[CAM]R.3|PEIVDTC[CAM]SLASPASV...

SEN / CTL

O75083

WD repeat-containing protein 1

WDR1

-0.17

0.9

0.0267

0.0121

platelet degranulation,sensory perception of sound...

actin filament binding

podosome,extracellular region,cytoplasm,cytosol,ac...

87

47

76

LYSILGTTLKDEGK.3|LYSILGTTLKDEGK.2|VFASLPQVER.2|YAP...

SEN / CTL

P04424

Argininosuccinate lyase

ASL

-0.17

0.48

0.0355

0.0151

urea cycle,internal protein amino acid acetylation...

argininosuccinate lyase activity,protein binding

cytoplasm,cytosol,extracellular exosome

12

29

36

FNASIAYDR.2|MAEDLILYC[CAM]TK.2|INVLPLGSGAIAGNPLGVD...

SEN / CTL

Q13838

Spliceosome RNA helicase DDX39B

DDX39B

-0.17

0.39

0.0958

0.0344

spliceosomal complex assembly,mRNA splicing, via s...

ATP-dependent RNA helicase activity,protein bindin...

transcription export complex,nucleus,nucleoplasm,s...

18

15

31

VAVFFGGLSIK.2|C[CAM]IALAQLLVEQNFPAIAIHR.3|C[CAM]IA...

SEN / CTL

P24534

Elongation factor 1-beta

EEF1B2

-0.17

0.39

0.122

0.0419

translational elongation,response to ethanol

translation elongation factor activity,protein bin...

cytoplasm,cytosol,eukaryotic translation elongatio...

18

13

25

LVPVGYGIK.2|SIQADGLVWGSSK.2|SIQADGLVWGSSK.3|SSILLD...

SEN / CTL

P04075

Fructose-bisphosphate aldolase A

ALDOA

-0.18

0.88

0.000072

0.0000744

platelet degranulation,fructose metabolic process,...

actin binding,fructose-bisphosphate aldolase activ...

extracellular region,extracellular space,nucleus,c...

153

51

110

VDKGVVPLAGTNGETTTQGLDGLSER.3|VDKGVVPLAGTNGETTTQGLD...

SEN / CTL

P31153

S-adenosylmethionine synthase isoform type-2

MAT2A

-0.18

0.27

0.0265

0.012

S-adenosylmethionine biosynthetic process,one-carb...

methionine adenosyltransferase activity,protein bi...

cytosol,methionine adenosyltransferase complex

15

24

40

NFDLRPGVIVR.3|FVIGGPQGDAGLTGR.2|FVIGGPQGDAGLTGR.3|...

SEN / CTL

P14174

Macrophage migration inhibitory factor

MIF

-0.18

0.33

0.135

0.0449

prostaglandin biosynthetic process,negative regula...

dopachrome isomerase activity,receptor binding,cyt...

extracellular region,extracellular space,nucleopla...

30

10

22

PMFIVNTNVPR.2|PMFIVNTNVPR.3|PM[Oxi]FIVNTNVPR.2|PM[...

SEN / CTL

P04264

Keratin, type II cytoskeletal 1

KRT1

-0.19

0.72

0.0000149

0.000018

complement activation, lectin pathway,retina homeo...

receptor activity,structural molecule activity,pro...

extracellular space,nucleus,cytoskeleton,plasma me...

87

64

116

LALDLEIATYR.2|SLNNQFASFIDKVR.3|SLNNQFASFIDKVR.2|WE...

SEN / CTL

P25787

Proteasome subunit alpha type-2

PSMA2

-0.19

0.18

0.000417

0.000354

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,cytoplasmic mRNA processing bod...

24

15

31

RLTPTEVKDYLAAIA.3|KLAQQYYLVYQEPIPTAQLVQR.3|KLAQQYY...

SEN / CTL

O14818

Proteasome subunit alpha type-7

PSMA7

-0.19

0.74

0.0728

0.0274

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

39

16

28

LTVEDPVTVEYITR.2|LTVEDPVTVEYITR.3|KIC[CAM]ALDDNVC[...

SEN / CTL

O75436

Vacuolar protein sorting-associated protein 26A

VPS26A

-0.19

0.41

0.103

0.0365

intracellular protein transport,Wnt signaling path...

protein binding,protein transporter activity

endosome,early endosome,cytosol,endosome membrane,...

21

22

31

YFLNLVLVDEEDRR.3|ELALPGELTQSR.2|LFLAGYDPTPTMR.2|LF...

SEN / CTL

P13861

cAMP-dependent protein kinase type II-alpha regulatory subunit

PRKAR2A

-0.19

1.19

0.134

0.0448

renal water homeostasis,blood coagulation,activati...

cAMP-dependent protein kinase inhibitor activity,p...

cytoplasm,centrosome,cytosol,plasma membrane,focal...

18

23

31

SLEVSER.2|NLDQEQLSQVLDAMFER.3|NLDQEQLSQVLDAMFER.2|...

SEN / CTL

Q13510

Acid ceramidase

ASAH1

-0.2

0.12

0.00423

0.00258

ceramide metabolic process,glycosphingolipid metab...

catalytic activity,ceramidase activity

extracellular space,lysosomal lumen,extracellular ...

9

24

34

LTVYTTLIDVTK.2|ESLDVYELDAK.2|TSQENISFETMYDVLSTKPVL...

SEN / CTL

P14854

Cytochrome c oxidase subunit 6B1

COX6B1

-0.2

0.2

0.0314

0.0137

mitochondrial electron transport, cytochrome c to ...

cytochrome-c oxidase activity

mitochondrion,mitochondrial inner membrane,mitocho...

9

9

12

GGDISVC[CAM]EWYQR.2|NC[CAM]WQNYLDFHR.3|NC[CAM]WQNY...

SEN / CTL

O15230

Laminin subunit alpha-5

LAMA5

-0.21

0.59

3.62e-7

6.69e-7

angiogenesis,branching involved in ureteric bud mo...

integrin binding,structural molecule activity

extracellular region,basement membrane,basal lamin...

123

77

89

LGLVWAALQGAR.2|ILQAVQAAEDAAGQALQQADHTWATVVR.3|ILQA...

SEN / CTL

P12429

Annexin A3

ANXA3

-0.21

0.35

0.00000406

0.00000579

phagocytosis,positive regulation of endothelial ce...

calcium ion binding,calcium-dependent phospholipid...

cytoplasm,plasma membrane,membrane,axon,dendrite,p...

66

31

45

MLISILTER.2|GAGTNEDALIEILTTR.2|GAGTNEDALIEILTTR.3|...

SEN / CTL

Q9Y696

Chloride intracellular channel protein 4

CLIC4

-0.21

0.36

0.000272

0.000243

angiogenesis,endothelial cell morphogenesis,chlori...

voltage-gated ion channel activity,chloride channe...

intracellular,cytoplasm,mitochondrion,centrosome,c...

30

24

43

GVVFSVTTVDLK.2|YLTNAYSRDEFTNTC[CAM]PSDKEVEIAYSDVAK...

SEN / CTL

Q9Y3B8

Oligoribonuclease, mitochondrial

REXO2

-0.21

0.12

0.000592

0.000481

nucleobase-containing compound metabolic process,n...

3'-5'-exoribonuclease activity,nucleic acid bindin...

nucleus,nucleolus,mitochondrion,mitochondrial inte...

9

14

18

ESTITLQQAEYEFLSFVR.3|ESTITLQQAEYEFLSFVR.2|ALDDISES...

SEN / CTL

P53634

Dipeptidyl peptidase 1

CTSC

-0.21

0.39

0.00183

0.00128

T cell mediated cytotoxicity,proteolysis,ER to Gol...

cysteine-type endopeptidase activity,serine-type e...

Golgi membrane,extracellular space,lysosome,endopl...

24

16

31

GTDEC[CAM]AIESIAVAATPIPKL.2|NSWGTGWGENGYFR.2|RGTDE...

SEN / CTL

P01034

Cystatin-C

CST3

-0.21

0.52

0.0102

0.00541

eye development,response to hypoxia,cell activatio...

beta-amyloid binding,protease binding,endopeptidas...

extracellular region,basement membrane,extracellul...

27

7

11

ALDFAVGEYNK.2|KQIVAGVNYFLDVELGR.3|TQPNLDNC[CAM]PFH...

SEN / CTL

Q03252

Lamin-B2

LMNB2

-0.21

0.62

0.0252

0.0115

biological_process

molecular_function,structural molecule activity

nuclear inner membrane,lamin filament

24

59

82

LQIEIGK.2|GLESDVAELR.2|ALELENDRLLLK.3|ALELENDRLLLK...

SEN / CTL

Q96G03

Phosphoglucomutase-2

PGM2

-0.21

0.44

0.0301

0.0133

glycogen biosynthetic process,glycogen catabolic p...

magnesium ion binding,phosphoglucomutase activity,...

cytosol,extracellular exosome

15

36

58

LAATTFISQGIPVYLFSDITPTPFVPFTVSHLK.4|LAATTFISQGIPVY...

SEN / CTL

P20810

Calpastatin

CAST

-0.21

1.1

0.0374

0.0156

negative regulation of endopeptidase activity,cell...

endopeptidase inhibitor activity,cysteine-type end...

cytoplasm,endoplasmic reticulum,cytosol,cell-cell ...

15

48

69

C[CAM]GEDDETIPSEYR.2|SESELIDELSEDFDRSEC[CAM]K.3|GT...

SEN / CTL

Q99497

Protein deglycase DJ-1

PARK7

-0.22

0.4

2.38e-8

5.64e-8

negative regulation of protein phosphorylation,neg...

transcription coactivator activity,mRNA binding,re...

chromatin,nucleus,cytoplasm,mitochondrion,mitochon...

45

27

55

DGLILTSR.2|GPGTSFEFALAIVEALNGKEVAAQVK.3|GPGTSFEFAL...

SEN / CTL

P13929

Beta-enolase

ENO3

-0.22

0.3

0.0103

0.00543

gluconeogenesis,aging,response to drug,skeletal mu...

magnesium ion binding,phosphopyruvate hydratase ac...

phosphopyruvate hydratase complex,extracellular sp...

9

14

19

VNQIGSVTESIQAC[CAM]K.2|VNQIGSVTESIQAC[CAM]K.3|YGKD...

SEN / CTL

Q9Y5Z4

Heme-binding protein 2

HEBP2

-0.22

0.59

0.0949

0.0342

negative regulation of mitochondrial membrane pote...

protein binding

cytoplasm,mitochondrion,extracellular exosome

9

10

11

AEMTVFVR.2|NQEQLLTLASILR.2|NQEQLLTLASILR.3|VYYTAGY...

SEN / CTL

O95967

EGF-containing fibulin-like extracellular matrix protein 2

EFEMP2

-0.22

0.42

0.0958

0.0344

extracellular matrix structural constituent,calciu...

extracellular region,basement membrane,extracellul...

6

6

6

C[CAM]INHYGGYLC[CAM]LPR.3|LC[CAM]QDIDEC[CAM]ESGAHQ...

SEN / CTL

P07858

Cathepsin B

CTSB

-0.23

0.44

0.00219

0.0015

toll-like receptor signaling pathway,proteolysis,c...

cysteine-type endopeptidase activity,serine-type e...

extracellular region,extracellular space,intracell...

39

22

46

VMFTEDLKLPASFDAR.3|EQWPQC[CAM]PTIK.2|GQDHC[CAM]GIE...

SEN / CTL

P05386

60S acidic ribosomal protein P1

RPLP1

-0.23

0.24

0.00921

0.00498

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,protein binding...

cytoplasm,cytosol,focal adhesion,cytosolic large r...

15

5

12

AAGVNVEPFWPGLFAK.2|AAGVNVEPFWPGLFAK.3|ALANVNIGSLIC...

SEN / CTL

O00148

ATP-dependent RNA helicase DDX39A

DDX39A

-0.23

0.39

0.108

0.0378

mRNA splicing, via spliceosome,termination of RNA ...

ATP-dependent RNA helicase activity,protein bindin...

nucleus,nucleoplasm,spliceosomal complex,membrane,...

27

28

52

ILVATNLFGR.2|GLAITFVSDENDAK.2|GLAITFVSDENDAK.3|DFL...

SEN / CTL

P29401

Transketolase

TKT

-0.24

0.69

3.26e-8

7.34e-8

xylulose biosynthetic process,pentose-phosphate sh...

transketolase activity,protein homodimerization ac...

nucleus,nucleoplasm,peroxisome,cytosol,vesicle,mye...

150

53

103

TVPFC[CAM]STFAAFFTR.2|TVPFC[CAM]STFAAFFTR.3|VLDPFT...

SEN / CTL

P11021

78 kDa glucose-regulated protein

HSPA5

-0.24

1.05

0.0202

0.0095

ER overload response,activation of signaling prote...

glycoprotein binding,calcium ion binding,protein b...

nucleus,mitochondrion,endoplasmic reticulum,endopl...

165

68

133

IINEPTAAAIAYGLDKR.3|IINEPTAAAIAYGLDKR.2|VLEDSDLKKS...

SEN / CTL

O00469

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2

PLOD2

-0.24

0.59

0.143

0.0471

response to hypoxia,cellular protein modification ...

iron ion binding,procollagen-lysine 5-dioxygenase ...

endoplasmic reticulum,endoplasmic reticulum membra...

33

33

47

SEDYVDIVQGNR.2|VLGQGEEWRGGDGINSIGGGQK.3|IFTENIVEQP...

SEN / CTL

P08758

Annexin A5

ANXA5

-0.25

0.74

0.000369

0.000319

signal transduction,blood coagulation,response to ...

phospholipase inhibitor activity,calcium ion bindi...

intracellular,cytoplasm,focal adhesion,external si...

108

45

70

GLGTDEESILTLLTSR.3|GLGTDEESILTLLTSR.2|VLTEIIASR.2|...

SEN / CTL

Q9NUQ9

Protein FAM49B

FAM49B

-0.26

0.32

0.00323

0.00208

cilium,membrane,extracellular exosome

12

23

41

VLKDQPPNSVEGLLNALR.3|VLKDQPPNSVEGLLNALR.2|INNVPAEG...

SEN / CTL

Q9Y287

Integral membrane protein 2B

ITM2B

-0.26

0.66

0.0316

0.0138

nervous system development,negative regulation of ...

beta-amyloid binding,protein binding,ATP binding

Golgi membrane,extracellular region,extracellular ...

6

6

6

NLLELLINIK.2|FAVETLIC[CAM]S.2|VTFNSALAQK.2|IENIDHL...

SEN / CTL

Q15274

Nicotinate-nucleotide pyrophosphorylase [carboxylating]

QPRT

-0.27

0.27

0.00000734

0.00000976

NAD biosynthetic process,NAD metabolic process,qui...

nicotinate-nucleotide diphosphorylase (carboxylati...

cytoplasm,cytosol,extracellular exosome

18

11

15

C[CAM]SGIASAAAAAVEAAR.3|C[CAM]SGIASAAAAAVEAAR.2|YD...

SEN / CTL

Q96C90

Protein phosphatase 1 regulatory subunit 14B

PPP1R14B

-0.27

0.28

0.000734

0.000581

regulation of protein dephosphorylation,regulation...

protein serine/threonine phosphatase inhibitor act...

cytoplasm

15

9

14

VKELLVDC[CAM]YKPTEAFISGLLDKIR.4|VYFQSPPGAAGEGPGGAD...

SEN / CTL

Q9NVN3

Synembryn-B

RIC8B

-0.27

0.19

0.121

0.0416

regulation of G-protein coupled receptor protein s...

G-protein alpha-subunit binding,guanyl-nucleotide ...

cytoplasm,centrosome,cytosol,plasma membrane,cell ...

3

1

1

GSSYREGLTPVLSLLTEC[CAM]SR.3

SEN / CTL

P30101

Protein disulfide-isomerase A3

PDIA3

-0.28

0.98

0.00000233

0.00000355

antigen processing and presentation of peptide ant...

protein disulfide isomerase activity,cysteine-type...

nucleus,endoplasmic reticulum,endoplasmic reticulu...

120

62

120

FLQDYFDGNLKR.3|FLQDYFDGNLKR.2|KTFSHELSDFGLESTAGEIP...

SEN / CTL

O14979

Heterogeneous nuclear ribonucleoprotein D-like

HNRNPDL

-0.28

0.3

0.0000807

0.0000819

transcription, DNA-templated,regulation of transcr...

nucleotide binding,DNA binding,poly(A) RNA binding

nucleoplasm,cytoplasm,extracellular exosome

18

22

35

DLTEYLSR.2|FGEVVDC[CAM]TIK.2|GFGFVLFK.2|GFGFVLFK.1...

SEN / CTL

P10599

Thioredoxin

TXN

-0.28

0.27

0.000516

0.00043

sulfate assimilation,negative regulation of transc...

protein binding,protein disulfide oxidoreductase a...

nucleus,nucleoplasm,cytoplasm,mitochondrion,cytoso...

24

12

20

TAFQEALDAAGDKLVVVDFSATWC[CAM]GPC[CAM]K.4|TAFQEALDA...

SEN / CTL

P25789

Proteasome subunit alpha type-4

PSMA4

-0.28

0.91

0.00263

0.00173

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,cytoplasmic mRNA processing bod...

36

18

30

LLDEVFFSEK.2|IYKLNEDMAC[CAM]SVAGITSDANVLTNELR.3|YL...

SEN / CTL

P63104

14-3-3 protein zeta/delta

YWHAZ

-0.28

1.42

0.00692

0.00396

protein targeting,signal transduction,platelet act...

protein binding,transcription factor binding,prote...

extracellular space,nucleus,nucleoplasm,cytoplasm,...

84

22

53

IETELRDIC[CAM]NDVLSLLEK.3|IETELRDIC[CAM]NDVLSLLEK....

SEN / CTL

Q14393

Growth arrest-specific protein 6

GAS6

-0.28

0.62

0.019

0.00903

neuron migration,positive regulation of protein ph...

phosphatidylserine binding,receptor binding,voltag...

extracellular region,extracellular space,cytoplasm...

15

11

13

SPVLTFAGGLPDVPVTSAPVTAFYR.3|AVPLSVALVDYHSTK.3|AVPL...

SEN / CTL

O43670

BUB3-interacting and GLEBS motif-containing protein ZNF207

ZNF207

-0.28

0.1

0.0231

0.0107

mitotic sister chromatid segregation,microtubule b...

DNA binding,transcription factor activity, sequenc...

kinetochore,condensed chromosome kinetochore,nucle...

3

10

12

LIHPDEDISLEER.3|LIHPDEDISLEER.2|LIHPDEDISLEERR.4|L...

SEN / CTL

P98172

Ephrin-B1

EFNB1

-0.28

0.19

0.112

0.0389

neural crest cell migration,cell adhesion,cell-cel...

protein binding,ephrin receptor binding

nucleus,cytoplasm,plasma membrane,integral compone...

3

4

4

LYLVRPEQAAAC[CAM]STVLDPNVLVTC[CAM]NRPEQEIR.4|AAALS...

SEN / CTL

O43278

Kunitz-type protease inhibitor 1

SPINT1

-0.28

0.19

0.15

0.0488

neural tube closure,negative regulation of endopep...

serine-type endopeptidase inhibitor activity

extracellular region,extracellular space,plasma me...

6

11

13

EGFINYLTR.2|WYYNPFSEHC[CAM]AR.3|GHC[CAM]VDLPDTGLC[...

SEN / CTL

P06733

Alpha-enolase

ENO1

-0.29

0.83

7.16e-10

2.25e-9

gluconeogenesis,transcription, DNA-templated,respo...

magnesium ion binding,DNA binding,phosphopyruvate ...

phosphopyruvate hydratase complex,extracellular sp...

228

56

121

VNQIGSVTESLQAC[CAM]K.2|VNQIGSVTESLQAC[CAM]K.3|YISP...

SEN / CTL

P00338

L-lactate dehydrogenase A chain

LDHA

-0.29

1.05

0.000129

0.000126

response to hypoxia,lactate metabolic process,pyru...

L-lactate dehydrogenase activity,protein binding,k...

nucleus,cytosol,cell-cell adherens junction,membra...

123

38

92

LVIITAGAR.2|VTLTSEEEAR.2|QVVESAYEVIK.2|QVVESAYEVIK...

SEN / CTL

P60174

Triosephosphate isomerase

TPI1

-0.29

0.74

0.000129

0.000126

gluconeogenesis,glycolytic process,pentose-phospha...

triose-phosphate isomerase activity,ubiquitin prot...

extracellular space,nucleus,cytosol,extracellular ...

156

37

70

VVLAYEPVWAIGTGK.2|VVLAYEPVWAIGTGK.3|VPADTEVVC[CAM]...

SEN / CTL

Q13442

28 kDa heat- and acid-stable phosphoprotein

PDAP1

-0.29

0.31

0.0002

0.000189

signal transduction,cell proliferation

poly(A) RNA binding

12

15

23

KGVEGLIDIENPNR.3|KGVEGLIDIENPNR.2|GVEGLIDIENPNR.2|...

SEN / CTL

P60900

Proteasome subunit alpha type-6

PSMA6

-0.29

0.39

0.000979

0.000751

MAPK cascade,protein polyubiquitination,stimulator...

RNA binding,endopeptidase activity,threonine-type ...

proteasome complex,cytoplasmic mRNA processing bod...

30

20

30

LYQVEYAFK.2|KVPDKLLDSSTVTHLFK.4|KVPDKLLDSSTVTHLFK....

SEN / CTL

P30040

Endoplasmic reticulum resident protein 29

ERP29

-0.3

0.37

0.000115

0.000114

activation of MAPK activity,positive regulation of...

protein homodimerization activity,chaperone bindin...

endoplasmic reticulum,endoplasmic reticulum lumen,...

30

22

35

SLNILTAFQK.2|DGDFENPVPYTGAVK.2|DGDFENPVPYTGAVK.3|Y...

SEN / CTL

Q96AE4

Far upstream element-binding protein 1

FUBP1

-0.3

0.99

0.0539

0.0215

regulation of transcription, DNA-templated,transcr...

single-stranded DNA binding,transcription factor a...

nucleus,nucleoplasm

21

39

63

FAVGIVIGR.2|IGGNEGIDVPIPR.2|IGGNEGIDVPIPR.3|C[CAM]...

SEN / CTL

P61960

Ubiquitin-fold modifier 1

UFM1

-0.3

0.4

0.0938

0.0338

regulation of intracellular estrogen receptor sign...

nucleus,cytoplasm,extracellular exosome

9

5

9

VLSVPESTPFTAVLK.2|VLSVPESTPFTAVLK.3|FAAEEFKVPAATSA...

SEN / CTL

P09651

Heterogeneous nuclear ribonucleoprotein A1

HNRNPA1

-0.31

0.37

1.11e-8

2.83e-8

mRNA splicing, via spliceosome,mRNA processing,RNA...

nucleotide binding,single-stranded DNA binding,RNA...

nucleus,nucleoplasm,spliceosomal complex,cytoplasm...

42

41

92

LFIGGLSFETTDESLR.2|LFIGGLSFETTDESLR.3|KLFIGGLSFETT...

SEN / CTL

O00410

Importin-5

IPO5

-0.31

0.6

0.000453

0.00038

protein import into nucleus, docking,protein impor...

GTPase inhibitor activity,protein binding,nuclear ...

nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla...

39

61

119

ITFLLQAIR.2|VIAALLQTMEDQGNQR.2|VIAALLQTMEDQGNQR.3|...

SEN / CTL

Q8IWT0

Protein archease

ZBTB8OS

-0.31

0.16

0.0638

0.0246

tRNA splicing, via endonucleolytic cleavage and li...

metal ion binding

nucleoplasm,extracellular exosome,tRNA-splicing li...

3

2

2

FSADEFFIPR.2|SIGWGEEFSLSK.2

SEN / CTL

P35237

Serpin B6

SERPINB6

-0.32

0.3

5.51e-7

9.73e-7

sensory perception of sound,negative regulation of...

protease binding,serine-type endopeptidase inhibit...

extracellular space,cytoplasm,cytosol,protein comp...

45

28

44

LVLVNAVYFR.2|SC[CAM]DFLSSFR.2|IAELLSPGSVDPLTR.2|IA...

SEN / CTL

P26599

Polypyrimidine tract-binding protein 1

PTBP1

-0.32

0.48

0.0267

0.0121

alternative mRNA splicing, via spliceosome,regulat...

nucleotide binding,RNA binding,protein binding,pol...

nucleoplasm,nucleolus,membrane,extracellular exoso...

18

35

87

VTPQSLFILFGVYGDVQR.3|VTPQSLFILFGVYGDVQR.2|KLPIDVTE...

SEN / CTL

Q6PCB0

von Willebrand factor A domain-containing protein 1

VWA1

-0.32

0.24

0.0361

0.0152

extracellular matrix organization,behavioral respo...

identical protein binding

basement membrane,interstitial matrix,extracellula...

6

15

25

EQLFAEASGARPGVPK.3|EQLFAEASGARPGVPK.2|VREFVGQLVAPL...

SEN / CTL

Q9Y2B0

Protein canopy homolog 2

CNPY2

-0.33

0.33

0.000063

0.000067

enzyme linked receptor protein signaling pathway,t...

protein binding

endoplasmic reticulum,integral component of plasma...

21

15

27

INPDGSQSVVEVPYAR.2|INPDGSQSVVEVPYAR.3|SEAHLTELLEEI...

SEN / CTL

Q969H8

Myeloid-derived growth factor

MYDGF

-0.33

0.36

0.000689

0.000555

angiogenesis,positive regulation of protein phosph...

protein binding

extracellular space,endoplasmic reticulum lumen,en...

18

8

13

SYLYFTQFK.2|ESDVPLKTEEFEVTK.3|ESDVPLKTEEFEVTK.2|AA...

SEN / CTL

Q07021

Complement component 1 Q subcomponent-binding protein, mitochondrial

C1QBP

-0.33

0.18

0.00187

0.0013

negative regulation of transcription from RNA poly...

complement component C1q binding,transcription cor...

extracellular space,nucleus,nucleolus,cytoplasm,mi...

6

12

21

ALVLDC[CAM]HYPEDEVGQEDEAESDIFSIR.3|ALVLDC[CAM]HYPE...

SEN / CTL

P36551

Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial

CPOX

-0.33

0.5

0.00743

0.00419

protoporphyrinogen IX biosynthetic process,heme bi...

coproporphyrinogen oxidase activity,structural con...

cytoplasm,mitochondrion,mitochondrial inner membra...

9

29

42

AVVPSYIPLVK.2|IESILMSLPLTAR.2|IESILMSLPLTAR.3|IESI...

SEN / CTL

P62857

40S ribosomal protein S28

RPS28

-0.33

0.59

0.0626

0.0243

ribosomal small subunit assembly,nuclear-transcrib...

RNA binding,structural constituent of ribosome,pol...

nucleoplasm,cytoplasm,cytosol,small ribosomal subu...

21

8

13

EGDVLTLLESEREAR.3|NVKGPVREGDVLTLLESER.3|GPVREGDVLT...

SEN / CTL

Q04760

Lactoylglutathione lyase

GLO1

-0.34

0.25

0.0000223

0.0000259

carbohydrate metabolic process,pyruvate metabolic ...

lactoylglutathione lyase activity,zinc ion binding

cytoplasm,cytosol,extracellular exosome

18

16

31

GFGHIGIAVPDVYSAC[CAM]KR.4|GFGHIGIAVPDVYSAC[CAM]KR....

SEN / CTL

Q9UKK9

ADP-sugar pyrophosphatase

NUDT5

-0.34

0.39

0.00612

0.00358

chromatin remodeling,nucleotide metabolic process,...

magnesium ion binding,protein binding,nucleotidylt...

intracellular,nucleus,cytosol,extracellular exosom...

21

17

27

VYSYALALK.2|TLHYEC[CAM]IVLVK.3|TLHYEC[CAM]IVLVK.2|...

SEN / CTL

Q9BVG4

Protein PBDC1

PBDC1

-0.35

0.14

0.00019

0.00018

biological_process

molecular_function

cellular_component

9

12

17

IQFFAIEIAR.2|LISSVDPQFLK.2|FNGIVEDFNYGTLLR.2|AMQHA...

SEN / CTL

P49327

Fatty acid synthase

FASN

-0.35

0.88

0.00057

0.000467

osteoblast differentiation,acetyl-CoA metabolic pr...

fatty acid synthase activity,[acyl-carrier-protein...

cytoplasm,mitochondrion,Golgi apparatus,cytosol,pl...

57

162

312

TGTVSLEVR.2|SEGVVAVLLTK.2|FC[CAM]FTPHTEEGC[CAM]LSE...

SEN / CTL

Q99873

Protein arginine N-methyltransferase 1

PRMT1

-0.35

0.32

0.0016

0.00114

regulation of transcription, DNA-templated,protein...

protein binding,methyltransferase activity,N-methy...

nucleus,nucleoplasm,cytoplasm,cytosol,methylosome

15

32

48

DKWLAPDGLIFPDR.3|DKWLAPDGLIFPDR.2|KVIGIEC[CAM]SSIS...

SEN / CTL

P49721

Proteasome subunit beta type-2

PSMB2

-0.35

0.92

0.0154

0.00758

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

18

21

33

FILNLPTFSVR.2|IIDKNGIHDLDNISFPK.4|NGYELSPTAAANFTR....

SEN / CTL

Q14696

LDLR chaperone MESD

MESDC2

-0.35

0.27

0.0191

0.00904

protein folding,mesoderm development,Wnt signaling...

molecular_function,low-density lipoprotein particl...

cellular_component,endoplasmic reticulum,plasma me...

6

15

22

DGSYAWEIKDFLVGQDR.3|DGSYAWEIKDFLVGQDR.2|IDPSKPESIL...

SEN / CTL

O15240

Neurosecretory protein VGF

VGF

-0.35

0.26

0.133

0.0446

ovarian follicle development,response to dietary e...

molecular_function,hormone activity,neuropeptide h...

extracellular space,transport vesicle,cytoplasmic ...

3

10

11

LADLASDLLLQYLLQGGAR.3|LADLASDLLLQYLLQGGAR.2|RAQEEA...

SEN / CTL

Q9UBG0

C-type mannose receptor 2

MRC2

-0.36

0.33

0.0204

0.00956

osteoblast differentiation,endocytosis,signal tran...

transmembrane signaling receptor activity,protein ...

integral component of plasma membrane,focal adhesi...

12

30

39

TLGDQLSLLLGAR.2|DC[CAM]SIALPYVC[CAM]K.2|GAWLGMNFNP...

SEN / CTL

Q9NQP4

Prefoldin subunit 4

PFDN4

-0.36

0.5

0.0727

0.0274

protein folding

protein binding,unfolded protein binding,chaperone...

nucleus,cytoplasm,mitochondrion,cytosol,prefoldin ...

9

7

10

ITELKEEIEVK.3|ITELKEEIEVK.2|NLQEEIDALESR.2|NLQEEID...

SEN / CTL

O00391

Sulfhydryl oxidase 1

QSOX1

-0.36

0.79

0.1

0.0358

platelet degranulation,negative regulation of macr...

protein disulfide isomerase activity,flavin-linked...

extracellular region,extracellular space,Golgi app...

51

23

29

DFNIPGFPTVR.2|VGSPNAAVLWLWSSHNR.3|SFYTAYLQR.2|NNEE...

SEN / CTL

P09211

Glutathione S-transferase P

GSTP1

-0.37

0.63

0.000541

0.000445

response to reactive oxygen species,negative regul...

glutathione transferase activity,glutathione perox...

extracellular space,intracellular,nucleus,cytoplas...

48

20

44

ALPGQLKPFETLLSQNQGGK.3|ALPGQLKPFETLLSQNQGGK.2|ALPG...

SEN / CTL

O43854

EGF-like repeat and discoidin I-like domain-containing protein 3

EDIL3

-0.38

0.46

0.00476

0.00286

cell adhesion,multicellular organism development,p...

integrin binding,calcium ion binding

extracellular matrix,extracellular exosome,extrace...

15

11

13

SGHIQDYQITASSIFR.3|SGHIQDYQITASSIFR.2|GNIDNNTPYANS...

SEN / CTL

P62258

14-3-3 protein epsilon

YWHAE

-0.38

1.2

0.00699

0.00398

G2/M transition of mitotic cell cycle,neuron migra...

protein binding,potassium channel regulator activi...

mitochondrion,cytosol,kinesin complex,cell-cell ad...

90

36

102

LIC[CAM]C[CAM]DILDVLDKHLIPAANTGESK.4|LIC[CAM]C[CAM...

SEN / CTL

P15374

Ubiquitin carboxyl-terminal hydrolase isozyme L3

UCHL3

-0.38

0.36

0.00704

0.004

ubiquitin-dependent protein catabolic process,prot...

thiol-dependent ubiquitin-specific protease activi...

nucleus,cytoplasm,extracellular exosome

12

15

26

FLEESVSMSPEER.2|FLEESVSM[Oxi]SPEER.2|SQGQDVTSSVYFM...

SEN / CTL

P13667

Protein disulfide-isomerase A4

PDIA4

-0.38

1.14

0.00841

0.00465

protein folding,protein secretion,response to endo...

protein disulfide isomerase activity,protein bindi...

endoplasmic reticulum lumen,cell surface,melanosom...

60

69

125

FDVSGYPTIK.2|FDVSGYPTLK.2|IANILKDKDPPIPVAK.4|IANIL...

SEN / CTL

Q9UHY7

Enolase-phosphatase E1

ENOPH1

-0.38

0.34

0.0136

0.00682

dephosphorylation,L-methionine biosynthetic proces...

magnesium ion binding,acireductone synthase activi...

nucleus,cytosol,extracellular exosome

9

11

14

LLFGHSTEGDILELVDGHFDTK.4|LLFGHSTEGDILELVDGHFDTK.3|...

SEN / CTL

O00584

Ribonuclease T2

RNASET2

-0.38

0.89

0.0223

0.0104

RNA catabolic process,RNA phosphodiester bond hydr...

RNA binding,ribonuclease activity,ribonuclease T2 ...

extracellular region,extracellular space,lysosome,...

33

17

29

SWPFNLEEIKDLLPEMR.3|ELDLNSVLLK.2|LGIKPSINYYQVADFKD...

SEN / CTL

P25788

Proteasome subunit alpha type-3

PSMA3

-0.38

1.23

0.033

0.0143

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

24

15

25

AVENSSTAIGIR.2|LFNVDRHVGMAVAGLLADAR.4|VFQVEYAMK.2|...

SEN / CTL

Q92820

Gamma-glutamyl hydrolase

GGH

-0.39

0.21

1.34e-12

6.7e-12

proteolysis,glutamine metabolic process,response t...

exopeptidase activity,omega peptidase activity,gam...

extracellular space,nucleus,lysosome,vacuole,cytos...

30

19

26

YYIAASYVK.2|SINGILFPGGSVDLRR.3|VVPVRLDLTEKDYEILFK....

SEN / CTL

P07942

Laminin subunit beta-1

LAMB1

-0.39

0.48

1.47e-12

7.23e-12

cell adhesion,neuronal-glial interaction involved ...

structural molecule activity,extracellular matrix ...

extracellular region,basement membrane,laminin-1 c...

84

76

100

YSDIEPSTEGEVIFR.2|YSDIEPSTEGEVIFR.3|ISGVIGPYRETVDS...

SEN / CTL

P06748

Nucleophosmin

NPM1

-0.39

0.23

4.35e-11

1.68e-10

DNA repair,nucleosome assembly,intracellular prote...

DNA binding,transcription coactivator activity,RNA...

nucleus,nucleoplasm,nucleolus,cytoplasm,centrosome...

30

26

61

MSVQPTVSLGGFEITPPVVLR.3|MSVQPTVSLGGFEITPPVVLR.2|M[...

SEN / CTL

P00491

Purine nucleoside phosphorylase

PNP

-0.39

0.39

1.81e-8

4.4e-8

nucleobase-containing compound metabolic process,i...

nucleoside binding,purine nucleobase binding,purin...

intracellular,nucleus,cytoplasm,cytosol,cytoskelet...

48

26

53

VFGFSLITNK.2|HRPQVAIIC[CAM]GSGLGGLTDKLTQAQIFDYGEIP...

SEN / CTL

Q6YP21

Kynurenine--oxoglutarate transaminase 3

CCBL2

-0.39

0.25

0.0121

0.00624

2-oxoglutarate metabolic process,cellular amino ac...

kynurenine-oxoglutarate transaminase activity,pyri...

mitochondrion

6

19

24

IAAIDSLNQYTR.2|MAGATPVFIPLR.2|M[Oxi]AGATPVFIPLR.2|...

SEN / CTL

P37837

Transaldolase

TALDO1

-0.39

0.89

0.013

0.0066

carbohydrate metabolic process,xylulose biosynthet...

sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosp...

nucleus,cytoplasm,cytosol,extracellular exosome

30

31

43

LLGELLQDNAK.2|LLGELLQDNAK.3|LIELYKEAGISKDR.4|NAIDK...

SEN / CTL

P10155

60 kDa SS-A/Ro ribonucleoprotein

TROVE2

-0.39

0.66

0.0168

0.00818

immune system development,transcription from RNA p...

RNA binding,U2 snRNA binding,metal ion binding

nucleus,cytoplasm,intracellular ribonucleoprotein ...

24

27

39

LGLENAEALIR.2|ALLQEMPLTALLR.2|ALLQEMPLTALLR.3|ALLQ...

SEN / CTL

P11047

Laminin subunit gamma-1

LAMC1

-0.4

0.39

2.94e-12

1.39e-11

protein complex assembly,cell adhesion,endoderm de...

extracellular matrix structural constituent

extracellular region,basement membrane,laminin-1 c...

72

77

97

LSAEDLVLEGAGLR.2|LSAEDLVLEGAGLR.3|SQEC[CAM]YFDPELY...

SEN / CTL

Q9BRA2

Thioredoxin domain-containing protein 17

TXNDC17

-0.4

0.3

0.00000664

0.00000898

tumor necrosis factor-mediated signaling pathway,o...

peroxidase activity,protein binding,protein-disulf...

cytosol,extracellular exosome

21

11

18

TIFAYFTGSK.2|SWC[CAM]PDC[CAM]VQAEPVVR.2|SWC[CAM]PD...

SEN / CTL

Q12907

Vesicular integral-membrane protein VIP36

LMAN2

-0.4

0.36

0.0125

0.00641

ER to Golgi vesicle-mediated transport,retrograde ...

glycoprotein binding,mannose binding,carbohydrate ...

Golgi membrane,extracellular space,endoplasmic ret...

9

21

31

WTELAGC[CAM]TADFR.2|NLHGDGIALWYTR.3|NLHGDGIALWYTR....

SEN / CTL

Q9NWV4

UPF0587 protein C1orf123

C1orf123

-0.4

0.09

0.0126

0.00644

biological_process

molecular_function

extracellular exosome

3

8

11

ATLENITNLRPVGEDFR.3|ATLENITNLRPVGEDFR.4|ATLENITNLR...

SEN / CTL

Q9BWS9

Chitinase domain-containing protein 1

CHID1

-0.41

0.07

0.0109

0.00572

carbohydrate metabolic process,chitin catabolic pr...

chitinase activity,protein binding,chitin binding,...

extracellular space,nucleus,lysosome,late endosome...

3

18

27

FTQISPVWLQLK.2|FTQISPVWLQLK.3|GLVVTDLK.2|SQFSDKPVQ...

SEN / CTL

P04439

P13746

HLA class I histocompatibility antigen, A-3 alpha chain;HLA class I histocompatibility antigen, A-11 alpha chain

HLA-A

-0.41

0.65

0.0267

0.0121

;

;

;

39

10

16

WAAVVVPSGEEQR.2|SWTAADMAAQITKR.3|SWTAADMAAQITKR.2|...

SEN / CTL

Q86U42

Polyadenylate-binding protein 2

PABPN1

-0.41

0.21

0.0713

0.027

MAPK cascade,mRNA splicing, via spliceosome,termin...

nucleotide binding,RNA binding,protein binding,pol...

nucleus,nucleoplasm,cytoplasm,nuclear speck,intrac...

3

10

15

TSLALDESLFR.2|VREMEEEAEK.3|VREM[Oxi]EEEAEK.3|VTILC...

SEN / CTL

Q16881

Thioredoxin reductase 1, cytoplasmic

TXNRD1

-0.42

0.27

1.06e-16

7.99e-16

response to reactive oxygen species,mesoderm forma...

thioredoxin-disulfide reductase activity,electron ...

nucleus,mitochondrion,cytosol,extracellular exosom...

48

37

60

QFVPIKVEQIEAGTPGR.3|VVAQSTNSEEIIEGEYNTVMLAIGR.3|KV...

SEN / CTL

P63220

40S ribosomal protein S21

RPS21

-0.42

0.23

0.000153

0.000148

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,poly(A) RNA bin...

nucleoplasm,cytoplasm,cytosol,small ribosomal subu...

9

7

18

TYAIC[CAM]GAIR.2|DHASIQMNVAEVDKVTGR.4|DHASIQMNVAEV...

SEN / CTL

Q15631

Translin

TSN

-0.42

0.37

0.000169

0.000161

DNA recombination,RNA metabolic process,gene silen...

DNA binding,single-stranded DNA binding,mRNA bindi...

nucleus,cytosol

15

16

25

KVEEVVYDLSIR.3|KVEEVVYDLSIR.2|EAVTEILGIEPDREK.3|LS...

SEN / CTL

Q16363

Laminin subunit alpha-4

LAMA4

-0.42

0.46

0.00411

0.00253

cell adhesion,regulation of cell adhesion,extracel...

receptor binding,extracellular matrix structural c...

extracellular region,basement membrane,basal lamin...

12

42

51

SLLSDVEELVEKENQASR.3|C[CAM]LDGYIGDSIR.2|ELVDEEADEA...

SEN / CTL

Q8IZ83

Aldehyde dehydrogenase family 16 member A1

ALDH16A1

-0.42

0.08

0.00705

0.004

oxidation-reduction process

aminobutyraldehyde dehydrogenase activity,4-trimet...

membrane,extracellular exosome

3

23

29

AALLWALAAALER.2|LAEVIQK.2|LLWTLESLVTGR.3|LLWTLESLV...

SEN / CTL

Q8N1N4

Keratin, type II cytoskeletal 78

KRT78

-0.42

0.15

0.0339

0.0145

structural molecule activity

extracellular space,keratin filament,extracellular...

3

13

14

TLNNQFASFIDKVR.3|VQISQLHQEIQR.3|VQISQLHQEIQR.2|TQE...

SEN / CTL

P10586

Receptor-type tyrosine-protein phosphatase F

PTPRF

-0.43

0.26

1.63e-15

1.08e-14

cell adhesion,transmembrane receptor protein tyros...

protein tyrosine phosphatase activity,transmembran...

plasma membrane,integral component of plasma membr...

45

55

65

NVLELSNVVR.2|IISYTVVFR.2|WFYIVVVPIDR.2|SDMGVGVFTPT...

SEN / CTL

P28066

Proteasome subunit alpha type-5

PSMA5

-0.43

0.33

0.000014

0.0000173

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

21

17

34

LFQVEYAIEAIK.2|LFQVEYAIEAIK.3|SEYDRGVNTFSPEGR.3|AI...

SEN / CTL

P22352

Glutathione peroxidase 3

GPX3

-0.43

0.18

0.00041

0.000349

response to reactive oxygen species,response to li...

glutathione peroxidase activity,transcription fact...

extracellular region,extracellular space,extracell...

6

7

10

MDILSYMR.2|FLVGPDGIPIMR.2|FLVGPDGIPIM[Oxi]R.2|LFWE...

SEN / CTL

Q16836

Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

HADH

-0.43

0.43

0.00265

0.00175

fatty acid beta-oxidation,response to activity,res...

3-hydroxyacyl-CoA dehydrogenase activity,NAD+ bind...

nucleoplasm,cytoplasm,mitochondrion,mitochondrial ...

12

22

45

TFESLVDFSK.2|TLSTIATSTDAASVVHSTDLVVEAIVENLK.4|TLST...

SEN / CTL

P07686

Beta-hexosaminidase subunit beta

HEXB

-0.43

0.31

0.0129

0.0066

skeletal system development,glycosphingolipid meta...

beta-N-acetylhexosaminidase activity,acetylglucosa...

acrosomal vesicle,extracellular space,membrane,azu...

9

27

38

VLDIIATINK.2|LAPGTIVEVWKDSAYPEELSR.3|LAPGTIVEVWKDS...

SEN / CTL

Q9Y646

Carboxypeptidase Q

CPQ

-0.43

0.54

0.0373

0.0156

proteolysis,thyroid hormone generation,tissue rege...

carboxypeptidase activity,protein homodimerization...

extracellular space,cytoplasm,lysosome,endoplasmic...

6

10

10

LALLVDTVGPR.2|AIINLAVYGK.2|VHLEPVRIPHWER.4|VGALASL...

SEN / CTL

P19338

Nucleolin

NCL

-0.44

0.66

7.97e-12

3.36e-11

angiogenesis,positive regulation of transcription ...

nucleotide binding,RNA binding,protein binding,pro...

nucleus,nucleoplasm,nucleolus,cell cortex,membrane...

60

63

97

NDLAVVDVR.2|GFGFVDFNSEEDAK.2|EVFEDAAEIR.2|NLPYKVTQ...

SEN / CTL

P48637

Glutathione synthetase

GSS

-0.44

0.42

3.09e-7

5.84e-7

cellular amino acid metabolic process,glutathione ...

magnesium ion binding,glutathione synthase activit...

cytosol,extracellular exosome

30

27

39

AWELYGSPNALVLLIAQEKER.3|ALAEGVLLR.2|EGIAQTVFLGLNR....

SEN / CTL

P28065

Proteasome subunit beta type-9

PSMB9

-0.44

0.33

0.00113

0.000838

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity

proteasome complex,nucleoplasm,cytoplasm,cytosol,p...

12

8

12

FTTDAIALAMSR.2|FTTDAIALAMSR.3|EGGQVYGTLGGMLTR.2|VI...

SEN / CTL

P30086

Phosphatidylethanolamine-binding protein 1

PEBP1

-0.45

0.78

0.00386

0.00242

MAPK cascade,negative regulation of endopeptidase ...

serine-type endopeptidase inhibitor activity,prote...

nucleus,cytosol,extracellular exosome

57

25

48

YVWLVYEQDRPLKC[CAM]DEPILSNR.4|YVWLVYEQDRPLKC[CAM]D...

SEN / CTL

P62310

U6 snRNA-associated Sm-like protein LSm3

LSM3

-0.45

0.38

0.00605

0.00355

mRNA splicing, via spliceosome,mRNA processing,cyt...

RNA binding,protein binding,poly(A) RNA binding

cytoplasmic mRNA processing body,nucleus,nucleopla...

9

4

4

GDGVVLVAPPLRVG.2|NIPMLFVR.2|GDGVVLVAPPLR.2|RNIPMLF...

SEN / CTL

Q9H299

SH3 domain-binding glutamic acid-rich-like protein 3

SH3BGRL3

-0.45

1.47

0.116

0.0401

regulation of actin filament depolymerization,regu...

GTPase activator activity,electron carrier activit...

nucleus,cytoplasm,lamellipodium,extracellular exos...

12

7

15

ATPPQIVNGDQYC[CAM]GDYELFVEAVEQNTLQEFLK.4|IQYQLVDIS...

SEN / CTL

P17174

Aspartate aminotransferase, cytoplasmic

GOT1

-0.46

0.23

1.75e-10

6.2e-10

gluconeogenesis,2-oxoglutarate metabolic process,o...

L-aspartate:2-oxoglutarate aminotransferase activi...

nucleus,cytoplasm,lysosome,cytosol,axon terminus,e...

30

36

57

VGGVQSLGGTGALR.2|IGADFLAR.2|TDDC[CAM]HPWVLPVVK.3|T...

SEN / CTL

Q9NZ08

Endoplasmic reticulum aminopeptidase 1

ERAP1

-0.46

0.29

1e-8

2.58e-8

angiogenesis,adaptive immune response,antigen proc...

endopeptidase activity,aminopeptidase activity,int...

extracellular region,extracellular space,endoplasm...

24

41

61

GFPLITITVR.2|ILASTQFEPTAAR.2|TKTDVLILPEEVEWIK.3|TK...

SEN / CTL

Q9BWD1

Acetyl-CoA acetyltransferase, cytosolic

ACAT2

-0.46

0.2

2.49e-8

5.86e-8

lipid metabolic process,fatty acid beta-oxidation

acetyl-CoA C-acetyltransferase activity

nucleus,nucleolus,cytoplasm,mitochondrion,extracel...

18

22

41

ILVTLLHTLER.3|ILVTLLHTLER.2|AGHFDKEIVPVLVSTR.4|AGH...

SEN / CTL

Q02818

Nucleobindin-1

NUCB1

-0.46

0.99

0.00000375

0.00000545

response to cisplatin,regulation of protein target...

G-protein alpha-subunit binding,DNA binding,calciu...

extracellular space,nucleus,early endosome,rough e...

63

33

46

DLELLIQTATR.2|LLERLPEVEVPQHL.3|LPEVEVPQHL.2|ELQQAV...

SEN / CTL

P40925

Malate dehydrogenase, cytoplasmic

MDH1

-0.46

0.39

0.00000443

0.00000623

gluconeogenesis,tricarboxylic acid cycle,oxaloacet...

malic enzyme activity,L-malate dehydrogenase activ...

extracellular space,cytoplasm,mitochondrion,centro...

33

23

39

FVEGLPINDFSR.2|VIVVGNPANTNC[CAM]LTASK.2|VIVVGNPANT...

SEN / CTL

P45877

Peptidyl-prolyl cis-trans isomerase C

PPIC

-0.46

0.26

0.00292

0.0019

protein peptidyl-prolyl isomerization,protein fold...

peptidyl-prolyl cis-trans isomerase activity,prote...

cytoplasm,extracellular exosome

6

3

3

TPFVVEIADW.2|IVIGLFGK.2|TVENFVALATGEK.2

SEN / CTL

Q6UVY6

DBH-like monooxygenase protein 1

MOXD1

-0.46

0.05

0.00312

0.00202

oxidation-reduction process

copper ion binding,protein binding,oxidoreductase ...

endoplasmic reticulum membrane,integral component ...

3

2

2

LVLSLPVNVR.2|ELHTC[CAM]DINDK.2

SEN / CTL

P67936

Tropomyosin alpha-4 chain

TPM4

-0.46

1.24

0.00439

0.00267

osteoblast differentiation,movement of cell or sub...

actin binding,calcium ion binding,protein binding,...

stress fiber,podosome,cytosol,cytoskeleton,muscle ...

99

36

62

IQLVEEELDRAQER.3|IQLVEEELDRAQER.2|RIQLVEEELDRAQER....

SEN / CTL

Q13740

CD166 antigen

ALCAM

-0.47

0.48

1.63e-10

5.93e-10

adaptive immune response,cell adhesion,heterophili...

receptor binding,protein binding

immunological synapse,integral component of plasma...

51

30

45

ALFLETEQLK.2|ESLTLIVEGKPQIK.3|ESLTLIVEGKPQIK.2|WKY...

SEN / CTL

P35052

Glypican-1

GPC1

-0.47

0.36

0.0000317

0.0000352

retinoid metabolic process,glycosaminoglycan biosy...

copper ion binding,fibroblast growth factor bindin...

proteinaceous extracellular matrix,extracellular s...

21

13

13

VLQAMLATQLR.2|SFVQGLGVASDVVR.2|GFSLSDVPQAEISGEHLR....

SEN / CTL

P61086

Ubiquitin-conjugating enzyme E2 K

UBE2K

-0.47

0.49

0.126

0.0429

ubiquitin-dependent protein catabolic process,posi...

ubiquitin-protein transferase activity,protein bin...

nucleus,cytoplasm,filopodium tip,extracellular exo...

6

16

27

LWAHVYAGAPVSSPEYTK.3|LWAHVYAGAPVSSPEYTK.4|LWAHVYAG...

SEN / CTL

P62158

Calmodulin

CALM1

-0.48

0.46

4.79e-8

1.05e-7

G2/M transition of mitotic cell cycle,MAPK cascade...

Ras guanyl-nucleotide exchange factor activity,cal...

spindle pole,extracellular region,nucleus,nucleopl...

33

14

31

VFDKDGNGYISAAELR.3|VFDKDGNGYISAAELR.2|EAFSLFDKDGDG...

SEN / CTL

O75347

Tubulin-specific chaperone A

TBCA

-0.48

1.08

0.0133

0.00674

protein folding,tubulin complex assembly,post-chap...

poly(A) RNA binding,beta-tubulin binding,chaperone...

nucleolus,cytoplasm,microtubule,microtubule cytosk...

24

14

23

LVLDSVKLEA.2|ILENEKDLEEAEEYKEAR.4|ILENEKDLEEAEEYKE...

SEN / CTL

Q15637

Splicing factor 1

SF1

-0.48

0.12

0.0157

0.00767

spliceosomal complex assembly,mRNA 3'-splice site ...

transcription corepressor activity,RNA binding,pro...

nucleus,nucleoplasm,spliceosomal complex,ribosome

3

20

37

VSDKVMIPQDEYPEINFVGLLIGPR.3|C[CAM]GGAGHIASDC[CAM]K...

SEN / CTL

Q16531

DNA damage-binding protein 1

DDB1

-0.49

0.45

1.45e-14

7.99e-14

nucleotide-excision repair, DNA damage recognition...

DNA binding,protein binding,damaged DNA binding

nuclear chromosome, telomeric region,extracellular...

87

71

100

IGRPSETGIIGIIDPEC[CAM]R.3|LLASINSTVR.2|QSGESIDIITR...

SEN / CTL

P13798

Acylamino-acid-releasing enzyme

APEH

-0.49

0.37

2.5e-7

4.79e-7

translational termination,proteolysis,beta-amyloid...

serine-type endopeptidase activity,omega peptidase...

cytoplasm,cytosol,nuclear membrane,extracellular e...

33

34

45

VTSVVVDVVPR.2|QVLLSEPEEAAALYR.2|QVLLSEPEEAAALYR.3|...

SEN / CTL

P12955

Xaa-Pro dipeptidase

PEPD

-0.49

0.45

0.0000146

0.0000178

proteolysis,cellular amino acid metabolic process,...

aminopeptidase activity,metallocarboxypeptidase ac...

extracellular exosome

24

27

41

VPLALFALNR.2|YAVDDVQYVDEIASVLTSQKPSVLLTLR.3|YAVDDV...

SEN / CTL

O95777

U6 snRNA-associated Sm-like protein LSm8

LSM8

-0.49

0.19

0.034

0.0145

mRNA splicing, via spliceosome

RNA binding,protein binding,U6 snRNA binding,poly(...

nucleoplasm,spliceosomal complex,U4/U6 x U5 tri-sn...

3

4

6

GFDQTINLILDESHER.3|GFDQTINLILDESHER.2|TVAVITSDGR.2...

SEN / CTL

Q15393

Splicing factor 3B subunit 3

SF3B3

-0.5

0.19

2.67e-8

6.21e-8

RNA splicing, via transesterification reactions,mR...

RNA binding

nucleus,nucleoplasm,spliceosomal complex,U12-type ...

15

61

96

FLAVGLVDNTVR.2|TVLDPVTGDLSDTR.2|TVLDPVTGDLSDTR.3|M...

SEN / CTL

Q9GZT8

NIF3-like protein 1

NIF3L1

-0.5

0.37

0.000213

0.000198

neuron differentiation,positive regulation of tran...

protein binding,transcription factor binding,ident...

nucleus,cytoplasm,mitochondrion

12

15

19

GIDGVSVTSFSAR.2|ALMQVVDFLSR.2|ALM[Oxi]QVVDFLSR.2|V...

SEN / CTL

P30481

P30483

HLA class I histocompatibility antigen, B-44 alpha chain;HLA class I histocompatibility antigen, B-45 alpha chain

HLA-B

-0.5

1.16

0.00919

0.00498

;

;

;

9

3

4

DGEDQTQDTELVETRPAGDR.3|DGEDQTQDTELVETRPAGDR.4|AYLE...

SEN / CTL

P55145

Mesencephalic astrocyte-derived neurotrophic factor

MANF

-0.51

0.25

0.0000114

0.0000145

response to unfolded protein,biological_process,ne...

growth factor activity,poly(A) RNA binding

extracellular space,nucleus,endoplasmic reticulum

12

16

22

FYQDLKDRDVTFSPATIENELIK.4|IINEVSKPLAHHIPVEK.4|IINE...

SEN / CTL

P22626

Heterogeneous nuclear ribonucleoproteins A2/B1

HNRNPA2B1

-0.51

1.1

0.0000242

0.0000281

negative regulation of transcription from RNA poly...

nucleotide binding,RNA binding,mRNA 3'-UTR binding...

nucleus,nucleoplasm,spliceosomal complex,cytoplasm...

60

47

96

IDTIEIITDR.2|LFIGGLSFETTEESLR.3|LFIGGLSFETTEESLR.2...

SEN / CTL

Q9BYZ2

L-lactate dehydrogenase A-like 6B

LDHAL6B

-0.51

0.3

0.00467

0.00282

carbohydrate metabolic process,pyruvate metabolic ...

L-lactate dehydrogenase activity

nucleus,mitochondrial matrix

6

1

2

LIIVSNPVDILTYVAWK.3|LIIVSNPVDILTYVAWK.2

SEN / CTL

P16070

CD44 antigen

CD44

-0.51

0.46

0.00762

0.00427

cell-matrix adhesion,single organismal cell-cell a...

collagen binding,hyaluronic acid binding,cytokine ...

cytoplasm,Golgi apparatus,plasma membrane,integral...

12

12

18

YGFIEGHVVIPR.3|YGFIEGHVVIPR.2|ALSIGFETC[CAM]R.2|SQ...

SEN / CTL

P06865

Beta-hexosaminidase subunit alpha

HEXA

-0.52

0.37

0.00000154

0.00000247

carbohydrate metabolic process,glycosaminoglycan b...

beta-N-acetylhexosaminidase activity,acetylglucosa...

membrane,azurophil granule,lysosomal lumen,extrace...

24

21

32

ALLSAPWYLNR.2|GLETFSQLVWK.2|SNPEIQDFMR.2|LTSDLTFAY...

SEN / CTL

P80723

Brain acid soluble protein 1

BASP1

-0.52

0.72

0.049

0.0197

thorax and anterior abdomen determination,gonad de...

transcription corepressor activity,protein binding...

nucleus,cytoplasm,cytoskeleton,plasma membrane,nuc...

9

28

41

AQGPAASAEEPKPVEAPAANSDQTVTVKE.3|AQGPAASAEEPKPVEAPA...

SEN / CTL

P00390

Glutathione reductase, mitochondrial

GSR

-0.53

0.86

0.0503

0.0201

response to reactive oxygen species,glutathione me...

glutathione-disulfide reductase activity,electron ...

mitochondrial matrix,cytosol,external side of plas...

33

32

54

GIYAVGDVC[CAM]GK.2|ALLTPVAIAAGR.2|GHAAFTSDPKPTIEVS...

SEN / CTL

P54727

UV excision repair protein RAD23 homolog B

RAD23B

-0.54

0.32

2.45e-7

4.72e-7

nucleotide-excision repair, DNA damage recognition...

damaged DNA binding,single-stranded DNA binding,pr...

proteasome complex,nucleus,nucleoplasm,cytoplasm,X...

21

20

33

NFVVVMVTKPK.2|NFVVVMVTKPK.3|ILNDDTALKEYKIDEK.4|ILN...

SEN / CTL

P00492

Hypoxanthine-guanine phosphoribosyltransferase

HPRT1

-0.54

0.52

0.0000751

0.0000768

response to amphetamine,purine nucleotide biosynth...

nucleotide binding,magnesium ion binding,hypoxanth...

cytoplasm,cytosol,extracellular exosome

21

17

27

SIPMTVDFIR.2|NVLIVEDIIDTGK.2|TMQTLLSLVR.2|TM[Oxi]Q...

SEN / CTL

P98066

Tumor necrosis factor-inducible gene 6 protein

TNFAIP6

-0.54

0.15

0.0274

0.0123

inflammatory response,cell adhesion,signal transdu...

protein binding,hyaluronic acid binding

extracellular space

3

1

1

FLSDASVTAGGFQIK.2

SEN / CTL

P06132

Uroporphyrinogen decarboxylase

UROD

-0.55

0.52

0.00116

0.000858

protoporphyrinogen IX biosynthetic process,heme bi...

uroporphyrinogen decarboxylase activity

nucleoplasm,cytoplasm,cytosol

12

12

18

LRDPEVVASELGYVFQAITLTR.3|LRDPEVVASELGYVFQAITLTR.4|...

SEN / CTL

O43505

Beta-1,4-glucuronyltransferase 1

B4GAT1

-0.55

0.29

0.00393

0.00244

axon guidance,keratan sulfate biosynthetic process...

N-acetyllactosaminide beta-1,3-N-acetylglucosaminy...

Golgi membrane,Golgi apparatus,integral component ...

6

5

5

TALASGGVLDASGDYR.2|TTMDPNDVILATHASVDNLLHLSGLLER.4|...

SEN / CTL

P07954

Fumarate hydratase, mitochondrial

FH

-0.55

0.71

0.0054

0.00321

tricarboxylic acid cycle,fumarate metabolic proces...

fumarate hydratase activity

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

18

30

61

IYELAAGGTAVGTGLNTR.2|IYELAAGGTAVGTGLNTR.3|THTQDAVP...

SEN / CTL

P51858

Hepatoma-derived growth factor

HDGF

-0.56

0.36

8.89e-9

2.31e-8

negative regulation of transcription from RNA poly...

nucleotide binding,RNA polymerase II transcription...

extracellular space,nucleoplasm,cytoplasm,transcri...

21

29

48

KGFSEGLWEIENNPTVK.3|KGFSEGLWEIENNPTVK.2|GPPQEEEEEE...

SEN / CTL

O14907

Tax1-binding protein 3

TAX1BP3

-0.56

0.19

0.0205

0.00959

Rho protein signal transduction,negative regulatio...

protein binding,beta-catenin binding,protein C-ter...

nucleus,cytoplasm,cytosol,plasma membrane,extracel...

3

4

5

VSEGGPAEIAGLQIGDK.2|VSEGGPAEIAGLQIGDK.3|AVQQSMLS.2...

SEN / CTL

Q15424

Scaffold attachment factor B1

SAFB

-0.56

0.54

0.0448

0.0183

chromatin organization,transcription, DNA-template...

nucleotide binding,core promoter binding,chromatin...

nucleus,nucleoplasm

6

36

54

AIEDEGGNPDEIEITSEGNKK.3|AIEDEGGNPDEIEITSEGNKK.4|AI...

SEN / CTL

P13497

Bone morphogenetic protein 1

BMP1

-0.56

0.25

0.0591

0.0231

skeletal system development,cartilage condensation...

metalloendopeptidase activity,serine-type endopept...

extracellular region,proteinaceous extracellular m...

3

2

2

AGFAVNFFK.2|NC[CAM]IWQLVAPTQYR.2

SEN / CTL

P05067

Amyloid beta A4 protein

APP

-0.58

0.44

1.25e-9

3.71e-9

response to yeast,suckling behavior,platelet degra...

DNA binding,serine-type endopeptidase inhibitor ac...

extracellular region,extracellular space,nuclear e...

36

21

26

LALENYITALQAVPPRPR.3|WYFDVTEGK.2|ISYGNDALMPSLTETK....

SEN / CTL

P00736

Complement C1r subcomponent

C1R

-0.58

0.34

7.26e-9

1.92e-8

proteolysis,immune response,complement activation,...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular exosome,blood m...

27

25

35

M[Oxi]GNFPWQVFTNIHGR.3|MGNFPWQVFTNIHGR.3|LPVANPQAC...

SEN / CTL

Q8NBS9

Thioredoxin domain-containing protein 5

TXNDC5

-0.58

0.79

0.0000669

0.00007

protein folding,response to endoplasmic reticulum ...

protein disulfide isomerase activity

endoplasmic reticulum,endoplasmic reticulum lumen,...

33

30

49

GYPTLLLFR.2|GYPTLLWFR.2|FVLSQAKDEL.2|IGKVDC[CAM]TQ...

SEN / CTL

Q99729

Heterogeneous nuclear ribonucleoprotein A/B

HNRNPAB

-0.58

0.4

0.000905

0.000702

epithelial to mesenchymal transition,positive regu...

nucleotide binding,RNA binding,mRNA binding,protei...

nucleus,nucleoplasm,cytoplasm,intracellular ribonu...

9

14

26

GFGFILFK.2|MFVGGLSWDTSKK.3|M[Oxi]FVGGLSWDTSKK.3|M[...

SEN / CTL

P35908

Keratin, type II cytoskeletal 2 epidermal

KRT2

-0.58

0.94

0.00103

0.000779

keratinocyte development,epidermis development,ker...

structural constituent of cytoskeleton,protein bin...

extracellular space,nucleus,cytoplasm,Golgi appara...

54

56

105

YEELQVTVGR.2|FLEQQNQVLQTK.2|FLEQQNQVLQTK.3|VDLLNQE...

SEN / CTL

Q71DI3

Histone H3.2

HIST2H3A

-0.58

0.35

0.017

0.00825

negative regulation of transcription from RNA poly...

protein binding,nucleosomal DNA binding,histone bi...

nucleosome,extracellular region,nucleus,nucleoplas...

6

1

4

FQSSAVMALQEASEAYLVGLFEDTNLC[CAM]AIHAK.4|FQSSAVM[Ox...

SEN / CTL

Q9GZM7

Tubulointerstitial nephritis antigen-like

TINAGL1

-0.59

0.41

0.00000325

0.0000048

receptor-mediated endocytosis,immune response,cell...

scavenger receptor activity,extracellular matrix s...

extracellular region,extracellular space,extracell...

21

21

33

ITGWGEETLPDGR.2|LDGAWWFLR.2|QATAHC[CAM]PNSYVNNNDIY...

SEN / CTL

P06744

Glucose-6-phosphate isomerase

GPI

-0.63

0.6

7.28e-20

8.55e-19

angiogenesis,in utero embryonic development,mesode...

glucose-6-phosphate isomerase activity,cytokine ac...

extracellular space,nucleoplasm,cytoplasm,cytosol,...

141

49

107

TLAQLNPESSLFIIASK.2|TLAQLNPESSLFIIASK.3|VKEFGIDPQN...

SEN / CTL

Q06481

Amyloid-like protein 2

APLP2

-0.63

0.34

2.46e-9

7.08e-9

platelet degranulation,G-protein coupled receptor ...

DNA binding,serine-type endopeptidase inhibitor ac...

nucleus,plasma membrane,membrane,integral componen...

24

16

20

C[CAM]LVGEFVSDVLLVPEK.3|C[CAM]LVGEFVSDVLLVPEK.2|VP...

SEN / CTL

P09493

Tropomyosin alpha-1 chain

TPM1

-0.64

1.39

0.029

0.0128

in utero embryonic development,positive regulation...

actin binding,structural constituent of cytoskelet...

stress fiber,cytosol,cytoskeleton,muscle thin fila...

60

27

42

AQKDEEKMEIQEIQLK.4|AQKDEEKMEIQEIQLK.3|SKQLEDELVSLQ...

SEN / CTL

O75144

ICOS ligand

ICOSLG

-0.64

0.27

0.0458

0.0186

adaptive immune response,defense response,hyperosm...

receptor binding

plasma membrane,integral component of membrane,ext...

3

1

1

GLYDVVSVLR.2

SEN / CTL

P07195

L-lactate dehydrogenase B chain

LDHB

-0.65

1.22

5.72e-8

1.22e-7

carbohydrate metabolic process,lactate metabolic p...

L-lactate dehydrogenase activity,protein binding,k...

cytoplasm,mitochondrion,cytosol,membrane,myelin sh...

99

35

73

IVVVTAGVR.2|SADTLWDIQKDLKDL.2|SADTLWDIQKDLKDL.3|FI...

SEN / CTL

Q01130

Serine/arginine-rich splicing factor 2

SRSF2

-0.65

0.2

0.00000388

0.00000561

regulation of alternative mRNA splicing, via splic...

nucleotide binding,transcription corepressor activ...

nucleus,nucleoplasm,spliceosomal complex,nuclear s...

9

7

13

FHDKRDAEDAMDAMDGAVLDGR.4|VGDVYIPR.2|DAEDAMDAMDGAVL...

SEN / CTL

P00441

Superoxide dismutase [Cu-Zn]

SOD1

-0.66

0.61

0.0000181

0.0000217

activation of MAPK activity,response to reactive o...

superoxide dismutase activity,copper ion binding,p...

extracellular region,extracellular space,nucleus,n...

30

20

39

LAC[CAM]GVIGIAQ.2|HVGDLGNVTADKDGVADVSIEDSVISLSGDHC...

SEN / CTL

P09341

P19875

P19876

Growth-regulated alpha protein;C-X-C motif chemokine 2;C-X-C motif chemokine 3

CXCL1

CXCL2

CXCL3

-0.66

0.28

0.0011

0.000827

chemotaxis,inflammatory response,immune response,s...

receptor binding,chemokine activity,enzyme activat...

extracellular region,extracellular space,intracell...

6

1

2

SPGPHC[CAM]AQTEVIATLK.3|SPGPHC[CAM]AQTEVIATLK.2

SEN / CTL

P28070

Proteasome subunit beta type-4

PSMB4

-0.66

0.59

0.0392

0.0162

MAPK cascade,protein polyubiquitination,stimulator...

lipopolysaccharide binding,threonine-type endopept...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

15

10

21

TQNPMVTGTSVLGVK.2|TQNPMVTGTSVLGVK.3|TQNPM[Oxi]VTGT...

SEN / CTL

Q15582

Transforming growth factor-beta-induced protein ig-h3

TGFBI

-0.67

0.69

1.25e-17

9.89e-17

angiogenesis,chondrocyte differentiation,cell adhe...

integrin binding,protein binding,collagen binding,...

extracellular region,proteinaceous extracellular m...

93

38

60

LTLLAPLNSVFKDGTPPIDAHTR.4|LTLLAPLNSVFKDGTPPIDAHTR....

SEN / CTL

Q9P2B2

Prostaglandin F2 receptor negative regulator

PTGFRN

-0.68

0.41

1.96e-10

6.87e-10

lipid particle organization

protein binding

endoplasmic reticulum membrane,Golgi apparatus,pla...

24

22

23

FTVSWYYR.2|LDRDSLVHSSPHVALSHVDAR.5|LDRDSLVHSSPHVAL...

SEN / CTL

P27695

DNA-(apurinic or apyrimidinic site) lyase

APEX1

-0.69

0.64

0.00000673

0.00000904

telomere maintenance,DNA repair,base-excision repa...

DNA binding,damaged DNA binding,double-stranded te...

nuclear chromosome, telomeric region,nucleus,nucle...

27

28

52

QGFGELLQAVPLADSFR.2|QGFGELLQAVPLADSFR.3|IC[CAM]SWN...

SEN / CTL

P60033

CD81 antigen

CD81

-0.69

0.36

0.000016

0.0000193

activation of MAPK activity,cell surface receptor ...

protein binding,MHC class II protein complex bindi...

immunological synapse,plasma membrane,integral com...

12

5

8

TFHETLDC[CAM]C[CAM]GSSTLTALTTSVLK.3|TFHETLDC[CAM]C...

SEN / CTL

P07108

Acyl-CoA-binding protein

DBI

-0.7

0.19

0.00000345

0.00000503

transport,phosphatidylcholine acyl-chain remodelin...

lipid binding,benzodiazepine receptor binding,long...

endoplasmic reticulum,Golgi apparatus,extracellula...

9

8

18

TKPSDEEMLFIYGHYK.3|TKPSDEEMLFIYGHYK.4|TKPSDEEM[Oxi...

SEN / CTL

P99999

Cytochrome c

CYCS

-0.71

0.36

0.0000636

0.0000673

response to reactive oxygen species,mitochondrial ...

protein binding,heme binding,electron transporter,...

protein phosphatase type 2A complex,nucleus,mitoch...

9

13

27

ADLIAYLK.2|ADLIAYLK.1|MIFVGIK.2|M[Oxi]IFVGIK.2|MIF...

SEN / CTL

P63165

Small ubiquitin-related modifier 1

SUMO1

-0.71

0.48

0.116

0.0402

DNA repair,double-strand break repair via nonhomol...

protein binding,transcription factor binding,potas...

heterochromatin,fibrillar center,XY body,nucleus,n...

3

6

8

VIGQDSSEIHFK.3|VIGQDSSEIHFK.2|FLFEGQR.2|IADNHTPK.2...

SEN / CTL

P15291

Beta-1,4-galactosyltransferase 1

B4GALT1

-0.72

0.26

5.53e-9

1.52e-8

epithelial cell development,acute inflammatory res...

beta-N-acetylglucosaminylglycopeptide beta-1,4-gal...

Golgi trans cisterna,Golgi membrane,extracellular ...

15

7

9

VAIIIPFR.2|YWLYYLHPVLQR.3|QQLDYGIYVINQAGDTIFNR.3|E...

SEN / CTL

O00560

Syntenin-1

SDCBP

-0.72

0.37

0.0000198

0.0000233

negative regulation of receptor internalization,pr...

glycoprotein binding,frizzled binding,interleukin-...

extracellular space,nucleus,cytoplasm,endoplasmic ...

12

13

25

SLMDHTIPEV.2|DSTGHVGFIFK.3|DSTGHVGFIFK.2|SIDNGIFVQ...

SEN / CTL

Q16629

Serine/arginine-rich splicing factor 7

SRSF7

-0.72

0.38

0.00567

0.00335

mRNA splicing, via spliceosome,termination of RNA ...

nucleotide binding,protein binding,zinc ion bindin...

nucleus,nucleoplasm,cytoplasm,extracellular exosom...

6

10

17

VYVGNLGTGAGKGELER.3|VYVGNLGTGAGKGELER.2|VRVELSTGMP...

SEN / CTL

Q9NX55

Huntingtin-interacting protein K

HYPK

-0.72

0.4

0.0902

0.0329

protein binding

nucleoplasm,cytoplasm,microtubule cytoskeleton

3

11

15

SLREHMGNVVEALIALTN.3|KHDSGAADLER.3|KHDSGAADLER.2|H...

SEN / CTL

P07093

Glia-derived nexin

SERPINE2

-0.73

0.22

1.55e-15

1.04e-14

blood coagulation,negative regulation of cell prol...

serine-type endopeptidase inhibitor activity,recep...

extracellular region,extracellular space,cytosol,e...

27

11

14

LVLVNAVYFK.2|SYQVPMLAQLSVFR.2|ASAATTAILIAR.2|TIDSW...

SEN / CTL

P01130

Low-density lipoprotein receptor

LDLR

-0.73

0.43

0.00722

0.00408

lipid metabolic process,endocytosis,receptor-media...

virus receptor activity,glycoprotein binding,prote...

lysosome,early endosome,late endosome,Golgi appara...

6

18

20

NVVALDTEVASNR.2|AVGSIAYLFFTNR.2|AHGVSSYDTVISR.3|AH...

SEN / CTL

O14786

Neuropilin-1

NRP1

-0.74

0.31

2.94e-10

9.92e-10

angiogenesis,patterning of blood vessels,neuron mi...

vascular endothelial growth factor-activated recep...

semaphorin receptor complex,extracellular space,ea...

21

12

14

FVTAVGTQGAISK.2|IAPPPVVSSGPFLFIK.3|IAPPPVVSSGPFLFI...

SEN / CTL

P24592

Insulin-like growth factor-binding protein 6

IGFBP6

-0.74

0.09

0.00000478

0.00000658

regulation of cell growth,signal transduction,nega...

receptor binding,insulin-like growth factor I bind...

extracellular region,extracellular space,Golgi app...

6

4

4

HLDSVLQQLQTEVYR.3|EGQEC[CAM]GVYTPNC[CAM]APGLQC[CAM...

SEN / CTL

P13645

Keratin, type I cytoskeletal 10

KRT10

-0.75

0.83

2.62e-12

1.26e-11

keratinocyte differentiation

structural constituent of epidermis

extracellular space,nucleus,cytoplasm,intermediate...

93

52

104

IRLENEIQTYR.3|IRLENEIQTYR.2|LKYENEVALR.3|LKYENEVAL...

SEN / CTL

P27797

Calreticulin

CALR

-0.75

1.08

1.94e-8

4.67e-8

negative regulation of transcription from RNA poly...

complement component C1q binding,glycoprotein bind...

acrosomal vesicle,extracellular region,proteinaceo...

87

52

95

EQFLDGDGWTSR.2|FYALSASFEPFSNK.2|FYALSASFEPFSNK.3|G...

SEN / CTL

Q14767

Latent-transforming growth factor beta-binding protein 2

LTBP2

-0.75

0.17

0.0145

0.00722

protein targeting,transforming growth factor beta ...

calcium ion binding,protein binding,heparin bindin...

proteinaceous extracellular matrix,extracellular s...

3

8

8

SSEVYAQLC[CAM]NVAR.2|RSTPLGQQQPAPR.3|SSAAGEGTLAR.2...

SEN / CTL

P56159

GDNF family receptor alpha-1

GFRA1

-0.75

0.29

0.0621

0.0241

MAPK cascade,cell surface receptor signaling pathw...

Ras guanyl-nucleotide exchange factor activity,rec...

intracellular,plasma membrane,extrinsic component ...

3

5

5

LADFFTNC[CAM]QPESR.2|EGLGASSHITTK.3|NKPLGPAGSENEIP...

SEN / CTL

P07951

Tropomyosin beta chain

TPM2

-0.75

0.76

0.0846

0.0314

muscle contraction,muscle filament sliding,regulat...

actin binding,structural constituent of muscle

cytosol,muscle thin filament tropomyosin

12

24

37

AMKDEEKMELQEMQLK.4|AMKDEEKMELQEMQLK.3|KLVILEGELERS...

SEN / CTL

Q9C005

Protein dpy-30 homolog

DPY30

-0.75

2.58

0.0928

0.0336

chromatin silencing at telomere,transcription, DNA...

protein binding,histone-lysine N-methyltransferase...

chromosome, telomeric region,nucleus,nucleoplasm,G...

6

4

6

ERPPNPIEFLASYLLK.3|ERPPNPIEFLASYLLK.4|ERPPNPIEFLAS...

SEN / CTL

P16035

Metalloproteinase inhibitor 2

TIMP2

-0.76

0.26

6.22e-12

2.75e-11

central nervous system development,aging,negative ...

protease binding,integrin binding,metalloendopepti...

extracellular region,proteinaceous extracellular m...

21

8

11

AVSEKEVDSGNDIYGNPIKR.4|AVSEKEVDSGNDIYGNPIKR.3|GAAP...

SEN / CTL

P62906

60S ribosomal protein L10a

RPL10A

-0.77

0.32

1.64e-10

5.93e-10

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion...

21

19

35

KYDAFLASESLIK.3|KYDAFLASESLIK.2|FSVC[CAM]VLGDQQHC[...

SEN / CTL

Q01469

Fatty acid-binding protein, epidermal

FABP5

-0.77

0.91

0.00134

0.000975

glucose metabolic process,lipid metabolic process,...

transporter activity,fatty acid binding,protein bi...

nucleoplasm,cytoplasm,cytosol,extracellular exosom...

24

17

34

ELGVGIALR.2|TTQFSC[CAM]TLGEKFEETTADGRK.4|TTQFSC[CA...

SEN / CTL

P04156

Major prion protein

PRNP

-0.77

0.3

0.039

0.0162

negative regulation of protein phosphorylation,cel...

copper ion binding,lamin binding,microtubule bindi...

nucleus,cytoplasm,endoplasmic reticulum,Golgi appa...

3

4

5

VVEQMC[CAM]ITQYER.2|VVEQM[Oxi]C[CAM]ITQYER.2|PIIHF...

SEN / CTL

Q92688

Acidic leucine-rich nuclear phosphoprotein 32 family member B

ANP32B

-0.78

0.37

2.89e-7

5.5e-7

vasculature development,nucleosome assembly,activa...

protein binding,histone binding,RNA polymerase bin...

nucleus,cytoplasm,extracellular exosome,nucleolus

15

10

17

SLDLFNC[CAM]EVTNLNDYRESVFK.3|IFGGLDM[Oxi]LAEKLPNLT...

SEN / CTL

P20700

Lamin-B1

LMNB1

-0.78

0.78

0.00226

0.00154

structural molecule activity,phospholipase binding

nuclear envelope,nuclear inner membrane,lamin fila...

30

59

97

LQIELGK.2|SLEGDLEDLKDQIAQLEASLAAAK.4|SLEGDLEDLKDQI...

SEN / CTL

P33908

Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA

MAN1A1

-0.78

0.85

0.058

0.0228

N-glycan processing,Golgi apparatus mannose trimmi...

mannosyl-oligosaccharide 1,2-alpha-mannosidase act...

Golgi membrane,cytoplasm,endoplasmic reticulum,end...

6

12

15

FDGGVEAIATR.2|WAWEAVEALENHC[CAM]R.3|HEFEEAK.2|MYFD...

SEN / CTL

Q93088

Betaine--homocysteine S-methyltransferase 1

BHMT

-0.79

0.57

0.0154

0.00758

sulfur amino acid metabolic process,protein methyl...

zinc ion binding,S-adenosylmethionine-homocysteine...

cytoplasm,cytosol,extracellular exosome

6

35

57

ISGQEVNEAAC[CAM]DIAR.2|ISGQEVNEAAC[CAM]DIAR.3|AGPW...

SEN / CTL

P13693

Translationally-controlled tumor protein

TPT1

-0.8

0.56

0.00000815

0.0000107

calcium ion transport,cellular calcium ion homeost...

calcium ion binding,protein binding,microtubule bi...

extracellular space,nucleus,cytoplasm,multivesicul...

18

14

26

VKPFMTGAAEQIKHILANFK.4|IREIADGLC[CAM]LEVEGK.3|IREI...

SEN / CTL

P05155

Plasma protease C1 inhibitor

SERPING1

-0.81

0.69

5.39e-8

1.17e-7

negative regulation of complement activation, lect...

serine-type endopeptidase inhibitor activity,prote...

extracellular region,extracellular space,platelet ...

51

19

34

FQPTLLTLPR.2|LVLLNAIYLSAK.2|LLDSLPSDTR.2|TNLESILSY...

SEN / CTL

Q16610

Extracellular matrix protein 1

ECM1

-0.82

0.51

1.73e-8

4.29e-8

ossification,angiogenesis,positive regulation of e...

protease binding,signal transducer activity,interl...

extracellular region,proteinaceous extracellular m...

24

22

28

ELLALIQLER.2|LVWEEAMSR.2|FC[CAM]EAEFSVK.2|RAPYPNYD...

SEN / CTL

P39687

Acidic leucine-rich nuclear phosphoprotein 32 family member A

ANP32A

-0.82

0.92

0.0000266

0.0000304

transcription, DNA-templated,regulation of transcr...

histone binding,poly(A) RNA binding

nucleus,nucleoplasm,cytoplasm,endoplasmic reticulu...

27

19

33

SNEGKLEGLTDEFEELEFLSTINVGLTSIANLPK.4|VSGGLEVLAEK.2...

SEN / CTL

Q92859

Neogenin

NEO1

-0.82

0.29

0.0368

0.0154

cell adhesion,axon guidance,positive regulation of...

receptor activity,protein binding,co-receptor bind...

nucleoplasm,Golgi apparatus,plasma membrane,integr...

3

6

6

QLLPDGSLFISNVVHSK.3|SHLYHPGSPWPIGTSMSLSDR.4|EHNLQV...

SEN / CTL

Q15904

V-type proton ATPase subunit S1

ATP6AP1

-0.83

0.16

0.0000492

0.0000526

insulin receptor signaling pathway,ATP hydrolysis ...

transporter activity,ATP binding,Rab GTPase bindin...

endosome membrane,integral component of membrane,p...

6

9

11

LGASPLHVDLATLR.3|LGASPLHVDLATLR.2|EVLTGNDEVIGQVLST...

SEN / CTL

P12004

Proliferating cell nuclear antigen

PCNA

-0.83

0.72

0.00129

0.000946

G1/S transition of mitotic cell cycle,regulation o...

purine-specific mismatch base pair DNA N-glycosyla...

nuclear chromosome, telomeric region,nucleus,nucle...

18

21

41

DLSHIGDAVVISC[CAM]AK.3|DLSHIGDAVVISC[CAM]AK.2|YLNF...

SEN / CTL

Q07955

Serine/arginine-rich splicing factor 1

SRSF1

-0.84

0.48

0.0000431

0.0000463

alternative mRNA splicing, via spliceosome,mRNA 5'...

nucleotide binding,RNA binding,mRNA binding,protei...

nucleus,nucleoplasm,cytoplasm,nuclear speck,extrac...

15

24

32

EAGDVC[CAM]YADVYR.2|EAGDVC[CAM]YADVYRDGTGVVEFVR.3|...

SEN / CTL

P07225

Vitamin K-dependent protein S

PROS1

-0.84

0.48

0.0021

0.00144

platelet degranulation,signal peptide processing,E...

endopeptidase inhibitor activity,calcium ion bindi...

Golgi membrane,extracellular region,extracellular ...

9

20

26

SFQTGLFTAAR.2|VYFAGFPR.2|NNLELSTPLKIETISHEDLQR.4|N...

SEN / CTL

P24844

Myosin regulatory light polypeptide 9

MYL9

-0.84

0.42

0.00399

0.00247

muscle contraction,regulation of muscle contractio...

calcium ion binding,structural constituent of musc...

stress fiber,cytosol,muscle myosin complex,Z disc

6

6

10

GNFNYVEFTR.2|NAFAC[CAM]FDEEASGFIHEDHLR.4|NAFAC[CAM...

SEN / CTL

Q86SF2

N-acetylgalactosaminyltransferase 7

GALNT7

-0.85

0.67

0.00073

0.000579

carbohydrate metabolic process,protein O-linked gl...

polypeptide N-acetylgalactosaminyltransferase acti...

Golgi membrane,membrane,integral component of memb...

15

23

30

GFETAYC[CAM]IDSMGK.2|C[CAM]LDRSEVLHQVFISNC[CAM]DSS...

SEN / CTL

P35555

Fibrillin-1

FBN1

-0.86

0.68

5.7e-19

5.5e-18

skeletal system development,metanephros developmen...

integrin binding,hormone activity,extracellular ma...

microfibril,extracellular region,proteinaceous ext...

66

32

32

ILELLPALTTLTNHNR.3|TLPGGNQC[CAM]IVPIC[CAM]R.2|TC[C...

SEN / CTL

P16949

Stathmin

STMN1

-0.87

0.4

9.85e-10

2.98e-9

mitotic cytokinesis,microtubule depolymerization,m...

signal transducer activity,tubulin binding

intracellular,cytoplasm,cytosol,microtubule,membra...

21

18

24

ASGQAFELILSPR.2|ASGQAFELILSPR.3|SKESVPEFPLSPPK.3|S...

SEN / CTL

Q8TEA8

D-tyrosyl-tRNA(Tyr) deacylase 1

DTD1

-0.87

0.3

0.0317

0.0138

DNA replication,tRNA metabolic process,regulation ...

aminoacyl-tRNA editing activity,DNA binding,metal ...

nucleus,cytoplasm

3

6

8

ASVTVGGEQISAIGR.2|SASSGAEGDVSSEREP.3|SASSGAEGDVSSE...

SEN / CTL

Q9H910

Hematological and neurological expressed 1-like protein

HN1L

-0.88

0.42

5.63e-9

1.54e-8

nucleus,cytoplasm,plasma membrane

21

11

17

TSDIFGSPVTATSR.2|GSGIFDESTPVQTR.2|AMKPPGGESSNLFGSP...

SEN / CTL

P23142

Fibulin-1

FBLN1

-0.88

0.44

0.000581

0.000474

negative regulation of protein phosphorylation,neg...

fibronectin binding,extracellular matrix structura...

extracellular region,proteinaceous extracellular m...

9

25

36

RGYQLSDVDGVTC[CAM]EDIDEC[CAM]ALPTGGHIC[CAM]SYR.4|Y...

SEN / CTL

P84090

Enhancer of rudimentary homolog

ERH

-0.88

0.54

0.00627

0.00365

nucleobase-containing compound metabolic process,p...

protein binding,methyl-CpG binding,poly(A) RNA bin...

midbody,methylosome

6

5

10

TYADYESVNEC[CAM]MEGVC[CAM]K.2|TYADYESVNEC[CAM]MEGV...

SEN / CTL

P17858

ATP-dependent 6-phosphofructokinase, liver type

PFKL

-0.88

1.2

0.0179

0.00859

fructose 6-phosphate metabolic process,glycolytic ...

6-phosphofructokinase activity,protein binding,ATP...

cytosol,6-phosphofructokinase complex,membrane,ext...

30

42

74

GQLESIVENIR.2|TFVLEVMGR.2|TFVLEVM[Oxi]GR.2|AIGVLTS...

SEN / CTL

Q9UBR2

Cathepsin Z

CTSZ

-0.88

1.57

0.0207

0.00966

angiotensin maturation,proteolysis,ER to Golgi ves...

cysteine-type endopeptidase activity,protein bindi...

Golgi membrane,extracellular space,lysosome,endopl...

15

16

25

NVDGVNYASITR.2|NVDGVNYASITR.3|NQHIPQYC[CAM]GSC[CAM...

SEN / CTL

P29279

Connective tissue growth factor

CTGF

-0.89

0.54

0.00528

0.00314

cartilage condensation,ossification,angiogenesis,r...

fibronectin binding,integrin binding,protein bindi...

extracellular region,proteinaceous extracellular m...

9

8

8

DGAPC[CAM]IFGGTVYR.2|C[CAM]PAGVSLVLDGC[CAM]GC[CAM]...

SEN / CTL

Q13308

Inactive tyrosine-protein kinase 7

PTK7

-0.9

0.38

3.97e-10

1.29e-9

establishment of planar polarity,ventricular septu...

protein kinase activity,protein binding,ATP bindin...

integral component of plasma membrane,cell-cell ju...

24

30

35

VVLAPQDVVVAR.2|ADGSSLPEWVTDNAGTLHFAR.3|INSVEVYDGTW...

SEN / CTL

Q96PU4

E3 ubiquitin-protein ligase UHRF2

UHRF2

-0.9

0.22

0.0202

0.00952

cell cycle,cell proliferation,maintenance of DNA m...

DNA binding,ubiquitin-protein transferase activity...

nucleus,nucleoplasm,nuclear heterochromatin

3

14

15

IISVDEIFK.2|RPISDDDC[CAM]PSASK.3|IERPGAHPLSFADGK.3...

SEN / CTL

Q16270

Insulin-like growth factor-binding protein 7

IGFBP7

-0.91

0.98

4.86e-10

1.56e-9

regulation of cell growth,cell adhesion,embryo imp...

protein binding,insulin-like growth factor binding

extracellular region,extracellular space,extracell...

36

12

15

TELLPGDRDNLAIQTR.3|TELLPGDRDNLAIQTR.2|SRYPVC[CAM]G...

SEN / CTL

P78324

Q5TFQ8

Tyrosine-protein phosphatase non-receptor type substrate 1;Signal-regulatory protein beta-1 isoform 3

SIRPA

SIRPB1

-0.91

0.29

0.0314

0.0137

cell adhesion,leukocyte migration;

SH3 domain binding;

plasma membrane,membrane,integral component of mem...

3

1

2

ATPQHTVSFTC[CAM]ESHGFSPR.4|ATPQHTVSFTC[CAM]ESHGFSP...

SEN / CTL

O75882

Attractin

ATRN

-0.92

0.09

0.00292

0.0019

inflammatory response,response to oxidative stress...

receptor activity,carbohydrate binding

extracellular space,cytoplasm,plasma membrane,inte...

3

29

41

LTLTPWVGLR.2|EQYAVVGHSAHIVTLK.4|EQYAVVGHSAHIVTLK.3...

SEN / CTL

O00241

Signal-regulatory protein beta-1

SIRPB1

-0.92

0.27

0.0286

0.0127

signal transduction,cell surface receptor signalin...

plasma membrane,integral component of plasma membr...

3

2

2

ATPEHTVSFTC[CAM]ESHGFSPR.4|SVSVAAGESATLR.2

SEN / CTL

O00468

Agrin

AGRN

-0.93

0.81

1.72e-26

3.1e-25

retinoid metabolic process,glycosaminoglycan biosy...

dystroglycan binding,structural constituent of cyt...

extracellular region,basal lamina,cytoplasm,Golgi ...

159

54

64

SFLAFPTLR.2|KFDGPC[CAM]DPC[CAM]QGALPDPSR.3|KFDGPC[...

SEN / CTL

P61916

Epididymal secretory protein E1

NPC2

-0.94

0.48

7.02e-8

1.45e-7

cholesterol metabolic process,response to virus,ph...

protein binding,cholesterol binding,enzyme binding

lysosome,endoplasmic reticulum,extracellular exoso...

21

12

19

AVVHGILMGVPVPFPIPEPDGC[CAM]K.3|AVVHGILMGVPVPFPIPEP...

SEN / CTL

Q8WUT4

Leucine-rich repeat neuronal protein 4

LRRN4

-0.94

0.25

0.0209

0.00975

long-term memory,visual learning

integral component of plasma membrane,extracellula...

3

2

2

ALSTSELGHLEQLQVLTLR.3|HLQTPC[CAM]AELQR.2

SEN / CTL

P05156

Complement factor I

CFI

-0.96

0.79

0.00000132

0.00000216

proteolysis,receptor-mediated endocytosis,compleme...

serine-type endopeptidase activity,scavenger recep...

extracellular region,extracellular space,membrane,...

18

26

36

VFSLQWGEVK.2|GLETSLAEC[CAM]TFTK.2|IVIEYVDR.2|AC[CA...

SEN / CTL

P00751

Complement factor B

CFB

-0.96

0.49

0.0121

0.00624

proteolysis,complement activation,complement activ...

complement binding,serine-type endopeptidase activ...

extracellular region,extracellular space,plasma me...

6

51

78

DFHINLFQVLPWLK.3|DFHINLFQVLPWLK.4|DFHINLFQVLPWLK.2...

SEN / CTL

Q13185

Chromobox protein homolog 3

CBX3

-0.97

0.32

8.82e-9

2.31e-8

chromatin remodeling,transcription, DNA-templated,...

protein binding,enzyme binding,protein domain spec...

chromosome, centromeric region,condensed chromosom...

15

13

22

C[CAM]PQIVIAFYEER.2|C[CAM]PQIVIAFYEER.3|WKDSDEADLV...

SEN / CTL

Q13867

Bleomycin hydrolase

BLMH

-0.97

0.18

0.00945

0.00509

protein polyubiquitination,proteolysis,response to...

aminopeptidase activity,carboxypeptidase activity,...

nucleus,cytoplasm,cytosol,extracellular exosome

3

32

47

IGPITPLEFYR.2|IGPITPLEFYR.3|AQHVFQHAVPQEGKPITNQK.5...

SEN / CTL

Q6EMK4

Vasorin

VASN

-0.98

0.31

9.34e-8

1.88e-7

negative regulation of epithelial to mesenchymal t...

transforming growth factor beta binding,cadherin b...

extracellular space,mitochondrion,lysosomal membra...

12

8

8

SLTLGIEPVSPTSLR.2|NPFNC[CAM]VC[CAM]PLSWFGPWVR.3|LL...

SEN / CTL

O00193

Small acidic protein

SMAP

-0.98

0.57

0.00569

0.00336

biological_process

molecular_function

cellular_component

6

6

12

SASPDDDLGSSNWEAADLGNEER.3|TGEEDKKINEELESQYQQSMDSK....

SEN / CTL

O14672

Disintegrin and metalloproteinase domain-containing protein 10

ADAM10

-1

0.88

0.000983

0.000752

in utero embryonic development,protein phosphoryla...

endopeptidase activity,metalloendopeptidase activi...

nucleus,cytoplasm,Golgi apparatus,Golgi-associated...

21

21

28

EAVIAQISSHVK.3|EAVIAQISSHVK.2|AIDTIYQTTDFSGIR.2|AI...

SEN / CTL

P0C0S8

P20671

Q96KK5

Q99878

Q9BTM1

Histone H2A type 1;Histone H2A type 1-D;Histone H2A type 1-H;Histone H2A type 1-J;Histone H2A.J

HIST1H2AG

HIST1H2AD

HIST1H2AH

HIST1H2AJ

H2AFJ

-1

1.08

0.0364

0.0153

chromatin silencing,biological_process;chromatin s...

DNA binding,protein binding,enzyme binding,protein...

nucleosome,nuclear chromatin,nucleus,extracellular...

6

1

3

HLQLAIRNDEELNKLLGK.4|HLQLAIRNDEELNKLLGK.3|HLQLAIRN...

SEN / CTL

P07996

Thrombospondin-1

THBS1

-1.01

0.97

2.94e-21

3.78e-20

activation of MAPK activity,response to hypoxia,ne...

phosphatidylserine binding,glycoprotein binding,fi...

extracellular region,fibrinogen complex,extracellu...

129

63

89

FVFGTTPEDILR.2|TIVTTLQDSIR.2|GFLLLASLR.2|SITLFVQED...

SEN / CTL

Q10471

Polypeptide N-acetylgalactosaminyltransferase 2

GALNT2

-1.02

0.81

1.35e-7

2.65e-7

immunoglobulin biosynthetic process,protein O-link...

polypeptide N-acetylgalactosaminyltransferase acti...

Golgi membrane,endoplasmic reticulum membrane,Golg...

27

28

40

VWQC[CAM]GGSLEIIPC[CAM]SR.2|VLTFLDSHC[CAM]EC[CAM]N...

SEN / CTL

Q9H773

dCTP pyrophosphatase 1

DCTPP1

-1.03

0.6

0.0875

0.0322

nucleoside triphosphate catabolic process,protein ...

magnesium ion binding,pyrimidine deoxyribonucleoti...

cytosol

3

12

18

C[CAM]RVDLPLAVLSK.3|C[CAM]RVDLPLAVLSK.2|RLHAEFAAER...

SEN / CTL

Q02388

Collagen alpha-1(VII) chain

COL7A1

-1.06

0.78

4.01e-12

1.84e-11

ER to Golgi vesicle-mediated transport,cell adhesi...

serine-type endopeptidase inhibitor activity,prote...

Golgi membrane,extracellular region,collagen type ...

33

34

44

QHVPGVMVLLVDEPLRGDIFSPIR.4|SFLEGLVLPFSGAASAQGVR.3|...

SEN / CTL

P29323

Ephrin type-B receptor 2

EPHB2

-1.06

0.73

0.00000665

0.00000898

angiogenesis,urogenital system development,nervous...

protein tyrosine kinase activity,transmembrane-eph...

extracellular region,cytosol,plasma membrane,integ...

21

21

25

AGAIYVFQVR.2|VDTIAADESFSQVDLGGR.2|WTAPEAIQYR.2|AMA...

SEN / CTL

P12109

Collagen alpha-1(VI) chain

COL6A1

-1.08

0.87

6.2e-10

1.97e-9

osteoblast differentiation,cell adhesion,extracell...

platelet-derived growth factor binding

extracellular region,collagen type VI trimer,lysos...

48

49

69

VFSVAITPDHLEPR.3|VFSVAITPDHLEPR.2|LLLFSDGNSQGATPAA...

SEN / CTL

P09871

Complement C1s subcomponent

C1S

-1.08

0.97

0.0000247

0.0000284

proteolysis,complement activation,complement activ...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular exosome,blood m...

15

26

38

TNFDNDIALVR.2|MLTPEHVFIHPGWK.4|M[Oxi]LTPEHVFIHPGWK...

SEN / CTL

P19320

Vascular cell adhesion protein 1

VCAM1

-1.09

0.79

0.00000591

0.0000081

response to hypoxia,acute inflammatory response,ch...

integrin binding,primary amine oxidase activity,ce...

podosome,extracellular space,early endosome,endopl...

18

11

11

QSTQTLYVNVAPR.2|MEDSGVYLC[CAM]EGINQAGR.2|SLEVTFTPV...

SEN / CTL

P35442

Thrombospondin-2

THBS2

-1.11

0.59

0.0000131

0.0000162

cell adhesion,negative regulation of angiogenesis,...

calcium ion binding,heparin binding

extracellular region,basement membrane,platelet al...

15

8

9

GTLLALEGPGLSQR.2|SC[CAM]DVTSNTC[CAM]LGPSIQTR.2|GLL...

SEN / CTL

P14324

Farnesyl pyrophosphate synthase

FDPS

-1.11

0.78

0.0000651

0.0000684

cholesterol biosynthetic process,viral process,ger...

dimethylallyltranstransferase activity,geranyltran...

nucleoplasm,cytoplasm,cytosol

15

17

27

GLTVVVAFR.2|LKEVLEYNAIGGK.3|LKEVLEYNAIGGK.2|C[CAM]...

SEN / CTL

P55285

Cadherin-6

CDH6

-1.12

0.4

0.0000118

0.0000148

cell adhesion,homophilic cell adhesion via plasma ...

calcium ion binding

plasma membrane,integral component of membrane,ext...

9

12

12

IVVEDVDEPPVFSK.2|LAYILQIR.2|FLYLGPFKDSATVR.3|LHSDQ...

SEN / CTL

P15151

Poliovirus receptor

PVR

-1.12

0.39

0.0000405

0.0000439

positive regulation of natural killer cell mediate...

virus receptor activity,receptor activity,receptor...

extracellular space,cytoplasm,plasma membrane,inte...

9

5

6

VQLTGEPVPMAR.2|HGESGSMAVFHQTQGPSYSESK.4|HGESGSMAVF...

SEN / CTL

Q01105

Protein SET

SET

-1.12

1.12

0.0000737

0.0000757

DNA replication,nucleosome assembly,nucleosome dis...

DNA binding,protein phosphatase inhibitor activity...

nucleus,nucleoplasm,cytoplasm,endoplasmic reticulu...

24

18

30

VEVTEFEDIK.2|VEVTEFEDIKSGYR.3|IPNFWVTTFVNHPQVSALLG...

SEN / CTL

Q08380

Galectin-3-binding protein

LGALS3BP

-1.14

0.72

1.31e-18

1.18e-17

platelet degranulation,receptor-mediated endocytos...

scavenger receptor activity

extracellular region,proteinaceous extracellular m...

72

23

30

SDLAVPSELALLK.2|ELSEALGQIFDSQR.2|ELSEALGQIFDSQR.3|...

SEN / CTL

P08294

Extracellular superoxide dismutase [Cu-Zn]

SOD3

-1.14

1.47

0.0000979

0.0000979

response to reactive oxygen species,response to hy...

superoxide dismutase activity,copper ion binding,p...

extracellular region,extracellular space,nucleus,c...

33

10

14

VTGVVLFR.2|AVVVHAGEDDLGRGGNQASVENGNAGR.4|DDDGALHAA...

SEN / CTL

O95881

Thioredoxin domain-containing protein 12

TXNDC12

-1.15

0.65

0.00379

0.0024

cell differentiation,cell redox homeostasis,oxidat...

peptide disulfide oxidoreductase activity,protein-...

endoplasmic reticulum lumen

9

10

16

ILFLDPSGK.2|EAAASGLPLMVIIHK.3|EAAASGLPLM[Oxi]VIIHK...

SEN / CTL

O94973

AP-2 complex subunit alpha-2

AP2A2

-1.15

1.06

0.135

0.0449

intracellular protein transport,microtubule-based ...

molecular_function,lipid binding,protein transport...

cytosol,plasma membrane,cytoplasmic, membrane-boun...

18

41

64

GLAVFISDIR.2|TSVSLAVSR.2|NAVLFEAISLIIHHDSEPNLLVR.4...

SEN / CTL

Q9GZX9

Twisted gastrulation protein homolog 1

TWSG1

-1.16

0.4

0.00175

0.00123

ossification,mesoderm formation,salivary gland mor...

extracellular space,extracellular exosome

6

4

6

STVEELHEPIPSLFR.3|STVEELHEPIPSLFR.2|WFHNAC[CAM]C[C...

SEN / CTL

P10412

P16402

P16403

P22492

Q02539

Histone H1.4;Histone H1.3;Histone H1.2;Histone H1t;Histone H1.1

HIST1H1E

HIST1H1D

HIST1H1C

HIST1H1T

HIST1H1A

-1.16

1.07

0.0639

0.0246

negative regulation of transcription from RNA poly...

protein binding,chromatin DNA binding,poly(A) RNA ...

nucleosome,nucleus,nuclear heterochromatin,extrace...

6

2

3

ALAAAGYDVEK.2|ALAAAGYDVEKNNSR.3|ALAAAGYDVEKNNSR.2

SEN / CTL

P62979

Ubiquitin-40S ribosomal protein S27a

RPS27A

-1.18

0.86

4.94e-7

8.78e-7

G2/M transition of mitotic cell cycle,negative reg...

structural constituent of ribosome,protein binding...

extracellular space,nucleus,nucleoplasm,nucleolus,...

27

9

19

TITLEVEPSDTIENVK.2|TITLEVEPSDTIENVK.3|ESTLHLVLR.2|...

SEN / CTL

P12259

Coagulation factor V

F5

-1.2

0.28

0.0156

0.00765

platelet degranulation,proteolysis,ER to Golgi ves...

serine-type endopeptidase activity,copper ion bind...

Golgi membrane,extracellular region,extracellular ...

3

40

46

AEVDDVIQVR.2|FC[CAM]ENPDEVKR.3|SQHLDNFSNQIGK.3|SQH...

SEN / CTL

Q9UEE9

Craniofacial development protein 1

CFDP1

-1.21

0.54

0.0806

0.03

cell adhesion,multicellular organism development,b...

molecular_function

condensed chromosome kinetochore,cellular_componen...

3

9

11

VFDFAGEEVR.2|SSGMSSLLGK.2|EKPQANVPSALPSLPAGSGLKR.4...

SEN / CTL

Q14118

Dystroglycan

DAG1

-1.22

0.22

0.0000296

0.0000332

morphogenesis of an epithelial sheet,protein O-lin...

virus receptor activity,dystroglycan binding,actin...

extracellular region,basement membrane,extracellul...

6

17

21

VTIPTDLIASSGDIIK.2|LGC[CAM]SLNQNSVPDIHGVEAPAR.3|GG...

SEN / CTL

P36955

Pigment epithelium-derived factor

SERPINF1

-1.25

0.94

0.000385

0.000331

kidney development,multicellular organism developm...

serine-type endopeptidase inhibitor activity,prote...

extracellular region,basement membrane,extracellul...

12

20

26

SSTSPTTNVLLSPLSVATALSALSLGAEQR.3|DTDTGALLFIGK.2|LA...

SEN / CTL

O75937

DnaJ homolog subfamily C member 8

DNAJC8

-1.25

0.97

0.00385

0.00242

mRNA splicing, via spliceosome

nucleoplasm,cytoplasm,intercellular bridge

9

21

31

LFAELEIK.2|EGKPTIVEEDDPELFK.3|EGKPTIVEEDDPELFK.2|L...

SEN / CTL

Q08629

Testican-1

SPOCK1

-1.28

0.07

0.000902

0.000701

regulation of cell growth,neuron migration,cell ad...

serine-type endopeptidase inhibitor activity,cyste...

proteinaceous extracellular matrix,extracellular s...

3

2

2

SLLGAFIPR.2|ATQC[CAM]HGSTGQC[CAM]WC[CAM]VDK.3

SEN / CTL

Q8NBJ4

Golgi membrane protein 1

GOLM1

-1.3

0.54

0.00661

0.00383

nucleus organization,regulation of lipid metabolic...

protein binding

extracellular space,Golgi apparatus,integral compo...

6

21

27

DTINLLDQR.2|KFSYDLSQC[CAM]INQMK.3|KNEFQGELEK.3|KNE...

SEN / CTL

P14543

Nidogen-1

NID1

-1.33

0.91

2.03e-8

4.84e-8

cell-matrix adhesion,positive regulation of cell-s...

calcium ion binding,collagen binding,laminin bindi...

extracellular region,basement membrane,basal lamin...

27

39

51

VLFETDLVNPR.2|VYYREDLSPSITQR.3|TQFTC[CAM]EC[CAM]SI...

SEN / CTL

Q15262

Receptor-type tyrosine-protein phosphatase kappa

PTPRK

-1.35

0.24

3.35e-10

1.12e-9

protein dephosphorylation,cell adhesion,signal tra...

protein tyrosine phosphatase activity,transmembran...

photoreceptor outer segment,integral component of ...

12

12

13

VLLTRPGEGGTGLPGPPLITR.3|GLNPGTLNILVR.2|GSGVSNFAQLI...

SEN / CTL

P08572

Collagen alpha-2(IV) chain

COL4A2

-1.36

0.94

4.26e-12

1.92e-11

angiogenesis,transcription, DNA-templated,negative...

extracellular matrix structural constituent

extracellular region,collagen type IV trimer,endop...

39

15

19

SVSIGYLLVK.2|FSTMPFLYC[CAM]NPGDVC[CAM]YYASR.3|C[CA...

SEN / CTL

Q01995

Transgelin

TAGLN

-1.36

0.93

7.03e-9

1.88e-8

muscle organ development,epithelial cell different...

actin binding

cytoplasm

30

24

41

LGFQVWLK.2|EFTESQLQEGKHVIGLQMGSNR.4|QMEQVAQFLK.2|Q...

SEN / CTL

P51884

Lumican

LUM

-1.38

0.79

3.39e-8

7.56e-8

visual perception,response to organic cyclic compo...

extracellular matrix structural constituent,collag...

extracellular region,proteinaceous extracellular m...

18

21

29

FNALQYLR.2|SLEYLDLSFNQIAR.3|SLEYLDLSFNQIAR.2|LPSGL...

SEN / CTL

P13611

Versican core protein

VCAN

-1.39

0.98

9.82e-17

7.58e-16

skeletal system development,osteoblast differentia...

extracellular matrix structural constituent,calciu...

extracellular region,proteinaceous extracellular m...

60

17

23

LATVGELQAAWR.2|YTLNFEAAQK.2|VSVPTHPEAVGDASLTVVK.3|...

SEN / CTL

P10321

HLA class I histocompatibility antigen, Cw-7 alpha chain

HLA-C

-1.39

0.37

1.16e-11

4.73e-11

18

9

11

SWTAADTAAQITQR.2|SWTAADTAAQITQR.3|FISVGYVDDTQFVR.2...

SEN / CTL

P45973

Chromobox protein homolog 5

CBX5

-1.39

0.25

0.00902

0.00492

blood coagulation,viral process,negative regulatio...

chromatin binding,protein binding,protein binding,...

histone deacetylase complex,kinetochore,nuclear ch...

3

14

21

WKDTDEADLVLAK.3|WKDTDEADLVLAK.2|GQVEYLLK.2|WKGFSEE...

SEN / CTL

P49321

Nuclear autoantigenic sperm protein

NASP

-1.42

0.56

0.00000332

0.00000487

blastocyst development,DNA replication,DNA replica...

Hsp90 protein binding

nuclear chromatin,nucleus,nucleoplasm,cytoplasm,pr...

12

59

92

KPTDGASSSNC[CAM]VTDISHLVR.4|KPTDGASSSNC[CAM]VTDISH...

SEN / CTL

Q9Y4K0

Lysyl oxidase homolog 2

LOXL2

-1.47

1.43

5.99e-7

0.00000105

response to hypoxia,epithelial to mesenchymal tran...

chromatin binding,transcription corepressor activi...

basement membrane,extracellular space,nucleus,nucl...

42

16

19

VVC[CAM]GMFGFPGER.2|LGQGIGPIHLNEIQC[CAM]TGNEK.3|NG...

SEN / CTL

P02774

Vitamin D-binding protein

GC

-1.48

1.58

0.132

0.0444

vitamin D metabolic process,vitamin transport

actin binding,vitamin D binding,vitamin transporte...

extracellular region,extracellular space,cytosol,l...

15

46

77

HQPQEFPTYVEPTNDEIC[CAM]EAFRKDPK.5|HQPQEFPTYVEPTNDE...

SEN / CTL

P02452

Collagen alpha-1(I) chain

COL1A1

-1.53

0.58

2.94e-14

1.59e-13

skeletal system development,blood vessel developme...

extracellular matrix structural constituent,protei...

extracellular region,collagen type I trimer,extrac...

33

46

54

SLSQQIENIRSPEGSR.3|DRDLEVDTTLK.3|DRDLEVDTTLK.2|VLC...

SEN / CTL

P02462

Collagen alpha-1(IV) chain

COL4A1

-1.55

1.61

0.00144

0.00104

patterning of blood vessels,brain development,neur...

extracellular matrix structural constituent,extrac...

extracellular region,collagen type IV trimer,basem...

15

7

11

GTC[CAM]NYYANAYSFWLATIER.3|FSTMPFLFC[CAM]NINNVC[CA...

SEN / CTL

Q9UNN8

Endothelial protein C receptor

PROCR

-1.57

0.36

1.65e-10

5.93e-10

blood coagulation,negative regulation of coagulati...

receptor activity

extracellular region,centrosome,plasma membrane,in...

15

5

7

TLAFPLTIR.2|LHMLQISYFR.3|EFLEDTC[CAM]VQYVQK.2|TQSG...

SEN / CTL

P61457

Pterin-4-alpha-carbinolamine dehydratase

PCBD1

-1.58

0.32

0.0136

0.00681

transcription, DNA-templated,L-phenylalanine catab...

transcription coactivator activity,phenylalanine 4...

nucleoplasm,cytoplasm,cytosol,extracellular exosom...

3

10

15

LSAEERDQLLPNLR.3|AFGFMTR.2|LDHHPEWFNVYNK.4|LDHHPEW...

SEN / CTL

P02751

Fibronectin

FN1

-1.66

1.04

1.96e-140

5.29e-138

angiogenesis,regulation of protein phosphorylation...

protease binding,integrin binding,protein binding,...

extracellular region,fibrinogen complex,basal lami...

474

126

209

VTWAPPPSIDLTNFLVR.2|VTWAPPPSIDLTNFLVR.3|WLPSSSPVTG...

SEN / CTL

Q9BYT8

Neurolysin, mitochondrial

NLN

-1.77

1.2

0.029

0.0128

regulation of gluconeogenesis,proteolysis,peptide ...

metalloendopeptidase activity,peptide binding,meta...

mitochondrial intermembrane space,plasma membrane

9

35

48

LVNTGLLTLR.2|LKPLGEAEREFILNLK.4|C[CAM]KEENTIILQQLL...

SEN / CTL

O00160

Unconventional myosin-If

MYO1F

-1.77

0.88

0.0653

0.025

biological_process

motor activity,actin binding,calmodulin binding,AT...

unconventional myosin complex

3

27

32

GFGDLAVLK.2|GRLHGQEGLFPGNYVEK.4|GRLHGQEGLFPGNYVEK....

SEN / CTL

Q12841

Follistatin-related protein 1

FSTL1

-1.81

0.86

3.28e-7

6.14e-7

BMP signaling pathway,response to starvation

calcium ion binding,protein binding,heparin bindin...

extracellular region,extracellular space,extracell...

15

12

12

IIQWLEAEIIPDGWFSK.3|LSFQEFLK.2|IC[CAM]ANVFC[CAM]GA...

SEN / CTL

P01033

Metalloproteinase inhibitor 1

TIMP1

-1.84

0.45

5.33e-16

3.79e-15

cell activation,platelet degranulation,aging,posit...

protease binding,cytokine activity,protein binding...

extracellular region,proteinaceous extracellular m...

27

7

11

LQDGLLHITTC[CAM]SFVAPWNSLSLAQR.3|TYTVGC[CAM]EEC[CA...

SEN / CTL

P22692

Insulin-like growth factor-binding protein 4

IGFBP4

-1.86

0.78

6.31e-8

1.33e-7

skeletal system development,regulation of cell gro...

receptor binding,insulin-like growth factor I bind...

extracellular region,extracellular space

15

3

5

EDARPVPQGSC[CAM]QSELHR.4|THEDLYIIPIPNC[CAM]DR.3|TH...

SEN / CTL

P61769

Beta-2-microglobulin

B2M

-1.9

1.53

0.000351

0.000305

retina homeostasis,positive regulation of T cell m...

glycoprotein binding,protein binding,identical pro...

Golgi membrane,extracellular region,extracellular ...

15

7

9

SNFLNC[CAM]YVSGFHPSDIEVDLLK.3|SNFLNC[CAM]YVSGFHPSD...

SEN / CTL

P05121

Plasminogen activator inhibitor 1

SERPINE1

-1.92

1.85

0.000425

0.000359

chronological cell aging,angiogenesis,platelet deg...

protease binding,serine-type endopeptidase inhibit...

extracellular region,extracellular space,plasma me...

21

9

10

MAPEEIIMDRPFLFVVR.3|HNPTGTVLFMGQVMEP.2|QFQADFTSLSD...

SEN / CTL

P01023

Alpha-2-macroglobulin

A2M

-1.92

1.55

0.0937

0.0338

negative regulation of complement activation, lect...

protease binding,serine-type endopeptidase inhibit...

extracellular region,cytosol,platelet alpha granul...

18

89

144

ATVLNYLPK.2|QTVSWAVTPK.2|MVSGFIPLKPTVK.3|M[Oxi]VSG...

SEN / CTL

P41222

Prostaglandin-H2 D-isomerase

PTGDS

-1.94

0.06

0.000274

0.000244

prostaglandin biosynthetic process,transport,cyclo...

prostaglandin-D synthase activity,transporter acti...

extracellular region,extracellular space,endoplasm...

3

2

4

TMLLQPAGSLGSYSYR.2|TM[Oxi]LLQPAGSLGSYSYR.2|AQGFTED...

SEN / CTL

P02768

Serum albumin

ALB

-2.04

1.07

1.53e-42

8.26e-41

retina homeostasis,platelet degranulation,transpor...

DNA binding,fatty acid binding,copper ion binding,...

extracellular region,extracellular space,nucleus,e...

201

107

232

KVPQVSTPTLVEVSR.3|KVPQVSTPTLVEVSR.2|KVPQVSTPTLVEVS...

SEN / CTL

Q8IUX7

Adipocyte enhancer-binding protein 1

AEBP1

-2.05

2.39

0.0245

0.0112

negative regulation of transcription from RNA poly...

RNA polymerase II regulatory region sequence-speci...

extracellular space,nucleus,cytoplasm,extracellula...

15

9

11

YLSPDATVSTEVR.2|YTAGIHGNEVLGR.3|YTAGIHGNEVLGR.2|VV...

SEN / CTL

P14780

Matrix metalloproteinase-9

MMP9

-2.07

0.79

1.41e-14

7.93e-14

skeletal system development,ossification,positive ...

endopeptidase activity,metalloendopeptidase activi...

extracellular region,proteinaceous extracellular m...

30

30

40

SLGPALLLLQK.2|AFALWSAVTPLTFTR.2|AFALWSAVTPLTFTR.3|...

SEN / CTL

P54710

Sodium/potassium-transporting ATPase subunit gamma

FXYD2

-2.07

1.16

0.0194

0.00914

regulation of cell growth,transport,establishment ...

transporter activity,ion channel activity,sodium:p...

plasma membrane,sodium:potassium-exchanging ATPase...

6

2

3

GDVDPFYYDYETVR.2|TGLSMDGGGSPK.2|TGLSM[Oxi]DGGGSPK....

SEN / CTL

P09486

SPARC

SPARC

-2.15

0.6

5.19e-23

7.78e-22

ossification,negative regulation of endothelial ce...

calcium ion binding,protein binding,collagen bindi...

extracellular region,basement membrane,extracellul...

42

14

22

YIPPC[CAM]LDSELTEFPLR.3|YIPPC[CAM]LDSELTEFPLR.2|FF...

SEN / CTL

P02787

Serotransferrin

TF

-2.26

1.19

1.14e-53

1.03e-51

retina homeostasis,platelet degranulation,cellular...

protein binding,ferrous iron binding,ferric iron b...

extracellular region,extracellular space,early end...

240

86

160

SASDLTWDNLK.2|SVIPSDGPSVAC[CAM]VK.2|LKC[CAM]DEWSVN...

SEN / CTL

P02788

Lactotransferrin

LTF

-2.5

1.1

0.00237

0.00159

ossification,regulation of cytokine production,ret...

DNA binding,serine-type endopeptidase activity,iro...

extracellular region,extracellular space,nucleus,c...

9

76

117

C[CAM]GLVPVLAENYK.2|YYGYTGAFR.2|C[CAM]LAENAGDVAFVK...

SEN / CTL

P30530

Tyrosine-protein kinase receptor UFO

AXL

-2.52

0.43

0.0135

0.00679

neuron migration,natural killer cell differentiati...

virus receptor activity,phosphatidylserine binding...

extracellular space,intracellular,plasma membrane,...

3

9

10

APLQGTLLGYR.2|HGDLHSFLLYSR.3|HGDLHSFLLYSR.2|YGEVFE...

SEN / CTL

Q99969

Retinoic acid receptor responder protein 2

RARRES2

-2.67

0.44

7.63e-8

1.56e-7

retinoid metabolic process,in utero embryonic deve...

receptor binding,protein binding

extracellular region,extracellular matrix,platelet...

9

4

5

GLQVALEEFHK.3|LVHC[CAM]PIETQVLR.3|LVHC[CAM]PIETQVL...

SEN / CTL

P20742

Pregnancy zone protein

PZP

-2.69

0.99

0.075

0.0281

female pregnancy,negative regulation of endopeptid...

endopeptidase inhibitor activity,serine-type endop...

extracellular region,extracellular exosome,blood m...

3

23

26

DLFHC[CAM]VSFTLPR.3|DLFHC[CAM]VSFTLPR.2|SGTHTLPVES...

SEN / CTL

P01009

Alpha-1-antitrypsin

SERPINA1

-2.93

1.4

1.82e-30

4.9e-29

platelet degranulation,ER to Golgi vesicle-mediate...

glycoprotein binding,protease binding,serine-type ...

Golgi membrane,extracellular region,proteinaceous ...

105

44

85

LSITGTYDLK.2|ITPNLAEFAFSLYR.2|ITPNLAEFAFSLYR.3|SVL...

Reference: SASP atlas