Post-radiation exosome SASP in human fibroblasts (day 10)

[raw]




















































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































Comparison

UniProtIds

Protein Description

Genes

Log2 Ratio

Std. Dev.

PValue

QValue

GO Biological Process

GO Molecular Process

GO Cellular Process

Ratios

Unique Peptides

Elution Groups

Elution Group

SEN / CTL

A6NCE7


Q9GZQ8


Q9H492

Microtubule-associated proteins 1A/1B light chain 3 beta 2;Microtubule-associated proteins 1A/1B light chain 3B;Microtubule-associated proteins 1A/1B light chain 3A

MAP1LC3B2


MAP1LC3B


MAP1LC3A

5.99

2.42

0.0158

0.0226

autophagosome assembly,mitophagy,cellular response…

microtubule binding;protein binding,microtubule bi…

autophagosome membrane,cytosol,microtubule,endomem…

1

1

1

_IPVIIER_.2

SEN / CTL

Q96CN9

GRIP and coiled-coil domain-containing protein 1

GCC1

5.73

1.68

0.00159

0.00448

protein targeting to Golgi

protein binding

Golgi membrane,cytoplasm,Golgi apparatus,cytosol,p…

13

11

13

_ALAVLTEK_.2|_SHFQAQLQQEMR_.3|_SHFQAQLQQEMR_.2|_TA…

SEN / CTL

Q5TAP6


Q9BVJ6

U3 small nucleolar RNA-associated protein 14 homolog C;U3 small nucleolar RNA-associated protein 14 homolog A

UTP14C


UTP14A

5.41

2.36

0.0195

0.0259

multicellular organism development,spermatogenesis…

protein binding;protein binding,poly(A) RNA bindin…

nucleolus,small-subunit processome;nucleoplasm,nuc…

1

1

1

_TPLEQEIFNLLHK_.3

SEN / CTL

O75175

CCR4-NOT transcription complex subunit 3

CNOT3

5.2

4.01

0.0442

0.0456

nuclear-transcribed mRNA catabolic process, deaden…

protein binding

cytoplasmic mRNA processing body,nucleus,cytosol,C…

19

15

19

_TWVASNEIK_.2|_APEPLSSLK_.2|_LIETQMER_.2|_EGFTFEYR…

SEN / CTL

P68400


Q8NEV1

Casein kinase II subunit alpha;Casein kinase II subunit alpha 3

CSNK2A1


CSNK2A3

4.89

1.31

0.00495

0.00958

transcription, DNA-templated,regulation of transcr…

protein serine/threonine kinase activity,protein b…

nucleus,nucleoplasm,cytosol,plasma membrane,Sin3 c…

1

1

1

_FNDILGR_.2

SEN / CTL

P42677


Q71UM5

40S ribosomal protein S27;40S ribosomal protein S27-like

RPS27


RPS27L

4.87

0.94

0.0019

0.00509

ribosomal small subunit assembly,nuclear-transcrib…

DNA binding,structural constituent of ribosome,pro…

nucleus,nucleoplasm,cytosol,ribosome,cytosolic sma…

1

1

1

_LTEGC[+57]SFR_.2

SEN / CTL

O15075

Serine/threonine-protein kinase DCLK1

DCLK1

4.87

3.35

0.0314

0.0363

neuron migration,protein phosphorylation,nervous s…

protein kinase activity,protein serine/threonine k…

intracellular,integral component of plasma membran…

60

39

60

_DASGM[+16]LYNLASAIK_.2|_DASGMLYNLASAIK_.2|_GKEHMI…

SEN / CTL

Q9BTM9

Ubiquitin-related modifier 1

URM1

4.31

2.84

0.0273

0.0327

tRNA wobble uridine modification,tRNA modification…

protein binding,sulfurtransferase activity

cytosol,extracellular exosome

4

3

4

_NLLIWIK_.2|_HRVTLPGQEEPWDIR_.4|_HRVTLPGQEEPWDIR_….

SEN / CTL

Q5T440

Putative transferase CAF17, mitochondrial

IBA57

4.13

1.31

0.00217

0.00557

heme biosynthetic process,iron-sulfur cluster asse…

transferase activity,poly(A) RNA binding

mitochondrial matrix

18

12

18

_GC[+57]YIGQELTAR_.2|_AGAAAILIRDPR_.3|_AGAAAILIR_….

SEN / CTL

O00267

Transcription elongation factor SPT5

SUPT5H

3.91

2.11

0.0144

0.0211

negative regulation of transcription from RNA poly…

chromatin binding,mRNA binding,protein binding,enz…

nucleus,nucleoplasm,DSIF complex

67

43

67

_LVENGGMFVC[+57]K_.2|_TPHYGSQTPLHDGSR_.4|_TPHYGSQT…

SEN / CTL

Q9Y520

Protein PRRC2C

PRRC2C

3.79

0.94

0.00085

0.00261

hematopoietic progenitor cell differentiation

protein C-terminus binding,poly(A) RNA binding

membrane

86

68

86

_STTPTSSPFR_.2|_HGLQSLGK_.2|_LLAQQHPPPDR_.3|_LLAQQ…

SEN / CTL

Q92797

Symplekin

SYMPK

3.75

1.45

0.00443

0.0089

mRNA polyadenylation,cell adhesion,positive regula…

protein binding

nucleoplasm,cytoplasm,cytoskeleton,plasma membrane…

66

48

66

_QFQYLHVLLDLSSHEK_.3|_RQEHDISLDRIPR_.4|_RQEHDISLDR…

SEN / CTL

P61009

Signal peptidase complex subunit 3

SPCS3

3.74

2.35

0.0236

0.0292

signal peptide processing,proteolysis

peptidase activity

endoplasmic reticulum,signal peptidase complex,end…

4

3

4

_NVEDFTGPR_.2|_NNALNQVVLWDK_.3|_NNALNQVVLWDK_.2|_Y…

SEN / CTL

Q92692

Nectin-2

PVRL2

3.73

1.9

0.0117

0.018

acrosome assembly,positive regulation of natural k…

virus receptor activity,receptor binding,protein b…

plasma membrane,integral component of plasma membr…

10

9

10

_FTLVPSGR_.2|_YHELPTLEER_.3|_ADGVTVTC[+57]K_.2|_AE…

SEN / CTL

Q6ZS30

Neurobeachin-like protein 1

NBEAL1

3.66

1.19

0.00237

0.0059

phospholipid binding

endomembrane system,extrinsic component of membran…

15

15

15

_NISNYFTFIK_.2|_LLNSDHSALPNQR_.3|_DLHSLNLSINPLAMR_…

SEN / CTL

P55212

Caspase-6

CASP6

3.65

2.04

0.0162

0.0228

proteolysis,apoptotic process,cellular component d…

cysteine-type endopeptidase activity,protein bindi…

nucleoplasm,cytoplasm,cytosol

18

14

18

_AEELLLK_.2|_FFWHLTLPER_.3|_FFWHLTLPER_.2|_IFIIQAC…

SEN / CTL

Q9NZT1

Calmodulin-like protein 5

CALML5

3.6

1.68

0.0000824

0.000342

signal transduction,epidermis development

calcium ion binding

extracellular exosome

7

6

7

_NLSEAQLR_.2|_AFSAVDTDGNGTINAQELGAALK_.3|_AFSAVDTD…

SEN / CTL

Q9HAV4

Exportin-5

XPO5

3.55

1.78

0.0112

0.0179

protein export from nucleus,gene silencing by RNA,…

tRNA binding,RNA binding,mRNA binding,nuclear expo…

nucleus,nucleoplasm,cytoplasm,cytosol,RNA nuclear …

71

48

71

_DIQQTLTQNMER_.2|_IVVEMIK_.2|_ASMTNLVK_.2|_ASM[+16…

SEN / CTL

Q92974

Rho guanine nucleotide exchange factor 2

ARHGEF2

3.53

2.45

0.0322

0.0369

establishment of mitotic spindle orientation,cell …

guanyl-nucleotide exchange factor activity,Rho gua…

podosome,cytoplasm,Golgi apparatus,spindle,cytosol…

78

49

78

_ALVELLR_.2|_VIQQSVR_.2|_LIHDGC[+57]LLWK_.3|_LIHDG…

SEN / CTL

P47929

Galectin-7

LGALS7

3.49

2.38

0.00123

0.00363

apoptotic process,heterophilic cell-cell adhesion …

carbohydrate binding

extracellular space,nucleus,cytoplasm,extracellula…

5

5

5

_SSLPEGIRPGTVLR_.3|_LDTSEVVFNSK_.2|_AVVGDAQYHHFR_….

SEN / CTL

Q05086

Ubiquitin-protein ligase E3A

UBE3A

3.46

1.75

0.0114

0.0179

ovarian follicle development,proteolysis,ubiquitin…

transcription coactivator activity,ubiquitin-prote…

proteasome complex,nucleus,cytoplasm,cytosol

37

31

37

_DHIIDDALVR_.2|_GFHMVTNESPLK_.3|_GFHMVTNESPLK_.2|_…

SEN / CTL

Q9NPH0

Lysophosphatidic acid phosphatase type 6

ACP6

3.46

1.91

0.0154

0.0222

phospholipid metabolic process,dephosphorylation,l…

acid phosphatase activity,lysophosphatidic acid ph…

cytoplasm,mitochondrion

10

9

10

_EWFVQLYYHGK_.2|_EWFVQLYYHGK_.3|_GGMFAGQLTK_.2|_QT…

SEN / CTL

Q9H7Z7

Prostaglandin E synthase 2

PTGES2

3.41

1.95

0.0175

0.024

prostaglandin biosynthetic process,cell redox home…

DNA binding,protein binding,electron carrier activ…

Golgi membrane,nucleus,mitochondrion,cytosol,integ…

40

22

40

_YWLMLNEK_.2|_YMGAAAMYLISK_.3|_YMGAAAMYLISK_.2|_YM…

SEN / CTL

P54886

Delta-1-pyrroline-5-carboxylate synthase

ALDH18A1

3.4

0.67

0.000339

0.00119

glutamate metabolic process,proline biosynthetic p…

glutamate 5-kinase activity,glutamate-5-semialdehy…

cytoplasm,mitochondrion,mitochondrial inner membra…

83

48

83

_FASYLTFSPSEVK_.2|_FASYLTFSPSEVK_.3|_LGSAVVTR_.2|_…

SEN / CTL

Q9NW64

Pre-mRNA-splicing factor RBM22

RBM22

3.35

2.03

0.0212

0.0273

protein import into nucleus, translocation,spliceo…

nucleotide binding,nucleocytoplasmic transporter a…

Prp19 complex,nucleus,nucleoplasm,cytoplasm,U2-typ…

17

14

17

_YYGINDPVADK_.2|_KTEVC[+57]QTC[+57]SK_.3|_DRYYGIND…

SEN / CTL

Q99459

Cell division cycle 5-like protein

CDC5L

3.3

1.92

0.0184

0.0248

mitotic cell cycle,mRNA splicing, via spliceosome,…

RNA polymerase II transcription factor activity, s…

Prp19 complex,nucleus,nucleoplasm,nucleolus,cytopl…

61

46

61

_IASLLHR_.2|_AAGIEIQK_.2|_LRQQDLDGELRSEK_.4|_LRQQD…

SEN / CTL

Q9Y2Q3

Glutathione S-transferase kappa 1

GSTK1

3.25

2.07

0.0246

0.03

glutathione metabolic process,epithelial cell diff…

glutathione transferase activity,glutathione perox…

intracellular,mitochondrion,mitochondrial inner me…

31

17

31

_DFLSVM[+16]LEK_.2|_DFLSVMLEK_.2|_DSGNKPPGLLPR_.3|…

SEN / CTL

Q6KB66

Keratin, type II cytoskeletal 80

KRT80

3.24

1.62

0.0112

0.0179

structural molecule activity,protein binding

keratin filament

22

21

22

_SLEEAEAYSR_.2|_APGPGFSSR_.2|_IRYEDEISKR_.3|_AQYDA…

SEN / CTL

P15170


Q8IYD1

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A;Eukaryotic peptide chain release factor GTP-binding subunit ERF3B

GSPT1


GSPT2

3.21

1.46

0.0217

0.0278

G1/S transition of mitotic cell cycle,nuclear-tran…

translation release factor activity,GTPase activit…

intracellular,cytosol,translation release factor c…

1

1

1

_DMGTVVLGK_.2

SEN / CTL

Q9ULV3

Cip1-interacting zinc finger protein

CIZ1

3.12

0.88

0.00137

0.00398

nucleic acid binding,protein binding,zinc ion bind…

nucleus

20

16

20

_LGEIQHMSQAC[+57]LLSLLPVPR_.3|_LGEIQHMSQAC[+57]LLS…

SEN / CTL

Q7Z794

Keratin, type II cytoskeletal 1b

KRT77

3.03

1.12

0.0000129

0.0000641

biological_process

molecular_function,structural molecule activity

cytoskeleton,keratin filament,extracellular exosom…

16

13

16

_YQELQITAGR_.2|_SLDLDSIIDAVR_.2|_TGSENDFVVLKK_.3|_…

SEN / CTL

P05062

Fructose-bisphosphate aldolase B

ALDOB

3.02

1.14

0.00409

0.00839

fructose metabolic process,gluconeogenesis,glycoly…

fructose-bisphosphate aldolase activity,protein bi…

microtubule organizing center,cytosol,centriolar s…

58

32

58

_GILAADESVGTMGNR_.2|_GILAADESVGTM[+16]GNR_.2|_AANK…

SEN / CTL

Q02818

Nucleobindin-1

NUCB1

3

2.69

0.000725

0.00228

response to cisplatin,regulation of protein target…

G-protein alpha-subunit binding,DNA binding,calciu…

extracellular space,nucleus,early endosome,rough e…

46

33

46

_DLELLIQTATR_.2|_LSQETEALGR_.2|_LVTLEEFLASTQRK_.3|…

SEN / CTL

Q14847

LIM and SH3 domain protein 1

LASP1

3

0.96

0.00216

0.00557

ion transport,positive regulation of signal transd…

SH3/SH2 adaptor activity,protein binding,zinc ion …

cytoplasm,cell-cell adherens junction,focal adhesi…

35

20

35

_TGDTGMLPANYVEAI_.2|_TGDTGM[+16]LPANYVEAI_.2|_AC[+…

SEN / CTL

P11498

Pyruvate carboxylase, mitochondrial

PC

2.96

1.32

0.00744

0.013

pyruvate metabolic process,gluconeogenesis,lipid m…

DNA binding,biotin carboxylase activity,pyruvate c…

cytoplasm,mitochondrion,mitochondrial matrix,cytos…

148

76

148

_LFLQGPK_.2|_SGEGMGIR_.2|_SGEGM[+16]GIR_.2|_FIGPSP…

SEN / CTL

Q6GQQ9

OTU domain-containing protein 7B

OTUD7B

2.96

2.24

0.0417

0.0439

negative regulation of transcription from RNA poly…

DNA binding,thiol-dependent ubiquitin-specific pro…

nucleus,cytoplasm

15

13

15

_NWDVNAALSDFEQLR_.2|_LLPLHFAVDPGK_.3|_HQYQEEMIQR_….

SEN / CTL

O60637

Tetraspanin-3

TSPAN3

2.93

1.72

0.0191

0.0255

cell surface receptor signaling pathway,biological…

molecular_function

integral component of plasma membrane,extracellula…

2

2

2

_AIDYVQR_.2|_SRDPAYELLITGGTYA_.2

SEN / CTL

Q6UXS9

Inactive caspase-12

CASP12

2.92

0.99

0.00277

0.00665

endoplasmic reticulum unfolded protein response,re…

cysteine-type endopeptidase activity involved in a…

endoplasmic reticulum,IPAF inflammasome complex,NL…

2

1

2

_AGADTHGRLLQGNIC[+57]NDAVTK_.3|_AGADTHGRLLQGNIC[+5…

SEN / CTL

Q9GZR2

RNA exonuclease 4

REXO4

2.91

1.03

0.00319

0.00724

regulation of transcription, DNA-templated,nucleic…

transcription factor activity, sequence-specific D…

nucleus,nucleolus

11

11

11

_ALALDC[+57]EMVGVGPK_.2|_YVKPTEPVTDYR_.3|_ALQEWLLK…

SEN / CTL

Q8N1Q1

Carbonic anhydrase 13

CA13

2.87

1.98

0.0314

0.0363

one-carbon metabolic process,bicarbonate transport

carbonate dehydratase activity,zinc ion binding

cytosol,myelin sheath,intracellular membrane-bound…

4

4

4

_ITDTLDSIK_.2|_EHNGPIHWK_.2|_SLLC[+57]TAEGEAAAFLVS…

SEN / CTL

Q9NYU2

UDP-glucose:glycoprotein glucosyltransferase 1

UGGT1

2.85

3.38

0.0353

0.0389

protein N-linked glycosylation via asparagine,endo…

UDP-glucose:glycoprotein glucosyltransferase activ…

endoplasmic reticulum,endoplasmic reticulum lumen,…

111

69

111

_VDALLSAQPK_.2|_KYHISALYVVDLK_.3|_LSDMPLK_.2|_SGYW…

SEN / CTL

Q9BY43

Charged multivesicular body protein 4a

CHMP4A

2.83

0.88

0.00197

0.0052

cell separation after cytokinesis,posttranslationa…

protein binding,lipid binding,identical protein bi…

ESCRT III complex,nucleus,cytoplasm,cytosol,cytopl…

12

11

12

_FEQQLAQTDGTLSTLEFQR_.3|_FEQQLAQTDGTLSTLEFQR_.2|_L…

SEN / CTL

P02647

Apolipoprotein A-I

APOA1

2.83

1.28

0.00784

0.0136

retinoid metabolic process,regulation of protein p…

beta-amyloid binding,protein binding,phospholipid …

extracellular region,extracellular space,nucleus,e…

68

43

68

_VQPYLDDFQK_.2|_VQPYLDDFQK_.3|_ATEHLSTLSEK_.3|_ATE…

SEN / CTL

Q9NR30

Nucleolar RNA helicase 2

DDX21

2.82

2.28

0.00353

0.0077

osteoblast differentiation,rRNA processing,transcr…

double-stranded RNA binding,ATP-dependent RNA heli…

nucleus,nucleoplasm,nucleolus,membrane

100

64

100

_AAVIGDVIR_.2|_TIIFC[+57]ETK_.2|_GVTFLFPIQAK_.3|_G…

SEN / CTL

Q8WTW3

Conserved oligomeric Golgi complex subunit 1

COG1

2.82

1.18

0.00597

0.0109

retrograde transport, vesicle recycling within Gol…

protein binding

Golgi membrane,Golgi apparatus,Golgi transport com…

36

27

36

_LLLEIPEK_.2|_TLAHPISQEYLK_.3|_TLAHPISQEYLK_.2|_C[…

SEN / CTL

P25685

DnaJ homolog subfamily B member 1

DNAJB1

2.81

0.89

0.00000373

0.0000206

response to unfolded protein,positive regulation o…

ATPase activator activity,protein binding,Hsp70 pr…

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,ce…

28

21

28

_ILTIEVK_.2|_EIAEAYDVLSDPR_.2|_EIAEAYDVLSDPR_.3|_R…

SEN / CTL

Q96CG8

Collagen triple helix repeat-containing protein 1

CTHRC1

2.81

2.27

0.00356

0.00774

cell migration,positive regulation of protein bind…

frizzled binding,Wnt-protein binding

proteinaceous extracellular matrix,collagen trimer…

3

3

3

_IIIEELPK_.2|_GDASTGWNSVSR_.2|_QC[+57]SWSSLNYGIDLG…

SEN / CTL

O14773

Tripeptidyl-peptidase 1

TPP1

2.81

1.41

0.0113

0.0179

proteolysis,lipid metabolic process,lysosome organ…

endopeptidase activity,serine-type endopeptidase a…

mitochondrion,lysosome,melanosome,lysosomal lumen,…

26

16

26

_AYPDVAALSDGYWVVSNRVPIPWVSGTSASTPVFGGILSLINEHR_.4|…

SEN / CTL

Q9Y6R1

Electrogenic sodium bicarbonate cotransporter 1

SLC4A4

2.81

1.69

0.0205

0.0267

transport,sodium ion transport,inorganic anion tra…

inorganic anion exchanger activity,protein binding…

plasma membrane,integral component of plasma membr…

14

13

14

_FLFILLGPK_.2|_LIVPSEFKPTSPNR_.3|_MFTNPDNGSPAMTHR_…

SEN / CTL

Q99735

Microsomal glutathione S-transferase 2

MGST2

2.78

1.03

0.00377

0.00803

glutathione biosynthetic process,xenobiotic metabo…

glutathione transferase activity,leukotriene-C4 sy…

nuclear envelope,endoplasmic reticulum,endoplasmic…

5

3

5

_HLYFWGYSEAAK_.2|_HLYFWGYSEAAK_.3|_VTPPAVTGSPEFER_…

SEN / CTL

Q8WUA2

Peptidyl-prolyl cis-trans isomerase-like 4

PPIL4

2.78

1.9

0.0308

0.0359

protein peptidyl-prolyl isomerization,protein fold…

nucleotide binding,peptidyl-prolyl cis-trans isome…

nucleoplasm,cytoplasm

25

21

25

_DFIIQTGDPTGTGR_.2|_IHVDFSQSVAK_.3|_IHVDFSQSVAK_.2…

SEN / CTL

P36871

Phosphoglucomutase-1

PGM1

2.77

1.16

0.00585

0.0108

glycogen biosynthetic process,glycogen catabolic p…

magnesium ion binding,phosphoglucomutase activity,…

cytoplasm,cytosol,actin cytoskeleton,extracellular…

76

47

76

_ELLSGPNR_.2|_VDLGVLGK_.2|_IRIDAMHGVVGPYVK_.4|_IRI…

SEN / CTL

P40261

Nicotinamide N-methyltransferase

NNMT

2.77

2.1

0.0423

0.0444

response to organonitrogen compound,animal organ r…

nicotinamide N-methyltransferase activity,pyridine…

cytosol

20

13

20

_DTYLSHFNPR_.2|_DTYLSHFNPR_.3|_IFC[+57]LDGVK_.2|_H…

SEN / CTL

P31151

Protein S100-A7

S100A7

2.75

2.9

0.00252

0.00622

response to reactive oxygen species,angiogenesis,e…

calcium ion binding,protein binding,zinc ion bindi…

extracellular region,nucleus,cytoplasm,endoplasmic…

13

9

13

_SIIGMIDMFHK_.3|_SIIGMIDMFHK_.2|_GTNYLADVFEK_.2|_K…

SEN / CTL

Q5T9A4

ATPase family AAA domain-containing protein 3B

ATAD3B

2.74

0.92

0.00263

0.00643

ATP binding

mitochondrial inner membrane

18

13

18

_EYEAAVEQLK_.2|_HILLYGPPGTGK_.3|_HILLYGPPGTGK_.2|_…

SEN / CTL

O95772

MLN64 N-terminal domain homolog

STARD3NL

2.74

1.19

0.00676

0.012

lysosomal membrane,membrane,integral component of …

3

2

3

_LLIVQDASER_.2|_NIHSINPTQLMAR_.3|_NIHSINPTQLMAR_.2

SEN / CTL

Q9UHL4

Dipeptidyl peptidase 2

DPP7

2.73

1.27

0.0000794

0.000332

proteolysis

serine-type carboxypeptidase activity,serine-type …

lysosome,Golgi apparatus,cytosol,cytoplasmic vesic…

27

18

27

_YC[+57]LDTWGVWPR_.2|_LYHSC[+57]ADPTGC[+57]GTGPDAR…

SEN / CTL

Q96PM9

Zinc finger protein 385A

ZNF385A

2.73

1.09

0.00507

0.00978

transcription, DNA-templated,regulation of transcr…

p53 binding,DNA binding,mRNA 3′-UTR binding,zinc i…

nucleoplasm,nucleolus,cytoplasm,dendrite,neuronal …

4

4

4

_GAGELAGTLTFSK_.2|_VAVNSLSQLEAHNK_.3|_TAHGPILFSPY_…

SEN / CTL

Q9Y4R8

Telomere length regulation protein TEL2 homolog

TELO2

2.73

1.97

0.0361

0.0395

regulation of TOR signaling,protein stabilization,…

protein binding,protein kinase binding,protein com…

chromosome, telomeric region,intracellular,nucleus…

30

24

30

_QQEILGVLVPR_.2|_EKEEFASAHFSPVLR_.4|_ALEGLVYR_.2|_…

SEN / CTL

O15204

ADAM DEC1

ADAMDEC1

2.72

1.68

0.0223

0.0283

proteolysis,immune response,negative regulation of…

metalloendopeptidase activity,zinc ion binding

cellular_component,extracellular region

10

8

10

_NNVALVGVMSHELGHVLGMPDVPFNTK_.4|_NNVALVGVMSHELGHVL…

SEN / CTL

P35900

Keratin, type I cytoskeletal 20

KRT20

2.71

0.94

0.00298

0.00691

apoptotic process,cellular response to stress,inte…

structural constituent of cytoskeleton,protein bin…

cytoplasm,intermediate filament

60

37

60

_MAMQNLNDR_.2|_M[+16]AMQNLNDR_.2|_MAM[+16]QNLNDR_….

SEN / CTL

P31944

Caspase-14

CASP14

2.71

1.6

0.0191

0.0255

proteolysis,apoptotic process,epidermis developmen…

cysteine-type endopeptidase activity,protein bindi…

nucleus,cytoplasm,extracellular matrix,keratin fil…

18

15

18

_TNPEIQSTLR_.2|_FQQAIDSR_.2|_GHILELLTEVTRR_.3|_VYI…

SEN / CTL

Q9BVK6

Transmembrane emp24 domain-containing protein 9

TMED9

2.7

3.04

0.00398

0.00831

ER to Golgi vesicle-mediated transport,retrograde …

protein binding,syntaxin binding

Golgi membrane,endoplasmic reticulum,endoplasmic r…

17

12

17

_LSELQLR_.2|_QLVEQVEQIQKEQNYQR_.3|_FSLFAGGMLR_.2|_…

SEN / CTL

O95865

N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

DDAH2

2.7

2.13

0.0475

0.048

citrulline metabolic process,arginine catabolic pr…

catalytic activity,protein binding,dimethylarginin…

cytoplasm,mitochondrion,centrosome,cytosol,extrace…

24

14

24

_GGGDLPNSQEALQK_.2|_ALQDLGLR_.2|_GLC[+57]GMGGPR_.2…

SEN / CTL

O43399

Tumor protein D54

TPD52L2

2.68

1.63

0.0214

0.0274

poly(A) RNA binding

28

18

28

_LGEWNEK_.2|_KTQETLSQAGQK_.3|_KTQETLSQAGQK_.2|_TSA…

SEN / CTL

Q8N1N4

Keratin, type II cytoskeletal 78

KRT78

2.67

2.1

1.06e-8

9.12e-8

structural molecule activity

extracellular space,keratin filament,extracellular…

14

13

14

_YLDFSSIITEVR_.2|_TLNNQFASFIDKVR_.3|_VQISQLHQEIQR_…

SEN / CTL

P25705

ATP synthase subunit alpha, mitochondrial

ATP5A1

2.67

1.42

0.00022

0.000815

negative regulation of endothelial cell proliferat…

protein binding,ATP binding,transmembrane transpor…

mitochondrion,mitochondrial inner membrane,mitocho…

105

55

105

_EAYPGDVFYLHSR_.3|_EAYPGDVFYLHSR_.2|_AVDSLVPIGR_.2…

SEN / CTL

Q8IWL1


Q8IWL2

Pulmonary surfactant-associated protein A2;Pulmonary surfactant-associated protein A1

SFTPA2


SFTPA1

2.67

0.98

0.00362

0.00778

respiratory gaseous exchange,cellular protein meta…

carbohydrate binding;lipid transporter activity,pr…

extracellular region,proteinaceous extracellular m…

11

9

11

_KYNTYAYVGLTEGPSPGDFR_.3|_HQILQTR_.2|_NPEENEAIASFV…

SEN / CTL

P11226

Mannose-binding protein C

MBL2

2.67

1.42

0.0137

0.0202

complement activation, lectin pathway,proteolysis,…

serine-type endopeptidase activity,receptor bindin…

extracellular region,collagen trimer,extracellular…

3

3

3

_EEAFLGITDEK_.2|_SPDGDSSLAASER_.2|_TEGQFVDLTGNR_.2

SEN / CTL

Q86VN1

Vacuolar protein-sorting-associated protein 36

VPS36

2.67

3.11

0.0238

0.0294

transcription, DNA-templated,regulation of transcr…

protein binding,protein C-terminus binding,phospha…

ESCRT II complex,nucleus,lysosome,endosome,cytosol…

26

20

26

_NISEAFEDLSK_.2|_LVGMSVLLAK_.2|_FDAGTLLLSTHR_.3|_F…

SEN / CTL

Q14134

Tripartite motif-containing protein 29

TRIM29

2.66

0.84

0.00207

0.00538

negative regulation of transcription from RNA poly…

p53 binding,transcription factor activity, sequenc…

nucleoplasm,cytoplasm,cell-cell adherens junction,…

9

8

9

_VIMDALDER_.2|_TSYQPSSPGR_.2|_SC[+57]LVC[+57]QASFC…

SEN / CTL

P09234

U1 small nuclear ribonucleoprotein C

SNRPC

2.65

0.83

0.00201

0.00527

spliceosomal snRNP assembly,mRNA 5′-splice site re…

single-stranded RNA binding,protein binding,zinc i…

commitment complex,nucleoplasm,U1 snRNP,Cajal body…

13

8

13

_WMEEQAQSLIDK_.2|_WM[+16]EEQAQSLIDK_.2|_TTAAFQQGK_…

SEN / CTL

P05109

Protein S100-A8

S100A8

2.64

1.72

0.000921

0.00279

cytokine production,leukocyte migration involved i…

calcium ion binding,protein binding,microtubule bi…

extracellular region,extracellular space,nucleus,c…

29

17

29

_LLETEC[+57]PQYIR_.2|_LLETEC[+57]PQYIR_.3|_ALNSIID…

SEN / CTL

P55084

Trifunctional enzyme subunit beta, mitochondrial

HADHB

2.64

2.03

0.0434

0.0452

fatty acid beta-oxidation,cardiolipin acyl-chain r…

3-hydroxyacyl-CoA dehydrogenase activity,acetyl-Co…

mitochondrion,mitochondrial envelope,mitochondrial…

75

41

75

_EVVDYIIFGTVIQEVK_.3|_EVVDYIIFGTVIQEVK_.2|_LMLDLNK…

SEN / CTL

Q9UBQ7

Glyoxylate reductase/hydroxypyruvate reductase

GRHPR

2.63

1.48

0.0164

0.0229

excretion,metabolic process,dicarboxylic acid meta…

glycerate dehydrogenase activity,hydroxypyruvate r…

cytoplasm,peroxisomal matrix,cytosol,extracellular…

47

28

47

_GDVVNQDDLYQALASGK_.2|_GDVVNQDDLYQALASGK_.3|_GVAGA…

SEN / CTL

Q9UPW0

Forkhead box protein J3

FOXJ3

2.63

1.87

0.0345

0.0384

transcription, DNA-templated,regulation of transcr…

RNA polymerase II transcription factor activity, s…

nucleus

10

7

10

_GSYWAIDTNPK_.2|_SDATQNAHGTGISK_.3|_SDATQNAHGTGISK…

SEN / CTL

Q5VZM2


Q7L523

Ras-related GTP-binding protein B;Ras-related GTP-binding protein A

RRAGB


RRAGA

2.59

0.98

0.0132

0.0197

cell cycle arrest,regulation of autophagy,macroaut…

GTPase activity,protein binding,GTP binding,guanyl…

nucleus,cytoplasm,lysosome,lysosomal membrane,Golg…

1

1

1

_SIIFANYIAR_.2

SEN / CTL

Q9HCY8

Protein S100-A14

S100A14

2.55

1.34

0.0131

0.0196

apoptotic process,response to lipopolysaccharide,t…

calcium ion binding,protein binding,chemokine rece…

nucleoplasm,cytoplasm,plasma membrane,microtubule …

9

8

9

_SFWELIGEAAK_.2|_NFHQYSVEGGK_.3|_NFHQYSVEGGK_.2|_E…

SEN / CTL

Q9BQ75

Protein CMSS1

CMSS1

2.53

1.02

0.0051

0.0098

poly(A) RNA binding

nucleus,90S preribosome

8

6

8

_SEPKPGLPEDLQK_.3|_SEPKPGLPEDLQK_.2|_ANDLTHSLSSYLK…

SEN / CTL

O14974

Protein phosphatase 1 regulatory subunit 12A

PPP1R12A

2.51

1.32

0.000193

0.000727

G2/M transition of mitotic cell cycle,protein deph…

enzyme inhibitor activity,signal transducer activi…

kinetochore,nucleoplasm,cytoplasm,centrosome,cytos…

66

47

66

_SLLSSTSTTTK_.2|_KLYEQILAENEK_.2|_KLYEQILAENEK_.3|…

SEN / CTL

Q02218

2-oxoglutarate dehydrogenase, mitochondrial

OGDH

2.47

1.52

0.0000199

0.0000952

generation of precursor metabolites and energy,gly…

oxoglutarate dehydrogenase (succinyl-transferring)…

mitochondrion,mitochondrial matrix,mitochondrial m…

124

77

124

_FGLEGC[+57]EVLIPALK_.2|_SWDIFFR_.2|_LVEDHLAVQSLIR…

SEN / CTL

Q5T749

Keratinocyte proline-rich protein

KPRP

2.46

2.21

4.19e-11

4.43e-10

protein binding

cytoplasm,extracellular exosome

17

15

17

_RLDQC[+57]PESPLQR_.3|_RLDQC[+57]PESPLQR_.2|_IEISS…

SEN / CTL

P01133

Pro-epidermal growth factor

EGF

2.45

1.63

0.0283

0.0337

MAPK cascade,activation of MAPKK activity,activati…

protein tyrosine kinase activity,Ras guanyl-nucleo…

extracellular region,extracellular space,lysosomal…

1

1

1

_QSVIEM[+16]ANLDGSK_.2

SEN / CTL

Q9Y3P9

Rab GTPase-activating protein 1

RABGAP1

2.44

0.95

0.00444

0.0089

intracellular protein transport,cell cycle,regulat…

DNA binding,GTPase activator activity,protein bind…

centrosome,cytosol,microtubule associated complex,…

34

30

34

_SYVITGSWNPK_.2|_QQTANKVEIEK_.3|_IQDLEHHLGLALNEVQA…

SEN / CTL

P51659

Peroxisomal multifunctional enzyme type 2

HSD17B4

2.44

1.94

0.0477

0.0481

very long-chain fatty acid metabolic process,osteo…

C-3 sterol dehydrogenase (C-4 sterol decarboxylase…

mitochondrion,peroxisome,peroxisomal membrane,pero…

84

51

84

_DIGPEVVK_.2|_IDVVVNNAGILR_.3|_IDVVVNNAGILR_.2|_TA…

SEN / CTL

Q16629

Serine/arginine-rich splicing factor 7

SRSF7

2.43

0.69

0.00143

0.0041

mRNA splicing, via spliceosome,termination of RNA …

nucleotide binding,protein binding,zinc ion bindin…

nucleus,nucleoplasm,cytoplasm,extracellular exosom…

17

10

17

_AFSYYGPLR_.2|_VRVELSTGM[+16]PR_.3|_VRVELSTGMPR_.3…

SEN / CTL

Q969Q5

Ras-related protein Rab-24

RAB24

2.42

0.83

0.00285

0.00669

autophagy,small GTPase mediated signal transductio…

protein binding,GTP binding

mitochondrion,autophagosome,cytosol,membrane

7

6

7

_TGQSVDELFQK_.2|_SDLLEEDR_.2|_VDFHDVQDYADNIK_.3|_F…

SEN / CTL

Q9NVN3

Synembryn-B

RIC8B

2.41

1.46

0.0208

0.027

regulation of G-protein coupled receptor protein s…

G-protein alpha-subunit binding,guanyl-nucleotide …

cytoplasm,centrosome,cytosol,plasma membrane,cell …

1

1

1

_GSSYREGLTPVLSLLTEC[+57]SR_.3

SEN / CTL

O14980

Exportin-1

XPO1

2.4

0.87

0.00349

0.00764

ribosomal subunit export from nucleus,ribosomal la…

RNA binding,nuclear export signal receptor activit…

kinetochore,nucleus,nuclear envelope,annulate lame…

96

55

96

_PAIMTMLADHAAR_.2|_PAIM[+16]TMLADHAAR_.3|_PAIMTM[+…

SEN / CTL

P21796

Voltage-dependent anion-selective channel protein 1

VDAC1

2.4

1.12

0.00861

0.0144

behavioral fear response,anion transport,mitochond…

protein binding,voltage-gated anion channel activi…

nucleus,mitochondrion,mitochondrial outer membrane…

53

31

53

_GYGFGLIK_.2|_VTGSLETK_.2|_GYGFGLIKLDLK_.3|_GYGFGL…

SEN / CTL

P11908

Ribose-phosphate pyrophosphokinase 2

PRPS2

2.4

1.18

0.0104

0.0169

5-phosphoribose 1-diphosphate biosynthetic process…

magnesium ion binding,ribose phosphate diphosphoki…

ribose phosphate diphosphokinase complex,protein c…

17

12

17

_ENIAEWK_.2|_PNIVLFSGSSHQDLSQR_.4|_PNIVLFSGSSHQDLS…

SEN / CTL

O75717

WD repeat and HMG-box DNA-binding protein 1

WDHD1

2.39

1.84

0.0439

0.0455

DNA binding,protein binding

nucleoplasm,cytoplasm

61

46

61

_LLAIPVEK_.2|_LSELAVEK_.2|_QILHGDPLPLTR_.3|_C[+57]…

SEN / CTL

P04843

Dolichyl-diphosphooligosaccharide–protein glycosyltransferase subunit 1

RPN1

2.38

0.83

0.00306

0.00706

cellular protein modification process,protein N-li…

protein binding,poly(A) RNA binding,dolichyl-dipho…

endoplasmic reticulum membrane,rough endoplasmic r…

79

48

79

_ATSFLLALEPELEAR_.2|_ATSFLLALEPELEAR_.3|_RTVDLSSHL…

SEN / CTL

P05089

Arginase-1

ARG1

2.38

2.44

0.0129

0.0193

urea cycle,liver development,positive regulation o…

arginase activity,manganese ion binding

extracellular space,nucleus,cytoplasm,mitochondria…

20

15

20

_TIGIIGAPFSK_.2|_GGVEEGPTVLR_.2|_ISLVLGGDHSLAIGSIS…

SEN / CTL

Q5T6S3

PHD finger protein 19

PHF19

2.32

0.75

0.00226

0.00571

transcription, DNA-templated,regulation of transcr…

protein binding,zinc ion binding,methylated histon…

nucleoplasm,ESC/E(Z) complex

3

3

3

_C[+57]IFALAVR_.2|_DSYGATSHLPNK_.2|_WVDVVHLALYNLGV…

SEN / CTL

Q96JH8

Ras-associating and dilute domain-containing protein

RADIL

2.32

1.05

0.00776

0.0135

signal transduction,multicellular organism develop…

protein binding

microtubule

19

17

19

_VVSVYQAALDLLR_.2|_SDVEELAAK_.2|_GTPTPALGDAR_.2|_L…

SEN / CTL

Q15323

Keratin, type I cuticular Ha1

KRT31

2.31

1.82

0.00000138

0.00000844

cytoskeleton organization,epidermis development

structural constituent of cytoskeleton,protein bin…

extracellular space,intermediate filament,extracel…

11

11

11

_LVVQIDNAK_.2|_ILDELTLC[+57]K_.2|_QNQEYQVLLDVR_.2|…

SEN / CTL

P16152

Carbonyl reductase [NADPH] 1

CBR1

2.31

2.35

0.0127

0.0191

drug metabolic process,cyclooxygenase pathway,epit…

carbonyl reductase (NADPH) activity,oxidoreductase…

cytosol,extracellular exosome,extracellular vesicl…

39

24

39

_IGVTVLSR_.2|_ILLNAC[+57]C[+57]PGWVR_.2|_ILLNAC[+5…

SEN / CTL

Q9ULG6

Cell cycle progression protein 1

CCPG1

2.3

0.96

0.00582

0.0108

cell cycle,positive regulation of cell proliferati…

molecular_function,protein binding

integral component of membrane

2

2

2

_GELQQLSGSQLHGK_.2|_FFLNGVFIHDQK_.3

SEN / CTL

P01009

Alpha-1-antitrypsin

SERPINA1

2.3

1.82

0.0478

0.0482

platelet degranulation,ER to Golgi vesicle-mediate…

glycoprotein binding,protease binding,serine-type …

Golgi membrane,extracellular region,proteinaceous …

85

44

85

_RLGMFNIQHC[+57]K_.3|_KLSSWVLLMK_.3|_KLSSWVLLMK_.2…

SEN / CTL

P11216

Glycogen phosphorylase, brain form

PYGB

2.29

2.71

0.00308

0.00706

glycogen catabolic process

protein binding,glycogen phosphorylase activity,py…

cytoplasm,membrane,extracellular exosome

104

61

104

_NLAENISR_.2|_VLYPNDNFFEGK_.2|_ILVDVEK_.2|_LKQEYFV…

SEN / CTL

P61254


Q9UNX3

60S ribosomal protein L26;60S ribosomal protein L26-like 1

RPL26


RPL26L1

2.29

0.63

0.00527

0.0101

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

cytosol,membrane,cytosolic large ribosomal subunit…

1

1

1

_FNPFVTSDR_.2

SEN / CTL

P02743

Serum amyloid P-component

APCS

2.28

0.83

0.00358

0.00774

negative regulation of acute inflammatory response…

complement component C1q binding,calcium ion bindi…

extracellular region,extracellular space,nucleus,e…

16

14

16

_IVLGQEQDSYGGK_.3|_IVLGQEQDSYGGK_.2|_AYSDLSR_.2|_E…

SEN / CTL

Q08554

Desmocollin-1

DSC1

2.27

1.5

0.0000408

0.000187

homophilic cell adhesion via plasma membrane adhes…

calcium ion binding

plasma membrane,gap junction,membrane,integral com…

12

9

12

_VTIFTVPENC[+57]R_.2|_VTATDLDEPDTLHTR_.3|_VTATDLDE…

SEN / CTL

P50135

Histamine N-methyltransferase

HNMT

2.24

1.39

0.0225

0.0283

histamine catabolic process,response to tumor cell…

histamine N-methyltransferase activity

nucleoplasm,cytoplasm,cytosol,neuron projection,ex…

16

11

16

_FFHSLLGTNAK_.3|_FFHSLLGTNAK_.2|_TSNLENVK_.2|_ETSS…

SEN / CTL

Q6YHK3

CD109 antigen

CD109

2.23

1.49

0.0288

0.0341

negative regulation of protein phosphorylation,hai…

serine-type endopeptidase inhibitor activity,trans…

extracellular space,plasma membrane,cell surface,a…

34

27

34

_SNLIQQWLSQQSDLGVISK_.3|_SNLIQQWLSQQSDLGVISK_.2|_I…

SEN / CTL

P35606

Coatomer subunit beta’

COPB2

2.23

2.76

0.0312

0.0362

intracellular protein transport,ER to Golgi vesicl…

structural molecule activity,protein binding

Golgi membrane,endoplasmic reticulum membrane,cyto…

94

61

94

_VWC[+57]VASLR_.2|_TGRLPEAAFLAR_.3|_TGRLPEAAFLAR_….

SEN / CTL

P02538

Keratin, type II cytoskeletal 6A

KRT6A

2.21

2.68

1.31e-35

4.24e-34

morphogenesis of an epithelium,cytoskeleton organi…

structural constituent of cytoskeleton,protein bin…

nucleus,membrane,keratin filament,extracellular ex…

85

61

85

_WTLLQEQGTK_.2|_QLDSIVGER_.2|_YEELQVTAGR_.2|_AQYEE…

SEN / CTL

Q02952

A-kinase anchor protein 12

AKAP12

2.21

1.12

0.0118

0.0181

protein targeting,G-protein coupled receptor signa…

protein binding,adenylate cyclase binding,protein …

cytoplasm,cytoskeleton,plasma membrane,focal adhes…

109

84

109

_LVQNIIQTAVDQFVR_.3|_LVQNIIQTAVDQFVR_.2|_DKTEKPDTV…

SEN / CTL

P78310

Coxsackievirus and adenovirus receptor

CXADR

2.21

1.47

0.0286

0.034

mitochondrion organization,heterophilic cell-cell …

virus receptor activity,integrin binding,protein b…

acrosomal vesicle,extracellular region,nucleoplasm…

15

14

15

_EGSLPLQYEWQK_.2|_AKGETAYLPC[+57]K_.3|_VAAPNLSR_.2…

SEN / CTL

P31153

S-adenosylmethionine synthase isoform type-2

MAT2A

2.19

1.69

0.0441

0.0456

S-adenosylmethionine biosynthetic process,one-carb…

methionine adenosyltransferase activity,protein bi…

cytosol,methionine adenosyltransferase complex

40

24

40

_FVIGGPQGDAGLTGR_.2|_FVIGGPQGDAGLTGR_.3|_DSFPWEVPK…

SEN / CTL

P13647

Keratin, type II cytoskeletal 5

KRT5

2.18

2.11

3.78e-30

1.03e-28

cytoskeleton organization,epidermis development,he…

structural constituent of cytoskeleton,protein bin…

nucleus,cytoplasm,mitochondrion,cytosol,intermedia…

51

31

51

_ISISTSGGSFR_.2|_AQYEEIANR_.2|_YEELQQTAGR_.2|_LAEL…

SEN / CTL

P14923

Junction plakoglobin

JUP

2.18

2.02

3.78e-22

8.49e-21

desmosome assembly,cytoskeletal anchoring at plasm…

transcription coactivator activity,signal transduc…

nucleus,cytoplasm,cytosol,cytoskeleton,intermediat…

62

39

62

_LVQLLVK_.2|_LVQNC[+57]LWTLR_.2|_LLNDEDPVVVTK_.2|_…

SEN / CTL

P68431


P84243


Q16695


Q71DI3

Histone H3.1;Histone H3.3;Histone H3.1t;Histone H3.2

HIST1H3A


H3F3A


HIST3H3


HIST2H3A

2.18

1.59

0.0000638

0.000276

chromatin silencing at rDNA,nucleosome assembly,DN…

protein binding,nucleosomal DNA binding,histone bi…

nuclear chromosome,nuclear chromosome, telomeric r…

4

3

4

_EIAQDFKTDLR_.3|_EIAQDFKTDLR_.2|_STELLIR_.2|_YRPGT…

SEN / CTL

Q9P260

LisH domain and HEAT repeat-containing protein KIAA1468

KIAA1468

2.18

0.83

0.00426

0.00866

37

30

37

_RALNFLVNEFLLK_.3|_RALNFLVNEFLLK_.2|_VKPQFQEILR_.3…

SEN / CTL

Q02413

Desmoglein-1

DSG1

2.16

1.69

2.24e-17

3.63e-16

cell-cell junction assembly,homophilic cell adhesi…

calcium ion binding,protein binding,toxic substanc…

cytosol,plasma membrane,cytoplasmic side of plasma…

32

21

32

_VIAPSSSLPTSLTIHHPR_.4|_VIAPSSSLPTSLTIHHPR_.3|_YVM…

SEN / CTL

P42765

3-ketoacyl-CoA thiolase, mitochondrial

ACAA2

2.16

0.97

0.00779

0.0135

fatty acid beta-oxidation,cholesterol biosynthetic…

acetyl-CoA C-acyltransferase activity,protein bind…

mitochondrion,mitochondrial inner membrane,extrace…

72

38

72

_VGIPKETPALTINR_.3|_RTPFGAYGGLLK_.3|_RTPFGAYGGLLK_…

SEN / CTL

Q9NX74

tRNA-dihydrouridine(20) synthase [NAD(P)+]-like

DUS2

2.16

2.41

0.0195

0.0259

tRNA dihydrouridine synthesis,negative regulation …

double-stranded RNA binding,protein kinase inhibit…

cytoplasm,mitochondrion,endoplasmic reticulum,cyto…

14

11

14

_AAM[+16]WNPSIFLK_.2|_AAMWNPSIFLK_.2|_YAVQYDNHYTNT…

SEN / CTL

Q8WVV4

Protein POF1B

POF1B

2.13

1.84

0.000532

0.00176

actin binding

bicellular tight junction,desmosome

38

28

38

_C[+57]QALEENNLSLR_.2|_VVQALDPFNSR_.2|_YFGELLADLSR…

SEN / CTL

P13645

Keratin, type I cytoskeletal 10

KRT10

2.1

1.83

2.54e-59

2.19e-57

keratinocyte differentiation

structural constituent of epidermis

extracellular space,nucleus,cytoplasm,intermediate…

100

51

100

_LKYENEVALR_.3|_LKYENEVALR_.2|_IRLENEIQTYR_.3|_IRL…

SEN / CTL

Q03154

Aminoacylase-1

ACY1

2.1

0.86

0.00533

0.0101

proteolysis,cellular amino acid metabolic process,…

aminoacylase activity,protein binding,zinc ion bin…

cytosol,extracellular exosome

55

37

55

_GVDIYTR_.2|_TPVLLHDHDER_.3|_TPVLLHDHDER_.2|_VAPDV…

SEN / CTL

P25311

Zinc-alpha-2-glycoprotein

AZGP1

2.1

1.1

0.013

0.0195

detection of chemical stimulus involved in sensory…

glycoprotein binding,antigen binding,ribonuclease …

extracellular region,extracellular space,nucleus,p…

31

20

31

_QKWEAEPVYVQR_.3|_QKWEAEPVYVQR_.2|_AREDIFMETLK_.3|…

SEN / CTL

P31150

Rab GDP dissociation inhibitor alpha

GDI1

2.08

1.36

0.0268

0.0322

signal transduction,protein transport,Rab protein …

GDP-dissociation inhibitor activity,Rab GDP-dissoc…

cytoplasm,Golgi apparatus,cytosol,midbody,neuron p…

53

28

53

_FQLLEGPPESMGR_.2|_FQLLEGPPESM[+16]GR_.2|_MAGTAFDF…

SEN / CTL

Q96BM9

ADP-ribosylation factor-like protein 8A

ARL8A

2.07

0.46

0.000557

0.0018

chromosome segregation,mitotic nuclear division,sm…

GTPase activity,protein binding,GTP binding,alpha-…

cytoplasm,lysosomal membrane,membrane,midbody,late…

19

11

19

_LWDIGGQPR_.2|_DLPGALDEK_.2|_PQLQGIPVLVLGNK_.3|_PQ…

SEN / CTL

Q07960

Rho GTPase-activating protein 1

ARHGAP1

2.07

1.29

0.0232

0.029

small GTPase mediated signal transduction,Rho prot…

SH3/SH2 adaptor activity,GTPase activator activity…

cytoplasm,cytosol,cell-cell adherens junction,peri…

48

27

48

_YNM[+16]GLPVDFDQYNELHLPAVILK_.3|_YNMGLPVDFDQYNELH…

SEN / CTL

P35527

Keratin, type I cytoskeletal 9

KRT9

2.06

1.65

5.62e-66

9.69e-64

spermatogenesis,epidermis development,skin develop…

structural constituent of cytoskeleton

extracellular space,nucleus,intermediate filament,…

121

54

121

_TLLDIDNTR_.2|_QGVDADINGLR_.2|_QFSSSYLSR_.2|_QVLDN…

SEN / CTL

Q12982


Q86WG3

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2;Caytaxin

BNIP2


ATCAY

2.06

1.14

0.0363

0.0396

apoptotic process,negative regulation of apoptotic…

GTPase activator activity,calcium ion binding,prot…

nuclear envelope,cytoplasm,cytosol,intracellular m…

1

1

1

_SLIIVHPSWFIR_.2

SEN / CTL

Q96ST3

Paired amphipathic helix protein Sin3a

SIN3A

2.05

0.84

0.00546

0.0103

negative regulation of transcription from RNA poly…

transcription regulatory region sequence-specific …

kinetochore,nucleus,nucleoplasm,transcription fact…

44

35

44

_C[+57]LVIFNQEVISR_.2|_QILEDAAALIIHHVK_.4|_QILEDAA…

SEN / CTL

Q99536

Synaptic vesicle membrane protein VAT-1 homolog

VAT1

2.04

1.74

5.11e-8

4.14e-7

negative regulation of mitochondrial fusion,oxidat…

zinc ion binding,oxidoreductase activity

mitochondrial outer membrane,integral component of…

53

28

53

_VLLVPGPEKEN_.2|_AC[+57]GLNFADLMAR_.2|_AC[+57]GLNF…

SEN / CTL

Q9H2V7

Protein spinster homolog 1

SPNS1

2.03

0.76

0.00407

0.00839

sphingosine-1-phosphate signaling pathway,lipid tr…

protein binding,sphingolipid transporter activity

mitochondrial inner membrane,lysosomal membrane,in…

4

4

4

_SEEPEVPDQEGLQR_.2|_AQLHVQGLLHEAGSTDDR_.4|_AQLHVQG…

SEN / CTL

P61289

Proteasome activator complex subunit 3

PSME3

2.03

1.44

0.0342

0.0383

MAPK cascade,protein polyubiquitination,stimulator…

p53 binding,protein binding,identical protein bind…

proteasome complex,nucleus,nucleoplasm,cytoplasm,c…

41

23

41

_LIISELR_.2|_KLLELDSFLK_.3|_KLLELDSFLK_.2|_YPHVEDY…

SEN / CTL

P04264

Keratin, type II cytoskeletal 1

KRT1

2

1.94

9.78e-64

1.26e-61

complement activation, lectin pathway,retina homeo…

receptor activity,structural molecule activity,pro…

extracellular space,nucleus,cytoskeleton,plasma me…

114

63

114

_SLDLDSIIAEVK_.2|_SLDLDSIIAEVK_.3|_SISISVAR_.2|_WE…

SEN / CTL

P56539


Q03135

Caveolin-3;Caveolin-1

CAV3


CAV1

1.99

0.88

0.0203

0.0266

plasma membrane repair,regulation of heart rate,ne…

calcium channel regulator activity,protein binding…

Golgi membrane,endoplasmic reticulum,plasma membra…

1

1

1

_EIDLVNRDPK_.2

SEN / CTL

P62979

Ubiquitin-40S ribosomal protein S27a

RPS27A

1.98

1.61

1.28e-9

1.28e-8

G2/M transition of mitotic cell cycle,negative reg…

structural constituent of ribosome,protein binding…

extracellular space,nucleus,nucleoplasm,nucleolus,…

17

11

17

_TLSDYNIQK_.2|_TITLEVEPSDTIENVK_.3|_TITLEVEPSDTIEN…

SEN / CTL

O15173

Membrane-associated progesterone receptor component 2

PGRMC2

1.97

1.89

0.00911

0.0151

steroid hormone mediated signaling pathway

steroid hormone receptor activity,steroid binding,…

nuclear envelope,endomembrane system,membrane,inte…

13

10

13

_FYGPAGPYGIFAGR_.2|_FYGPAGPYGIFAGR_.3|_DFSLEQLR_.2…

SEN / CTL

Q96KG9

N-terminal kinase-like protein

SCYL1

1.97

1.27

0.0257

0.0312

transcription, DNA-templated,regulation of transcr…

DNA binding,protein tyrosine kinase activity,ATP b…

nucleus,cytoplasm,endoplasmic reticulum-Golgi inte…

50

34

50

_SMLLLAPK_.2|_VLTSAFSR_.2|_APGGFMSNR_.2|_C[+57]LHV…

SEN / CTL

O43504

Ragulator complex protein LAMTOR5

LAMTOR5

1.96

0.72

0.00368

0.00787

cell cycle arrest,regulation of cell size,response…

protein binding,guanyl-nucleotide exchange factor …

lysosome,lysosomal membrane,cytosol,Ragulator comp…

6

4

6

_GTLSDEHAGVISVLAQQAAK_.3|_GTLSDEHAGVISVLAQQAAK_.2|…

SEN / CTL

P15924

Desmoplakin

DSP

1.95

2.16

4.1e-32

1.25e-30

desmosome organization,ventricular compact myocard…

protein kinase C binding,structural molecule activ…

cornified envelope,nucleus,cytoplasm,plasma membra…

227

165

227

_YIELLTR_.2|_QLQNIIQATSR_.2|_IEVLEEELR_.2|_VLLQEEG…

SEN / CTL

O15400

Syntaxin-7

STX7

1.94

1.42

0.00193

0.00514

positive regulation of T cell mediated cytotoxicit…

SNARE binding,SNAP receptor activity,protein bindi…

immunological synapse,lysosome,lysosomal membrane,…

12

10

12

_ITQC[+57]SVEIQR_.2|_TLNQLGTPQDSPELR_.2|_TLNQLGTPQ…

SEN / CTL

P35908

Keratin, type II cytoskeletal 2 epidermal

KRT2

1.91

1.93

6.95e-36

2.4e-34

keratinocyte development,epidermis development,ker…

structural constituent of cytoskeleton,protein bin…

extracellular space,nucleus,cytoplasm,Golgi appara…

106

57

106

_FLEQQNQVLQTK_.2|_FLEQQNQVLQTK_.3|_IEISELNR_.2|_YL…

SEN / CTL

Q15758

Neutral amino acid transporter B(0)

SLC1A5

1.89

1.46

0.00000104

0.00000655

amino acid transmembrane transport,extracellular a…

virus receptor activity,receptor activity,protein …

Golgi apparatus,plasma membrane,integral component…

21

16

21

_STEPELIQVK_.2|_SELPLDPLPVPTEEGNPLLK_.3|_SELPLDPLP…

SEN / CTL

Q9UHD8

Septin-9

9-Sep

1.89

1.21

0.000803

0.00248

cell cycle,protein heterooligomerization,cell divi…

GTPase activity,protein binding,GTP binding,cadher…

stress fiber,cytoplasm,microtubule,cell-cell adher…

76

46

76

_VVNIVPVIAK_.2|_APVDFGYVGIDSILEQM[+16]R_.3|_APVDFG…

SEN / CTL

Q9Y5B9

FACT complex subunit SPT16

SUPT16H

1.88

1.41

0.0403

0.0427

DNA replication,DNA repair,nucleosome disassembly,…

protein binding,nucleosome binding,histone binding…

nucleus,nucleoplasm,chromosome,FACT complex

104

69

104

_IIFMASK_.2|_RMQGSLEAHVNGFR_.4|_RMQGSLEAHVNGFR_.3|…

SEN / CTL

Q00325

Phosphate carrier protein, mitochondrial

SLC25A3

1.87

0.95

0.0115

0.018

generation of precursor metabolites and energy,tra…

symporter activity,phosphate ion carrier activity,…

nucleus,nucleolus,mitochondrion,mitochondrial inne…

40

23

40

_TVEALYK_.2|_TVEALYKFVVPKPR_.4|_TVEALYKFVVPKPR_.3|…

SEN / CTL

P53990

IST1 homolog

IST1

1.87

1.38

0.0391

0.0418

cytokinesis,protein localization,abscission,protei…

protein binding,protein domain specific binding,pr…

nuclear envelope,endoplasmic reticulum-Golgi inter…

15

12

15

_YLIEIAK_.2|_LSVEAPPK_.2|_FGLIQSMK_.2|_EIADYLAAGKD…

SEN / CTL

O75569

Interferon-inducible double-stranded RNA-dependent protein kinase activator A

PRKRA

1.85

0.84

0.00801

0.0138

protein phosphorylation,immune response,negative r…

double-stranded RNA binding,protein binding,enzyme…

nucleoplasm,cytoplasm,cytosol,membrane,perinuclear…

27

16

27

_LPEYTLSQEGGPAHKR_.4|_LPEYTLSQEGGPAHKR_.3|_LPEYTLS…

SEN / CTL

P08708


P0CW22

40S ribosomal protein S17;40S ribosomal protein S17-like

RPS17


RPS17L

1.85

1.27

0.031

0.0361

ribosomal small subunit assembly,nuclear-transcrib…

structural constituent of ribosome,poly(A) RNA bin…

nucleoplasm,cytosol,ribosome,focal adhesion,membra…

23

13

23

_VC[+57]EEIAIIPSKK_.3|_VC[+57]EEIAIIPSKK_.2|_LGNDF…

SEN / CTL

P06576

ATP synthase subunit beta, mitochondrial

ATP5B

1.84

1.47

0.00336

0.00748

angiogenesis,osteoblast differentiation,generation…

transporter activity,protein binding,ATP binding,t…

nucleus,mitochondrion,mitochondrial proton-transpo…

115

47

115

_IGLFGGAGVGK_.2|_FTQAGSEVSALLGR_.2|_FTQAGSEVSALLGR…

SEN / CTL

P32119

Peroxiredoxin-2

PRDX2

1.83

0.68

5.13e-8

4.14e-7

response to reactive oxygen species,response to ox…

thioredoxin peroxidase activity,antioxidant activi…

cytoplasm,cytosol,extracellular exosome

40

24

40

_GLFIIDGK_.2|_KEGGLGPLNIPLLADVTR_.3|_KEGGLGPLNIPLL…

SEN / CTL

P10412


P16402


P16403

Histone H1.4;Histone H1.3;Histone H1.2

HIST1H1E


HIST1H1D


HIST1H1C

1.83

2.36

0.0000456

0.000205

negative regulation of transcription from RNA poly…

protein binding,chromatin DNA binding,poly(A) RNA …

nucleosome,nucleus,nuclear heterochromatin,extrace…

9

7

9

_KASGPPVSELITK_.3|_KASGPPVSELITK_.2|_ALAAAGYDVEK_….

SEN / CTL

P02533

Keratin, type I cytoskeletal 14

KRT14

1.82

2.34

2.2e-38

9.5e-37

aging,epidermis development,response to zinc ion,r…

structural constituent of cytoskeleton,protein bin…

nucleus,cytoplasm,cytosol,intermediate filament,ke…

89

50

89

_VLDELTLAR_.2|_LAADDFR_.2|_LASYLDKVR_.2|_ISSVLAGGS…

SEN / CTL

P09211

Glutathione S-transferase P

GSTP1

1.82

1.33

1.38e-10

1.43e-9

response to reactive oxygen species,negative regul…

glutathione transferase activity,glutathione perox…

extracellular space,intracellular,nucleus,cytoplas…

44

20

44

_ASC[+57]LYGQLPK_.2|_PPYTVVYFPVR_.2|_PPYTVVYFPVR_….

SEN / CTL

Q14344

Guanine nucleotide-binding protein subunit alpha-13

GNA13

1.82

1.1

0.00053

0.00176

patterning of blood vessels,in utero embryonic dev…

GTPase activity,signal transducer activity,protein…

nucleus,cytoplasm,heterotrimeric G-protein complex…

25

19

25

_ILLLGAGESGK_.2|_VFLQYLPAIR_.2|_IIHGQDFDQR_.3|_IIH…

SEN / CTL

P33176

Kinesin-1 heavy chain

KIF5B

1.82

1.3

0.0351

0.0388

microtubule-based movement,cytoplasm organization,…

microtubule motor activity,protein binding,ATP bin…

cytoplasm,microtubule organizing center,kinesin co…

283

140

283

_EYELLSDELNQK_.2|_EYELLSDELNQK_.3|_ALESALKEAKENASR…

SEN / CTL

Q9Y394

Dehydrogenase/reductase SDR family member 7

DHRS7

1.81

0.84

0.00842

0.0142

oxidation-reduction process

oxidoreductase activity

membrane

18

13

18

_SLC[+57]M[+16]DTSLDVYR_.2|_SLC[+57]MDTSLDVYR_.2|_…

SEN / CTL

Q9UJF2

Ras GTPase-activating protein nGAP

RASAL2

1.79

0.83

0.00829

0.0141

MAPK cascade,signal transduction,positive regulati…

GTPase activator activity,protein binding

cytoplasm,cytosol,intrinsic component of the cytop…

124

73

124

_IVSLDSANTR_.2|_HTVPDRHIPLALPR_.4|_HTVPDRHIPLALPR_…

SEN / CTL

O75368

SH3 domain-binding glutamic acid-rich-like protein

SH3BGRL

1.76

1.49

0.00473

0.00931

positive regulation of signal transduction

SH3/SH2 adaptor activity,SH3 domain binding

extracellular space,nucleus,cytoplasm,extracellula…

17

12

17

_VYIASSSGSTAIK_.2|_ENNAVYAFLGLTAPPGSK_.3|_ENNAVYAF…

SEN / CTL

P61026

Ras-related protein Rab-10

RAB10

1.76

0.76

0.00661

0.0118

Golgi to plasma membrane transport,small GTPase me…

GTPase activity,protein binding,GTP binding,GDP bi…

Golgi membrane,endosome,endoplasmic reticulum memb…

19

14

19

_AFLTLAEDILR_.2|_ANINIEK_.2|_SFENISK_.2|_FHTITTSYY…

SEN / CTL

Q01469

Fatty acid-binding protein, epidermal

FABP5

1.75

1.85

0.0000161

0.0000786

glucose metabolic process,lipid metabolic process,…

transporter activity,fatty acid binding,protein bi…

nucleoplasm,cytoplasm,cytosol,extracellular exosom…

34

17

34

_ELGVGIALR_.2|_TQTVC[+57]NFTDGALVQHQEWDGKESTITR_.4…

SEN / CTL

O43175

D-3-phosphoglycerate dehydrogenase

PHGDH

1.74

1.63

0.0000166

0.0000803

glutamine metabolic process,glycine metabolic proc…

phosphoglycerate dehydrogenase activity,electron c…

cytosol,myelin sheath,extracellular exosome

65

33

65

_DLPLLLFR_.2|_GGIVDEGALLR_.2|_VTADVINAAEK_.2|_TLGI…

SEN / CTL

O94788

Retinal dehydrogenase 2

ALDH1A2

1.74

1.83

0.0147

0.0214

blood vessel development,kidney development,liver …

retinal dehydrogenase activity,3-chloroallyl aldeh…

cytoplasm,cytosol,perinuclear region of cytoplasm

30

23

30

_FKTMDEVIER_.3|_LADLVER_.2|_ILELIQSGVAEGAK_.3|_ILE…

SEN / CTL

O43242

26S proteasome non-ATPase regulatory subunit 3

PSMD3

1.73

1.75

0.0121

0.0185

MAPK cascade,protein polyubiquitination,stimulator…

protein binding,enzyme regulator activity

proteasome complex,nucleus,nucleoplasm,cytoplasm,c…

64

43

64

_SLMPYFLLTQAVR_.2|_SLMPYFLLTQAVR_.3|_SLM[+16]PYFLL…

SEN / CTL

O15260

Surfeit locus protein 4

SURF4

1.72

1.47

0.000467

0.00158

retrograde vesicle-mediated transport, Golgi to ER…

protein binding

Golgi membrane,endoplasmic reticulum membrane,endo…

11

6

11

_LC[+57]LISTFLEDGIR_.2|_SMFAGVPTMR_.2|_SM[+16]FAGV…

SEN / CTL

O95819


Q8N4C8


Q9UKE5

Mitogen-activated protein kinase kinase kinase kinase 4;Misshapen-like kinase 1;TRAF2 and NCK-interacting protein kinase

MAP4K4


MINK1


TNIK

1.72

0.93

0.00127

0.00373

protein phosphorylation,signal transduction by pro…

creatine kinase activity,protein serine/threonine …

cytoplasm;cytoplasm,Golgi apparatus,cytosol,postsy…

2

2

2

_ALFLIPR_.2|_VFFASVR_.2

SEN / CTL

P29218

Inositol monophosphatase 1

IMPA1

1.72

0.65

0.00409

0.00839

inositol metabolic process,inositol biosynthetic p…

magnesium ion binding,protein binding,inositol mon…

cytoplasm,cytosol,extracellular exosome

22

16

22

_MVLSNMEK_.2|_LFC[+57]IPVHGIR_.3|_LFC[+57]IPVHGIR_…

SEN / CTL

P18283

Glutathione peroxidase 2

GPX2

1.72

1.22

0.0348

0.0386

response to reactive oxygen species,oxidation-redu…

glutathione peroxidase activity,electron carrier a…

cytoplasm,cytosol,extracellular exosome

16

12

16

_VDFNTFR_.2|_SDVAWNFEK_.2|_FLIGPEGEPFR_.2|_RSDVAWN…

SEN / CTL

P06899


P23527


P33778


Q16778


Q8N257

Histone H2B type 1-J;Histone H2B type 1-O;Histone H2B type 1-B;Histone H2B type 2-E;Histone H2B type 3-B

HIST1H2BJ


HIST1H2BO


HIST1H2BB


HIST2H2BE


HIST3H2BB

1.71

1.67

4.79e-7

0.00000322

innate immune response in mucosa,nucleosome assemb…

DNA binding,protein heterodimerization activity;DN…

nucleosome,nuclear nucleosome,extracellular space,…

9

4

9

_LLLPGELAK_.2|_KESYSIYVYK_.3|_AMGIMNSFVNDIFER_.2|_…

SEN / CTL

Q16647

Prostacyclin synthase

PTGIS

1.71

1.29

0.0411

0.0433

prostaglandin biosynthetic process,icosanoid metab…

monooxygenase activity,iron ion binding,protein bi…

extracellular space,nucleus,endoplasmic reticulum,…

7

7

7

_VLDSTPVLDSVLSESLR_.2|_VHSADVFHTFR_.3|_GSLSVGDKDHM…

SEN / CTL

P08779

Keratin, type I cytoskeletal 16

KRT16

1.7

2.99

6.54e-14

8.46e-13

morphogenesis of an epithelium,inflammatory respon…

structural constituent of cytoskeleton,protein bin…

nucleus,cytoskeleton,intermediate filament,extrace…

45

25

45

_APSTYGGGLSVSSR_.2|_DAETWFLSK_.2|_QTVEADVNGLRR_.3|…

SEN / CTL

P02675

Fibrinogen beta chain

FGB

1.7

1.07

0.0238

0.0294

adaptive immune response,platelet degranulation,ce…

structural molecule activity,protein binding,prote…

extracellular region,fibrinogen complex,extracellu…

93

48

93

_SILENLR_.2|_YQISVNK_.2|_GSWYSMR_.2|_KREEAPSLRPAPP…

SEN / CTL

O76013

Keratin, type I cuticular Ha6

KRT36

1.7

1.2

0.0334

0.0379

biological_process,regulation of keratinocyte diff…

structural constituent of epidermis

intermediate filament,extracellular exosome

3

3

3

_QLVEADINGLR_.2|_ENAELESR_.2|_QNQEYQVLLDVK_.2

SEN / CTL

Q6EMK4

Vasorin

VASN

1.69

1.69

0.0117

0.018

negative regulation of epithelial to mesenchymal t…

protein binding,transforming growth factor beta bi…

extracellular space,mitochondrion,lysosomal membra…

8

8

8

_YLQGSSVQLR_.2|_LAGLGLQQLDEGLFSR_.2|_ESHVTLASPEETR…

SEN / CTL

Q9BTY7

Protein HGH1 homolog

HGH1

1.68

0.6

0.0033

0.00741

biological_process

molecular_function

cellular_component

22

17

22

_HVLALTGC[+57]GPGR_.3|_HVLALTGC[+57]GPGR_.2|_ADLQA…

SEN / CTL

P10599

Thioredoxin

TXN

1.68

1.75

0.0143

0.021

negative regulation of transcription from RNA poly…

thioredoxin-disulfide reductase activity,protein b…

nucleus,nucleoplasm,cytoplasm,mitochondrion,cytoso…

20

12

20

_C[+57]MPTFQFFK_.2|_C[+57]M[+16]PTFQFFK_.2|_MIKPFF…

SEN / CTL

Q09028


Q16576

Histone-binding protein RBBP4;Histone-binding protein RBBP7

RBBP4


RBBP7

1.68

0.77

0.0225

0.0283

DNA replication,DNA replication-dependent nucleoso…

histone deacetylase activity,protein binding,histo…

nuclear chromatin,nucleus,nucleoplasm,Sin3 complex…

1

1

1

_LMIWDTR_.2

SEN / CTL

P45880

Voltage-dependent anion-selective channel protein 2

VDAC2

1.67

1.79

0.0161

0.0228

anion transport,negative regulation of protein pol…

nucleotide binding,protein binding,voltage-gated a…

nucleus,mitochondrion,mitochondrial outer membrane…

28

21

28

_YQLDPTASISAK_.2|_GFGFGLVK_.2|_VTGTLETK_.2|_LTLSAL…

SEN / CTL

P27695

DNA-(apurinic or apyrimidinic site) lyase

APEX1

1.66

0.2

0.0000543

0.000239

telomere maintenance,DNA repair,base-excision repa…

DNA binding,damaged DNA binding,double-stranded te…

nuclear chromosome, telomeric region,nucleus,nucle…

52

28

52

_QRWDEAFRK_.3|_KGAVAEDGDELR_.3|_KGAVAEDGDELR_.2|_G…

SEN / CTL

P01857

Ig gamma-1 chain C region

IGHG1

1.66

2.97

0.00224

0.00569

proteolysis,phagocytosis, recognition,phagocytosis…

antigen binding,serine-type endopeptidase activity…

extracellular region,extracellular space,external …

54

25

54

_ALPAPIEK_.2|_GPSVFPLAPSSK_.2|_NQVSLTC[+57]LVK_.2|…

SEN / CTL

Q9HD45

Transmembrane 9 superfamily member 3

TM9SF3

1.66

0.93

0.0162

0.0228

integral component of membrane

17

14

17

_YFSLPFC[+57]VGSK_.2|_VNAVPRPIPEK_.3|_VNAVPRPIPEK_…

SEN / CTL

P30876

DNA-directed RNA polymerase II subunit RPB2

POLR2B

1.66

1.3

0.046

0.047

mRNA splicing, via spliceosome,transcription-coupl…

DNA binding,chromatin binding,protein binding,ribo…

nucleus,nucleoplasm,DNA-directed RNA polymerase II…

72

51

72

_LLLAALGR_.2|_LTFASTLSHLR_.3|_LTFASTLSHLR_.2|_KGFD…

SEN / CTL

Q04695

Keratin, type I cytoskeletal 17

KRT17

1.65

2.56

9.09e-12

1.02e-10

signal transduction,epidermis development,positive…

structural constituent of cytoskeleton,protein bin…

cytoplasm,intermediate filament,extracellular exos…

41

27

41

_ALEEANTELEVK_.2|_DYSQYYR_.2|_LSVEADINGLRR_.2|_LSV…

SEN / CTL

Q9Y5M8

Signal recognition particle receptor subunit beta

SRPRB

1.65

2.09

0.0341

0.0383

SRP-dependent cotranslational protein targeting to…

signal recognition particle binding,GTP binding

cytoplasm,signal recognition particle receptor com…

25

19

25

_VEFLEC[+57]SAK_.2|_LLTGLYR_.2|_GKEFEFSQLPLK_.3|_G…

SEN / CTL

P17302

Gap junction alpha-1 protein

GJA1

1.64

0.93

0.000357

0.00124

osteoblast differentiation,in utero embryonic deve…

signal transducer activity,receptor binding,gap ju…

Golgi membrane,mitochondrion,mitochondrial outer m…

5

4

5

_LAAGHELQPLAIVDQRPSSR_.4|_VAQTDGVNVDMHLK_.3|_SDPYH…

SEN / CTL

P84103

Serine/arginine-rich splicing factor 3

SRSF3

1.63

2.1

0.0366

0.0398

mRNA splicing, via spliceosome,termination of RNA …

nucleotide binding,RNA binding,protein binding,pho…

nucleoplasm,cytoplasm,nuclear speck

16

10

16

_AFGYYGPLR_.2|_NPPGFAFVEFEDPRDAADAVR_.3|_NPPGFAFVE…

SEN / CTL

P00441

Superoxide dismutase [Cu-Zn]

SOD1

1.61

1.71

0.00000307

0.0000173

activation of MAPK activity,response to reactive o…

superoxide dismutase activity,copper ion binding,p…

extracellular region,extracellular space,nucleus,n…

39

20

39

_LAC[+57]GVIGIAQ_.2|_GLTEGLHGFHVHEFGDNTAGC[+57]TSA…

SEN / CTL

Q92930

Ras-related protein Rab-8B

RAB8B

1.61

1.59

0.00233

0.00583

vesicle docking involved in exocytosis,small GTPas…

GTPase activity,receptor binding,protein binding,G…

mitochondrion,peroxisomal membrane,plasma membrane…

9

6

9

_LAIDYGIK_.2|_TITTAYYR_.2|_SSANVEEAFFTLAR_.3|_SSAN…

SEN / CTL

Q14240

Eukaryotic initiation factor 4A-II

EIF4A2

1.61

0.68

0.00633

0.0114

nuclear-transcribed mRNA poly(A) tail shortening,t…

translation initiation factor activity,ATP-depende…

cytosol,eukaryotic translation initiation factor 4…

29

18

29

_GVAINFVTEEDKR_.2|_GVAINFVTEEDKR_.3|_KGVAINFVTEEDK…

SEN / CTL

Q5R372

Rab GTPase-activating protein 1-like

RABGAP1L

1.61

2.07

0.0366

0.0398

intracellular protein transport,regulation of vesi…

GTPase activator activity,Rab GTPase binding

nucleus,early endosome,Golgi apparatus

13

13

13

_ESQLQQEDPMDR_.2|_C[+57]FGMLLSPGR_.2|_DSAQESVITR_….

SEN / CTL

P50583

Bis(5′-nucleosyl)-tetraphosphatase [asymmetrical]

NUDT2

1.6

1.9

0.0258

0.0312

response to reactive oxygen species,nucleobase-con…

bis(5′-nucleosyl)-tetraphosphatase (asymmetrical) …

mitochondrial matrix

14

11

14

_DYDVEIR_.2|_AALQEGHQFLC[+57]SIEA_.2|_AC[+57]GLIIF…

SEN / CTL

Q8WWI5

Choline transporter-like protein 1

SLC44A1

1.58

0.93

0.0188

0.0253

phosphatidylcholine biosynthetic process,choline t…

choline transmembrane transporter activity

nucleoplasm,mitochondrion,mitochondrial outer memb…

15

12

15

_LPVPASAPIPFFHR_.3|_LPVPASAPIPFFHR_.2|_NTKLEAIPNSG…

SEN / CTL

P61313

60S ribosomal protein L15

RPL15

1.57

1.8

0.00437

0.00882

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,cytosol,ribosome,cell-cell adherens juncti…

23

16

23

_SLQSVAEER_.2|_QGYVIYR_.2|_FFEVILIDPFHK_.3|_FFEVIL…

SEN / CTL

Q8TCT8

Signal peptide peptidase-like 2A

SPPL2A

1.56

0.53

0.00284

0.00669

signal peptide processing,membrane protein ectodom…

protein binding,aspartic endopeptidase activity, i…

lysosomal membrane,late endosome,plasma membrane,m…

3

2

3

_AVVVPWGSC[+57]HFLEK_.3|_AVVVPWGSC[+57]HFLEK_.2|_I…

SEN / CTL

Q10713

Mitochondrial-processing peptidase subunit alpha

PMPCA

1.56

0.72

0.00855

0.0144

proteolysis,protein processing involved in protein…

metalloendopeptidase activity,zinc ion binding

extracellular space,mitochondrion,mitochondrial in…

47

29

47

_NYYTPDR_.2|_LPHELC[+57]TLIR_.3|_LPHELC[+57]TLIR_….

SEN / CTL

Q8IWA5

Choline transporter-like protein 2

SLC44A2

1.55

0.32

0.000412

0.00142

phosphatidylcholine biosynthetic process,signal tr…

signal transducer activity,choline transmembrane t…

lysosomal membrane,plasma membrane,integral compon…

7

7

7

_IFDDSPC[+57]PFTAK_.2|_KANGVLEAR_.2|_YLTYLNAR_.2|_…

SEN / CTL

Q15365

Poly(rC)-binding protein 1

PCBP1

1.54

1.92

0.0101

0.0165

mRNA splicing, via spliceosome,gene expression,vir…

RNA polymerase II transcription factor activity, s…

nucleoplasm,cytoplasm,cell-cell adherens junction,…

50

16

50

_INISEGNC[+57]PER_.2|_QIC[+57]LVMLETLSQSPQGR_.3|_Q…

SEN / CTL

P04179

Superoxide dismutase [Mn], mitochondrial

SOD2

1.53

1.6

0.000413

0.00142

response to reactive oxygen species,response to su…

superoxide dismutase activity,manganese ion bindin…

mitochondrion,mitochondrial matrix,extracellular e…

42

23

42

_AIWNVINWENVTER_.2|_AIWNVINWENVTER_.3|_GDVTAQIALQP…

SEN / CTL

P52597

Heterogeneous nuclear ribonucleoprotein F

HNRNPF

1.53

1.04

0.00231

0.00583

mRNA splicing, via spliceosome,RNA processing,fibr…

nucleotide binding,RNA binding,single-stranded RNA…

nucleus,nucleoplasm,cytoplasm,membrane,catalytic s…

46

22

46

_ATENDIYNFFSPLNPVR_.3|_SYSDPPLK_.2|_HSGPNSADSANDGF…

SEN / CTL

P53801

Pituitary tumor-transforming gene 1 protein-interacting protein

PTTG1IP

1.52

0.24

0.000144

0.000564

protein import into nucleus,positive regulation of…

p53 binding,molecular_function,protein binding

nucleus,cytoplasm,membrane,integral component of m…

4

3

4

_YGLFKEENPYAR_.3|_KYGLFKEENPYAR_.3|_AC[+57]LDYPVTS…

SEN / CTL

P20962

Parathymosin

PTMS

1.52

0.72

0.00907

0.0151

immune system process,DNA replication

zinc ion binding

nucleus,cytosol

8

5

8

_SVEAAAELSAK_.2|_AAEEEDEADPKR_.3|_AAEEEDEADPKR_.2|…

SEN / CTL

P38606

V-type proton ATPase catalytic subunit A

ATP6V1A

1.51

2.02

0.0117

0.018

transport,insulin receptor signaling pathway,ATP h…

ATP binding,proton-transporting ATPase activity, r…

mitochondrion,lysosomal membrane,cytosol,plasma me…

91

53

91

_ITWSIIR_.2|_VGSHITGGDIYGIVSENSLIK_.3|_VGSHITGGDIY…

SEN / CTL

Q00839

Heterogeneous nuclear ribonucleoprotein U

HNRNPU

1.51

0.95

0.0234

0.0292

mRNA splicing, via spliceosome,osteoblast differen…

core promoter binding,DNA binding,RNA binding,prot…

nucleus,nucleoplasm,cell surface,membrane,intracel…

129

64

129

_EKPYFPIPEEYTFIQNVPLEDR_.3|_EKPYFPIPEEYTFIQNVPLEDR…

SEN / CTL

P06753

Tropomyosin alpha-3 chain

TPM3

1.5

0.43

0.00147

0.00418

movement of cell or subcellular component,muscle c…

molecular_function,protein binding,structural cons…

stress fiber,cytosol,cytoskeleton,muscle thin fila…

47

31

47

_AADAEAEVASLNRR_.3|_KLVIIEGDLER_.3|_KLVIIEGDLER_.2…

SEN / CTL

P54764

Ephrin type-A receptor 4

EPHA4

1.5

1.15

0.0433

0.0452

cell adhesion,adult walking behavior,motor neuron …

protein kinase activity,GPI-linked ephrin receptor…

cytoplasm,mitochondrial outer membrane,endoplasmic…

1

1

1

_FTVIQLVGMLR_.2

SEN / CTL

O00232

26S proteasome non-ATPase regulatory subunit 12

PSMD12

1.49

0.97

0.00088

0.00268

MAPK cascade,protein polyubiquitination,stimulator…

proteasome complex,nucleoplasm,cytoplasm,cytosol,p…

54

37

54

_LFTTMELMR_.2|_LQEVIETLLSLEK_.2|_LQEVIETLLSLEK_.3|…

SEN / CTL

P68871

Hemoglobin subunit beta

HBB

1.48

2.16

0.0034

0.00754

receptor-mediated endocytosis,blood coagulation,re…

oxygen transporter activity,iron ion binding,prote…

extracellular region,cytosol,hemoglobin complex,ha…

71

30

71

_LLVVYPWTQR_.2|_LLVVYPWTQR_.3|_LHVDPENFR_.2|_VNVDE…

SEN / CTL

P21980

Protein-glutamine gamma-glutamyltransferase 2

TGM2

1.48

1.26

0.0049

0.00953

blood vessel remodeling,isopeptide cross-linking v…

protein-glutamine gamma-glutamyltransferase activi…

mitochondrion,endoplasmic reticulum,cytosol,focal …

73

46

73

_SEGTYC[+57]C[+57]GPVPVR_.2|_SVPLC[+57]ILYEK_.2|_L…

SEN / CTL

P14174

Macrophage migration inhibitory factor

MIF

1.47

1.13

0.000186

0.00071

prostaglandin biosynthetic process,negative regula…

dopachrome isomerase activity,receptor binding,cyt…

extracellular region,extracellular space,nucleopla…

22

10

22

_LLC[+57]GLLAER_.2|_PMFIVNTNVPR_.2|_PMFIVNTNVPR_.3…

SEN / CTL

P04259

Keratin, type II cytoskeletal 6B

KRT6B

1.45

2.2

0.00000953

0.0000484

cytoskeleton organization,ectoderm development

structural constituent of cytoskeleton,protein bin…

keratin filament,extracellular exosome

14

9

14

_SGFSSISVSR_.2|_YEELQITAGR_.2|_YEELQITAGR_.1|_QLDN…

SEN / CTL

Q8IVT5

Kinase suppressor of Ras 1

KSR1

1.44

0.54

0.00397

0.00831

MAPK cascade,protein phosphorylation,Ras protein s…

protein kinase activity,signal transducer activity…

endoplasmic reticulum,endoplasmic reticulum membra…

34

27

34

_FGLGVLESSNPK_.2|_IDDVSSMR_.2|_ISFLPLTR_.2|_WHGEVA…

SEN / CTL

Q9NZM1

Myoferlin

MYOF

1.43

1.28

4.39e-28

1.14e-26

plasma membrane repair,muscle contraction,blood ci…

protein binding,phospholipid binding

nuclear envelope,plasma membrane,caveola,integral …

143

117

143

_GPVGTVSEAQLAR_.2|_VGETIIDLENR_.2|_SIFSPVVK_.2|_AN…

SEN / CTL

Q9UHD1

Cysteine and histidine-rich domain-containing protein 1

CHORDC1

1.42

0.88

0.0224

0.0283

regulation of centrosome duplication,chaperone-med…

protein binding,ATP binding,zinc ion binding,ADP b…

cellular_component

41

23

41

_FQEHIIQAPK_.2|_FQEHIIQAPK_.3|_HNSEKPPEPVKPEVK_.4|…

SEN / CTL

Q9BZQ8

Protein Niban

FAM129A

1.42

1

0.0336

0.038

negative regulation of protein phosphorylation,pos…

molecular_function,protein binding

cytoplasm,plasma membrane,membrane,extracellular e…

36

25

36

_EFPVYLWQPFFR_.2|_EFPVYLWQPFFR_.3|_FPHIDLVVQR_.3|_…

SEN / CTL

P15121

Aldose reductase

AKR1B1

1.41

1.51

0.0164

0.0229

tissue homeostasis,renal water homeostasis,carbohy…

alditol:NADP+ 1-oxidoreductase activity,aldo-keto …

extracellular space,nucleoplasm,cytoplasm,cytosol,…

42

26

42

_VAIDVGYR_.2|_MPILGLGTWK_.2|_M[+16]PILGLGTWK_.2|_L…

SEN / CTL

Q14CN4

Keratin, type II cytoskeletal 72

KRT72

1.39

0.82

0.000111

0.000447

biological_process

molecular_function,structural molecule activity,pr…

keratin filament,extracellular exosome

3

2

3

_FLEQQNQVLETK_.3|_FLEQQNQVLETK_.2|_TAAENEFVVLKK_.3

SEN / CTL

P13010

X-ray repair cross-complementing protein 5

XRCC5

1.36

0.41

0.00183

0.00505

telomere maintenance,double-strand break repair,do…

DNA binding,damaged DNA binding,double-stranded DN…

nuclear telomere cap complex,nuclear chromosome, t…

120

62

120

_HLMLPDFDLLEDIESK_.3|_HLM[+16]LPDFDLLEDIESK_.3|_HL…

SEN / CTL

Q99497

Protein deglycase DJ-1

PARK7

1.36

1.44

0.00257

0.00633

negative regulation of protein phosphorylation,neg…

transcription coactivator activity,mRNA binding,re…

chromatin,nucleus,cytoplasm,mitochondrion,mitochon…

55

27

55

_VTVAGLAGKDPVQC[+57]SR_.3|_VTVAGLAGKDPVQC[+57]SR_….

SEN / CTL

Q96S97

Myeloid-associated differentiation marker

MYADM

1.34

0.3

0.000536

0.00176

negative regulation of protein phosphorylation,neg…

molecular_function

ruffle,plasma membrane,cell-cell junction,integral…

2

1

2

_TTITTTTTSSSGLGSPMIVGSPR_.3|_TTITTTTTSSSGLGSPMIVGS…

SEN / CTL

P07339

Cathepsin D

CTSD

1.34

1.88

0.0156

0.0225

proteolysis,autophagy,antigen processing and prese…

aspartic-type endopeptidase activity,cysteine-type…

extracellular region,extracellular space,lysosome,…

62

30

62

_VSTLPAITLK_.2|_LSPEDYTLK_.2|_FDGILGMAYPR_.2|_FDGI…

SEN / CTL

P09327

Villin-1

VIL1

1.34

0.81

0.0213

0.0274

intestinal D-glucose absorption,protein complex as…

calcium ion binding,protein binding,phosphatidylin…

ruffle,nucleoplasm,cytoplasm,plasma membrane,micro…

70

45

70

_KAAATTAQEYLK_.3|_KAAATTAQEYLK_.2|_EPPHLMSIFK_.3|_…

SEN / CTL

Q15464

SH2 domain-containing adapter protein B

SHB

1.34

0.97

0.0368

0.0399

angiogenesis,negative regulation of protein kinase…

glycoprotein binding,SH3/SH2 adaptor activity,prot…

cytosol,plasma membrane

6

5

6

_C[+57]AASAAEESGAGKK_.3|_HGSPEFC[+57]GILGER_.3|_HG…

SEN / CTL

Q9NQW7

Xaa-Pro aminopeptidase 1

XPNPEP1

1.33

1.58

0.00567

0.0107

proteolysis,bradykinin catabolic process

aminopeptidase activity,manganese ion binding,prot…

cytoplasm,extracellular exosome

49

33

49

_QMDSNWTLMK_.2|_IENVVLVVPVK_.2|_IENVVLVVPVK_.3|_GS…

SEN / CTL

O75955

Flotillin-1

FLOT1

1.32

1.31

0.000232

0.000853

membrane raft assembly,positive regulation of cyto…

protease binding,protein binding,ionotropic glutam…

uropod,lysosomal membrane,endosome,early endosome,…

45

31

45

_VQVQVVER_.2|_ISLNTLTLNVK_.2|_LTGVSISQVNHKPLR_.4|_…

SEN / CTL

P19338

Nucleolin

NCL

1.31

2.35

0.0489

0.049

angiogenesis,positive regulation of transcription …

nucleotide binding,RNA binding,protein binding,pro…

nucleus,nucleoplasm,nucleolus,cell cortex,membrane…

97

63

97

_NDLAVVDVR_.2|_TGISDVFAK_.2|_VTQDELKEVFEDAAEIR_.3|…

SEN / CTL

Q9H4M9

EH domain-containing protein 1

EHD1

1.29

1.53

0.000176

0.000677

intracellular protein transport,endocytosis,blood …

calcium ion binding,protein binding,ATP binding,GT…

lipid particle,plasma membrane,cell-cell adherens …

54

29

54

_LLPLEEHYR_.2|_LNAFGNAFLNR_.2|_KLNAFGNAFLNR_.3|_FM…

SEN / CTL

Q14103

Heterogeneous nuclear ribonucleoprotein D0

HNRNPD

1.28

1.62

0.0114

0.0179

mRNA splicing, via spliceosome,telomere maintenanc…

nucleotide binding,AT DNA binding,chromatin bindin…

nucleus,nucleoplasm,cytosol,intracellular ribonucl…

52

26

52

_GFGFVLFK_.2|_KIFVGGLSPDTPEEK_.3|_KIFVGGLSPDTPEEK_…

SEN / CTL

Q9P0L0

Vesicle-associated membrane protein-associated protein A

VAPA

1.26

0.68

0.0147

0.0214

ER to Golgi vesicle-mediated transport,signal tran…

signal transducer activity,protein binding,microtu…

Golgi membrane,endoplasmic reticulum,endoplasmic r…

29

18

29

_LQGEMMK_.2|_VAHSDKPGSTSTASFR_.4|_VAHSDKPGSTSTASFR…

SEN / CTL

Q9Y625

Glypican-6

GPC6

1.26

1.35

0.0161

0.0228

retinoid metabolic process,glycosaminoglycan biosy…

heparan sulfate proteoglycan binding,coreceptor ac…

proteinaceous extracellular matrix,extracellular s…

3

3

3

_GFSLADIPYQEIAGEHLR_.3|_LEFENLVEETSHFVR_.3|_MFQLIN…

SEN / CTL

P81605

Dermcidin

DCD

1.25

1.49

0.000323

0.00114

proteolysis,killing of cells of other organism,def…

protein binding,peptidase activity,poly(A) RNA bin…

extracellular region,extracellular matrix,extracel…

6

4

6

_LGKDAVEDLESVGK_.3|_LGKDAVEDLESVGK_.2|_GAVHDVKDVLD…

SEN / CTL

P52907

F-actin-capping protein subunit alpha-1

CAPZA1

1.24

0.77

0.0000204

0.0000968

protein complex assembly,movement of cell or subce…

actin binding,protein binding,cadherin binding inv…

extracellular region,cytosol,cytoskeleton,cell-cel…

42

20

42

_LLLNNDNLLR_.2|_LLLNNDNLLR_.3|_KEASDPQPEEADGGLK_.3…

SEN / CTL

P0C0L4

Complement C4-A

C4A

1.24

1.56

0.00809

0.0138

proteolysis,inflammatory response,complement activ…

complement component C1q binding,serine-type endop…

extracellular region,extracellular space,plasma me…

175

104

175

_DSSTWLTAFVLK_.2|_ANSFLGEK_.2|_HLVPGAPFLLQALVR_.3|…

SEN / CTL

P61225

Ras-related protein Rap-2b

RAP2B

1.23

0.59

0.00984

0.0162

signal transduction,platelet activation,negative r…

protein binding,GTP binding,GDP binding,protein do…

cytosol,plasma membrane,bicellular tight junction,…

7

7

7

_ASVDELFAEIVR_.2|_VDLEGEREVSYGEGK_.3|_VPMILVGNKVDL…

SEN / CTL

O00159

Unconventional myosin-Ic

MYO1C

1.22

1.41

7.2e-7

0.00000461

protein targeting,protein targeting to membrane,po…

microfilament motor activity,receptor binding,prot…

nuclear pore,nucleoplasm,nucleolus,cytoplasm,cytos…

97

70

97

_LLSVEGSTLR_.2|_LGTDEISPR_.2|_NPQSYLYLVK_.2|_NPQSY…

SEN / CTL

Q96QK1

Vacuolar protein sorting-associated protein 35

VPS35

1.21

1.57

0.0374

0.0404

intracellular protein transport,positive regulatio…

protein binding,protein transporter activity,D1 do…

lysosomal membrane,endosome,early endosome,late en…

64

41

64

_ILVGTNLVR_.2|_SEDPDQQYLILNTAR_.2|_SEDPDQQYLILNTAR…

SEN / CTL

P01111

GTPase NRas

NRAS

1.2

1.17

0.000631

0.00202

MAPK cascade,stimulatory C-type lectin receptor si…

GTP binding,protein complex binding

Golgi membrane,Golgi apparatus,plasma membrane,mem…

6

6

6

_LVVVGAGGVGK_.2|_SFADINLYR_.2|_QGVEDAFYTLVR_.2|_SA…

SEN / CTL

Q13308

Inactive tyrosine-protein kinase 7

PTK7

1.18

1.56

6.09e-8

4.77e-7

establishment of planar polarity,ventricular septu…

protein kinase activity,protein binding,ATP bindin…

integral component of plasma membrane,cell-cell ju…

35

30

35

_VVLAPQDVVVAR_.2|_SEFGEVFLAK_.2|_SSLQPITTLGK_.2|_Y…

SEN / CTL

O60814


P57053


P58876


P62807


Q5QNW6


Q93079


Q99877


Q99879


Q99880

Histone H2B type 1-K;Histone H2B type F-S;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 2-F;Histone H2B type 1-H;Histone H2B type 1-N;Histone H2B type 1-M;Histone H2B type 1-L

HIST1H2BK


H2BFS


HIST1H2BD


HIST1H2BC


HIST2H2BF


HIST1H2BH


HIST1H2BN


HIST1H2BM


HIST1H2BL

1.18

1

0.00186

0.00505

innate immune response in mucosa,nucleosome assemb…

molecular_function,DNA binding,protein heterodimer…

nuclear nucleosome,extracellular space,nucleus,nuc…

3

2

3

_ESYSVYVYK_.2|_KESYSVYVYK_.3|_KESYSVYVYK_.2

SEN / CTL

P08727

Keratin, type I cytoskeletal 19

KRT19

1.18

2.17

0.0122

0.0186

Notch signaling pathway,viral process,response to …

structural constituent of cytoskeleton,protein bin…

intermediate filament,plasma membrane,dystrophin-a…

87

44

87

_TKFETEQALR_.3|_TKFETEQALR_.2|_LTMQNLNDR_.2|_LTM[+…

SEN / CTL

P17931

Galectin-3

LGALS3

1.16

1.5

0.000216

0.000805

monocyte chemotaxis,mRNA processing,RNA splicing,n…

protein binding,IgE binding,carbohydrate binding,c…

immunological synapse,extracellular space,nucleus,…

19

12

19

_IALDFQR_.2|_MLITILGTVKPNANR_.3|_M[+16]LITILGTVKPN…

SEN / CTL

Q69YQ0

Cytospin-A

SPECC1L

1.16

0.69

0.0201

0.0264

microtubule cytoskeleton organization,cell cycle,c…

cytoplasm,microtubule organizing center,spindle,ga…

33

27

33

_LHDNLIISDLENTVK_.3|_LHDNLIISDLENTVK_.2|_IKPENSSSA…

SEN / CTL

P52565

Rho GDP-dissociation inhibitor 1

ARHGDIA

1.15

0.97

0.00449

0.00892

movement of cell or subcellular component,negative…

Rho GDP-dissociation inhibitor activity,GTPase act…

cytosol,cytoskeleton,extracellular exosome

29

15

29

_AEEYEFLTPVEEAPK_.2|_AEEYEFLTPVEEAPK_.3|_SIQEIQELD…

SEN / CTL

P15144

Aminopeptidase N

ANPEP

1.14

2.1

0.0028

0.00667

angiogenesis,proteolysis,cell differentiation,pept…

virus receptor activity,aminopeptidase activity,re…

extracellular space,lysosomal membrane,endoplasmic…

99

60

99

_ELWILNR_.2|_YLSYTLNPDLIR_.2|_YLSYTLNPDLIR_.3|_QVT…

SEN / CTL

Q6NZI2

Polymerase I and transcript release factor

PTRF

1.12

1.1

0.00142

0.0041

regulation of transcription, DNA-templated,transcr…

protein binding,rRNA primary transcript binding,po…

nucleus,nucleoplasm,cytoplasm,mitochondrion,endopl…

23

15

23

_KLEVNEAELLR_.3|_KLEVNEAELLR_.2|_VMIYQDEVKLPAK_.3|…

SEN / CTL

P62158

Calmodulin

CALM1

1.1

0.97

1e-7

7.18e-7

G2/M transition of mitotic cell cycle,MAPK cascade…

Ras guanyl-nucleotide exchange factor activity,cal…

spindle pole,extracellular region,nucleus,nucleopl…

30

13

30

_VFDKDGNGYISAAELR_.3|_VFDKDGNGYISAAELR_.2|_EAFSLFD…

SEN / CTL

P42785

Lysosomal Pro-X carboxypeptidase

PRCP

1.1

0.52

0.00888

0.0148

regulation of thyroid hormone mediated signaling p…

serine-type carboxypeptidase activity,protein bind…

lysosome,plasma membrane,basal part of cell,extrac…

19

11

19

_NALDPMSVLLAR_.2|_NALDPMSVLLAR_.3|_NALDPM[+16]SVLL…

SEN / CTL

P49368

T-complex protein 1 subunit gamma

CCT3

1.09

1.93

0.00207

0.00538

protein folding,’de novo’ protein folding,binding …

protein binding,ATP binding,protein binding involv…

zona pellucida receptor complex,cytoplasm,cytosol,…

102

49

102

_AVAQALEVIPR_.2|_TAVETAVLLLR_.2|_EILSEVER_.2|_SMIE…

SEN / CTL

P12429

Annexin A3

ANXA3

1.09

1.23

0.00425

0.00866

phagocytosis,positive regulation of endothelial ce…

calcium ion binding,calcium-dependent phospholipid…

cytoplasm,plasma membrane,membrane,axon,dendrite,p…

45

31

45

_SEIDLLDIR_.2|_MLISILTER_.2|_GAGTNEDALIEILTTR_.3|_…

SEN / CTL

Q9NVJ2

ADP-ribosylation factor-like protein 8B

ARL8B

1.08

1.5

0.000286

0.00101

cell cycle,chromosome segregation,small GTPase med…

GTPase activity,protein binding,GTP binding,GDP bi…

cytoplasm,membrane,midbody,late endosome membrane,…

17

10

17

_MNLSAIQDR_.2|_EIC[+57]C[+57]YSISC[+57]K_.2|_DLPNA…

SEN / CTL

Q5K4L6

Long-chain fatty acid transport protein 3

SLC27A3

1.04

0.6

0.018

0.0245

long-chain fatty acid metabolic process

nucleotide binding,long-chain fatty acid-CoA ligas…

membrane,integral component of membrane,mitochondr…

17

14

17

_YLVNQPPSK_.2|_AAHTFLIHGSR_.3|_AAHTFLIHGSR_.2|_LAE…

SEN / CTL

P63096

Guanine nucleotide-binding protein G(i) subunit alpha-1

GNAI1

1.03

0.66

0.0252

0.0307

protein folding,cell cycle,G-protein coupled recep…

magnesium ion binding,G-protein coupled receptor b…

nucleus,cytoplasm,lysosomal membrane,centrosome,he…

9

7

9

_IAQPNYIPTQQDVLR_.2|_IAQPNYIPTQQDVLR_.3|_IIHEAGYSE…

SEN / CTL

P60903

Protein S100-A10

S100A10

1.02

1.18

0.00000258

0.0000149

membrane raft assembly,membrane budding,positive r…

calcium ion binding,protein binding,protein homodi…

extrinsic component of plasma membrane,extracellul…

32

12

32

_EFPGFLENQKDPLAVDK_.3|_EFPGFLENQKDPLAVDK_.2|_FAGDK…

SEN / CTL

P83731

60S ribosomal protein L24

RPL24

1

0.86

0.000455

0.00155

ribosomal large subunit assembly,nuclear-transcrib…

RNA binding,structural constituent of ribosome,pro…

cytoplasm,cytosol,cell-cell adherens junction,memb…

16

10

16

_QINWTVLYR_.2|_VFQFLNAK_.2|_AITGASLADIMAK_.2|_AITG…

SEN / CTL

P60174

Triosephosphate isomerase

TPI1

0.99

1.52

1.96e-14

2.59e-13

gluconeogenesis,glycolytic process,pentose-phospha…

triose-phosphate isomerase activity,protein bindin…

extracellular space,nucleus,cytosol,extracellular …

70

37

70

_IAVAAQNC[+57]YK_.2|_VVLAYEPVWAIGTGK_.2|_VVLAYEPVW…

SEN / CTL

Q9UBI6

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12

GNG12

0.99

1.44

0.00622

0.0112

signal transduction,G-protein coupled receptor sig…

signal transducer activity,protein binding,PDZ dom…

heterotrimeric G-protein complex,actin filament,pl…

10

6

10

_SDPLLIGIPTSENPFK_.2|_SDPLLIGIPTSENPFK_.3|_ASADLMS…

SEN / CTL

O75367


Q9P0M6

Core histone macro-H2A.1;Core histone macro-H2A.2

H2AFY


H2AFY2

0.97

1.08

0.0378

0.0408

negative regulation of transcription from RNA poly…

rDNA binding,RNA polymerase II regulatory region s…

nuclear chromosome,nuclear chromosome, telomeric r…

2

2

2

_AGVIFPVGR_.2|_HILLAVANDEELNQLLK_.3

SEN / CTL

P19013

Keratin, type II cytoskeletal 4

KRT4

0.97

1.64

0.038

0.0409

cytoskeleton organization,epithelial cell differen…

structural molecule activity,protein binding

nucleus,intermediate filament,cell surface,keratin…

28

26

28

_LALDIEIATYR_.2|_FASFIDKVQFLEQQNK_.3|_NLDLDSIIAEVR…

SEN / CTL

P02545

Prelamin-A/C

LMNA

0.96

1.19

0.00000255

0.0000148

mitotic nuclear envelope disassembly,mitotic nucle…

structural molecule activity,protein binding

nucleus,nuclear envelope,lamin filament,nucleoplas…

142

85

142

_ITESEEVVSR_.2|_LAVYIDR_.2|_LAVYIDR_.1|_LQLELSK_.2…

SEN / CTL

P23526

Adenosylhomocysteinase

AHCY

0.94

1.69

0.0047

0.0093

sulfur amino acid metabolic process,response to hy…

adenosylhomocysteinase activity,protein binding,ad…

nucleus,cytoplasm,cytosol,melanosome,neuron projec…

62

34

62

_SKFDNLYGC[+57]R_.3|_SKFDNLYGC[+57]R_.2|_IILLAEGR_…

SEN / CTL

P15822

Zinc finger protein 40

HIVEP1

0.94

0.64

0.0298

0.0351

negative regulation of transcription from RNA poly…

RNA polymerase II distal enhancer sequence-specifi…

nucleus,mitochondrion

58

50

58

_DTQQLAFPSLK_.2|_VGVTGHVPLLER_.3|_KLENFENHKK_.3|_V…

SEN / CTL

Q9NQH7

Probable Xaa-Pro aminopeptidase 3

XPNPEP3

0.94

0.67

0.036

0.0394

glomerular filtration,protein processing

aminopeptidase activity,metallopeptidase activity,…

mitochondrion,extracellular exosome

14

10

14

_AILFVPR_.2|_GVQQLIQR_.2|_YC[+57]PHHVGHYLGMDVHDTPD…

SEN / CTL

P0DMV8


P0DMV9

Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B

HSPA1A


HSPA1B

0.93

1.73

0.000108

0.00044

positive regulation of gene expression,negative re…

virus receptor activity,G-protein coupled receptor…

nucleoplasm,cytoplasm,mitochondrion,centriole,cyto…

132

60

132

_TTPSYVAFTDTER_.2|_TTPSYVAFTDTER_.3|_VEIIANDQGNR_….

SEN / CTL

P18669

Phosphoglycerate mutase 1

PGAM1

0.93

1.6

0.000164

0.000635

gluconeogenesis,glycolytic process,regulation of g…

bisphosphoglycerate mutase activity,phosphoglycera…

cytoplasm,cytosol,membrane,myelin sheath,extracell…

83

38

83

_ALPFWNEEIVPQIK_.2|_ALPFWNEEIVPQIK_.3|_YADLTEDQLPS…

SEN / CTL

P06396

Gelsolin

GSN

0.92

1.46

0.000277

0.00099

phagocytosis, engulfment,positive regulation of ge…

actin binding,calcium ion binding,protein binding,…

podosome,extracellular region,extracellular space,…

102

53

102

_HVVPNEVVVQR_.3|_HVVPNEVVVQR_.2|_AGALNSNDAFVLK_.2|…

SEN / CTL

P20340


Q14964


Q9NRW1

Ras-related protein Rab-6A;Ras-related protein Rab-39A;Ras-related protein Rab-6B

RAB6A


RAB39A


RAB6B

0.92

0.47

0.0299

0.0351

protein targeting to Golgi,retrograde vesicle-medi…

GTPase activity,protein binding,GTP binding,protei…

Golgi membrane,endoplasmic reticulum membrane,Golg…

1

1

1

_LQLWDTAGQER_.2

SEN / CTL

P62805

Histone H4

HIST1H4A

0.91

1.34

5.51e-9

5.09e-8

chromatin silencing at rDNA,double-strand break re…

DNA binding,protein binding,protein domain specifi…

nuclear chromosome,nuclear chromosome, telomeric r…

44

24

44

_DNIQGITKPAIR_.3|_DNIQGITKPAIR_.2|_ISGLIYEETR_.2|_…

SEN / CTL

P47756

F-actin-capping protein subunit beta

CAPZB

0.9

1.32

0.00638

0.0114

movement of cell or subcellular component,cytoskel…

actin binding,actin filament binding,cadherin bind…

cytosol,cytoskeleton,actin filament,cell-cell adhe…

40

22

40

_STLNEIYFGK_.2|_LVEDMENKIR_.3|_QMEKDETVSDC[+57]SPH…

SEN / CTL

Q14195

Dihydropyrimidinase-related protein 3

DPYSL3

0.9

1.13

0.0325

0.0371

positive regulation of neuron projection developme…

protein binding,hydrolase activity, acting on carb…

extracellular space,cytosol,lamellipodium,growth c…

39

27

39

_QIGDNLIVPGGVK_.2|_SAADLISQAR_.2|_IFNLYPR_.2|_QEVQ…

SEN / CTL

O43396

Thioredoxin-like protein 1

TXNL1

0.9

0.64

0.0351

0.0388

glycerol ether metabolic process,cellular response…

thioredoxin-disulfide reductase activity,protein d…

proteasome complex,nucleus,cytoplasm,extracellular…

33

21

33

_IFINLPR_.2|_EDGIVPLR_.2|_IKQHLENDPGSNEDTDIPK_.4|_…

SEN / CTL

P13489

Ribonuclease inhibitor

RNH1

0.89

1.43

0.0114

0.0179

mRNA catabolic process,negative regulation of cata…

protein binding,ribonuclease inhibitor activity

nucleoplasm,cytoplasm,angiogenin-PRI complex,extra…

55

31

55

_LDDC[+57]GLTEAR_.2|_VNPALAELNLR_.2|_VNPALAELNLR_….

SEN / CTL

Q14108

Lysosome membrane protein 2

SCARB2

0.88

1.13

0.00000499

0.0000272

protein targeting to lysosome,positive regulation …

virus receptor activity,protein binding,enzyme bin…

lysosomal membrane,focal adhesion,membrane,integra…

24

15

24

_GETPRVEEVGPYTYR_.3|_KLDDFVETGDIR_.3|_KLDDFVETGDIR…

SEN / CTL

Q9H082

Ras-related protein Rab-33B

RAB33B

0.88

0.42

0.00936

0.0155

protein targeting to Golgi,intra-Golgi vesicle-med…

GTPase activity,protein binding,GTP binding

Golgi membrane,Golgi apparatus,Golgi lumen,extrace…

5

4

5

_IQLWDTAGQER_.2|_IKIQLWDTAGQER_.3|_IKIQLWDTAGQER_….

SEN / CTL

P16401

Histone H1.5

HIST1H1B

0.88

1.91

0.0177

0.0241

negative regulation of transcription from RNA poly…

chromatin DNA binding,histone deacetylase binding,…

nucleosome,nuclear chromatin,nuclear heterochromat…

17

13

17

_ALAAGGYDVEKNNSR_.3|_ALAAGGYDVEK_.2|_KATGPPVSELITK…

SEN / CTL

Q9UEU0

Vesicle transport through interaction with t-SNAREs homolog 1B

VTI1B

0.88

0.56

0.0242

0.0296

protein targeting to vacuole,ER to Golgi vesicle-m…

SNARE binding,SNAP receptor activity,protein bindi…

cytoplasm,lysosomal membrane,endoplasmic reticulum…

7

7

7

_GLHEDLQGVPER_.3|_LLGTAGTEEK_.2|_STPLTATPGGR_.2|_Y…

SEN / CTL

Q06830

Peroxiredoxin-1

PRDX1

0.87

1.21

8.05e-8

5.95e-7

response to reactive oxygen species,skeletal syste…

peroxidase activity,protein binding,thioredoxin pe…

extracellular space,nucleus,cytoplasm,mitochondrio…

60

29

60

_GLFIIDDKGILR_.3|_GLFIIDDKGILR_.2|_DISLSDYK_.2|_QI…

SEN / CTL

P51149

Ras-related protein Rab-7a

RAB7A

0.87

1.37

0.0000423

0.000192

protein targeting to lysosome,endocytosis,epiderma…

GTPase activity,protein binding,GTP binding,GDP bi…

autophagosome membrane,lysosome,lysosomal membrane…

34

23

34

_EAINVEQAFQTIAR_.2|_EAINVEQAFQTIAR_.3|_ATIGADFLTK_…

SEN / CTL

P04908


Q7L7L0


Q93077

Histone H2A type 1-B/E;Histone H2A type 3;Histone H2A type 1-C

HIST1H2AB


HIST3H2A


HIST1H2AC

0.87

1.82

0.00282

0.00668

chromatin silencing,negative regulation of cell pr…

DNA binding,protein heterodimerization activity;DN…

nucleosome,nuclear chromatin,nucleus,extracellular…

11

6

11

_AGLQFPVGR_.2|_VTIAQGGVLPNIQAVLLPK_.2|_VTIAQGGVLPN…

SEN / CTL

P47897

Glutamine–tRNA ligase

QARS

0.87

0.57

0.0266

0.0322

tRNA aminoacylation for protein translation,glutam…

RNA binding,glutamine-tRNA ligase activity,protein…

cytoplasm,mitochondrion,mitochondrial matrix,cytos…

100

58

100

_AMAVLESLR_.2|_AM[+16]AVLESLR_.2|_LEADLEK_.2|_QHLE…

SEN / CTL

P07355

Annexin A2

ANXA2

0.86

1.61

2.23e-17

3.63e-16

angiogenesis,membrane raft assembly,positive regul…

protease binding,calcium ion binding,protein bindi…

ruffle,basement membrane,extracellular space,nucle…

99

49

99

_QDIAFAYQR_.2|_GVDEVTIVNILTNR_.2|_GVDEVTIVNILTNR_….

SEN / CTL

P27105

Erythrocyte band 7 integral membrane protein

STOM

0.86

1.46

5.35e-8

4.26e-7

positive regulation by host of viral genome replic…

protein binding,protein homodimerization activity,…

extracellular space,cytoplasm,mitochondrion,endopl…

38

20

38

_LLAQTTLR_.2|_LPVQLQR_.2|_VQNATLAVANITNADSATR_.3|_…

SEN / CTL

P46940

Ras GTPase-activating-like protein IQGAP1

IQGAP1

0.86

1.56

0.024

0.0295

regulation of cytokine production,signal transduct…

GTPase inhibitor activity,GTPase activator activit…

ruffle,nucleus,cytoplasm,cytosol,microtubule,actin…

200

128

200

_LIVDVIR_.2|_ILAIGLINEALDEGDAQK_.3|_ILAIGLINEALDEG…

SEN / CTL

P17980

26S protease regulatory subunit 6A

PSMC3

0.85

1.48

0.0017

0.00475

MAPK cascade,protein polyubiquitination,blastocyst…

transcription coactivator activity,transcription c…

proteasome complex,cytoplasmic mRNA processing bod…

62

35

62

_MSTEEIIQR_.2|_M[+16]STEEIIQR_.2|_LLDSEIK_.2|_KIEF…

SEN / CTL

P01031

Complement C5

C5

0.85

0.86

0.0118

0.0181

activation of MAPK activity,in utero embryonic dev…

endopeptidase inhibitor activity,receptor binding,…

extracellular region,membrane attack complex,extra…

93

68

93

_VFQFLEK_.2|_VTC[+57]TNAELVK_.2|_TGEAVAEK_.2|_FSYS…

SEN / CTL

P15311

Ezrin

EZR

0.85

1.22

0.0174

0.0238

negative regulation of transcription from RNA poly…

actin binding,protein binding,microtubule binding,…

ruffle,immunological synapse,uropod,extracellular …

90

50

90

_IALLEEAR_.2|_AKFYPEDVAEELIQDITQK_.3|_AKFYPEDVAEEL…

SEN / CTL

Q9NZM3

Intersectin-2

ITSN2

0.84

0.41

0.0101

0.0165

endocytosis,positive regulation of signal transduc…

SH3/SH2 adaptor activity,Rho guanyl-nucleotide exc…

cytoplasm,centrosome,extracellular exosome

29

27

29

_SMSGYLSGFQAR_.2|_NLHLELEALNGK_.3|_SILENTPESHADHSS…

SEN / CTL

O43790


Q14533

Keratin, type II cuticular Hb6;Keratin, type II cuticular Hb1

KRT86


KRT81

0.84

1.91

0.0181

0.0246

;

structural molecule activity,protein binding;struc…

extracellular space,keratin filament,extracellular…

8

8

8

_LGLDIEIATYR_.2|_DVDC[+57]AYLR_.2|_AQYDDIVTR_.2|_A…

SEN / CTL

P04899

Guanine nucleotide-binding protein G(i) subunit alpha-2

GNAI2

0.83

1.35

8.21e-8

5.98e-7

activation of MAPKK activity,adenosine receptor si…

G-protein coupled receptor binding,GTPase activity…

nucleoplasm,cytoplasm,centrosome,cytosol,heterotri…

44

27

44

_IAQSDYIPTQQDVLR_.2|_IAQSDYIPTQQDVLR_.3|_QLFALSC[+…

SEN / CTL

P50995

Annexin A11

ANXA11

0.82

1.53

0.00000108

0.00000675

phagocytosis,cell cycle,cell division,response to …

calcium ion binding,protein binding,calcium-depend…

nuclear envelope,nucleoplasm,cytoplasm,spindle,mem…

45

29

45

_SETDLLDIR_.2|_GVGTDEAC[+57]LIEILASR_.3|_GVGTDEAC[…

SEN / CTL

P09525

Annexin A4

ANXA4

0.82

1.69

0.0000471

0.000209

regulation of transcription from RNA polymerase II…

phospholipase inhibitor activity,calcium ion bindi…

nucleus,cytoplasm,plasma membrane,cell surface,ves…

70

45

70

_FLTVLC[+57]SR_.2|_GLGTDEDAIISVLAYR_.2|_GLGTDEDAII…

SEN / CTL

Q12884

Prolyl endopeptidase FAP

FAP

0.82

0.55

0.0289

0.0342

angiogenesis,proteolysis,cell adhesion,regulation …

protease binding,endopeptidase activity,metalloend…

extracellular space,cytoplasm,plasma membrane,foca…

5

5

5

_GNELPRPIQYLC[+57]WSPVGSK_.3|_LAYVYQNNIYLK_.2|_YYA…

SEN / CTL

Q9Y281

Cofilin-2

CFL2

0.81

1.98

0.0335

0.0379

skeletal muscle tissue development,actin filament …

protein binding,actin filament binding

extracellular space,actin cytoskeleton,nuclear mat…

27

17

27

_YALYDATYETK_.2|_YALYDATYETK_.3|_ESKKEDLVFIFWAPESA…

SEN / CTL

P09619

Platelet-derived growth factor receptor beta

PDGFRB

0.8

1.24

0.000261

0.000954

MAPK cascade,glycosaminoglycan biosynthetic proces…

protein tyrosine kinase activity,platelet activati…

nucleus,cytoplasm,plasma membrane,focal adhesion,c…

19

17

19

_IC[+57]DFGLAR_.2|_YVSELTLVR_.2|_YQQVDEEFLR_.2|_VL…

SEN / CTL

Q16881

Thioredoxin reductase 1, cytoplasmic

TXNRD1

0.79

1.23

0.000547

0.00178

response to reactive oxygen species,response to ox…

thioredoxin-disulfide reductase activity,protein b…

nucleus,mitochondrion,cytosol,extracellular exosom…

59

36

59

_VMVLDFVTPTPLGTR_.2|_VM[+16]VLDFVTPTPLGTR_.2|_VMVL…

SEN / CTL

P08758

Annexin A5

ANXA5

0.78

1.9

6.25e-8

4.83e-7

signal transduction,blood coagulation,response to …

phospholipase inhibitor activity,calcium ion bindi…

intracellular,cytoplasm,focal adhesion,external si…

70

45

70

_VLTEIIASR_.2|_GLGTDEESILTLLTSR_.3|_GLGTDEESILTLLT…

SEN / CTL

P11279

Lysosome-associated membrane glycoprotein 1

LAMP1

0.77

1.75

0.00793

0.0137

granzyme-mediated apoptotic signaling pathway,posi…

virus receptor activity,protein binding,enzyme bin…

cytoplasm,lysosome,lysosomal membrane,late endosom…

13

9

13

_TVESITDIR_.2|_ALQATVGNSYK_.2|_FFLQGIQLNTILPDARDPA…

SEN / CTL

P62491


Q15907

Ras-related protein Rab-11A;Ras-related protein Rab-11B

RAB11A


RAB11B

0.76

1.17

0.0449

0.0462

cytokinesis,renal water homeostasis,mitotic metaph…

GTPase activity,protein binding,GTP binding,microt…

spindle pole,mitochondrion,multivesicular body,Gol…

3

3

3

_AQIWDTAGQER_.2|_VVLIGDSGVGK_.2|_STIGVEFATR_.2

SEN / CTL

P54652

Heat shock-related 70 kDa protein 2

HSPA2

0.75

1.51

0.000535

0.00176

response to unfolded protein,male meiosis,male mei…

protein binding,ATP binding,enzyme binding,unfolde…

synaptonemal complex,male germ cell nucleus,nucleu…

43

31

43

_STAGDTHLGGEDFDNR_.3|_STAGDTHLGGEDFDNR_.2|_ARFEELN…

SEN / CTL

Q9BZZ5

Apoptosis inhibitor 5

API5

0.75

0.28

0.00363

0.00778

apoptotic process,negative regulation of apoptotic…

protein binding,fibroblast growth factor binding,p…

nucleus,nucleoplasm,spliceosomal complex,cytoplasm…

42

33

42

_TLPDEVLTK_.2|_DLFHIPPSYK_.3|_DLFHIPPSYK_.2|_TGEAL…

SEN / CTL

P62873

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

GNB1

0.75

1.12

0.00737

0.013

protein folding,signal transduction,adenylate cycl…

GTPase activity,signal transducer activity,protein…

photoreceptor inner segment,intracellular,lysosoma…

16

10

16

_LFVSGAC[+57]DASAK_.2|_ELAGHTGYLSC[+57]C[+57]R_.3|…

SEN / CTL

Q16555

Dihydropyrimidinase-related protein 2

DPYSL2

0.74

0.89

0.000022

0.000103

response to amphetamine,nucleobase-containing comp…

dihydropyrimidinase activity,protein binding,micro…

mitochondrion,cytosol,dendrite,growth cone,neurona…

74

35

74

_GSPLVVISQGK_.2|_QIGENLIVPGGVK_.2|_VFNLYPR_.2|_GLY…

SEN / CTL

P62942

Peptidyl-prolyl cis-trans isomerase FKBP1A

FKBP1A

0.74

0.41

0.0154

0.0222

protein peptidyl-prolyl isomerization,heart morpho…

peptidyl-prolyl cis-trans isomerase activity,signa…

cytoplasm,endoplasmic reticulum membrane,cytosol,t…

23

8

23

_GVQVETISPGDGR_.2|_GVQVETISPGDGR_.3|_RGQTC[+57]VVH…

SEN / CTL

P0CG39

POTE ankyrin domain family member J

POTEJ

0.73

0.56

0.0436

0.0453

retina homeostasis

extracellular space,extracellular exosome

3

2

3

_LC[+57]YVALDFEQEMAMVASSSSLEK_.3|_LC[+57]YVALDFEQE…

SEN / CTL

P50914

60S ribosomal protein L14

RPL14

0.72

1.06

0.00237

0.0059

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

cytoplasm,cytosol,cell-cell adherens junction,memb…

14

10

14

_LVAIVDVIDQNR_.2|_LVAIVDVIDQNR_.3|_ALVDGPC[+57]TQV…

SEN / CTL

P08134

Rho-related GTP-binding protein RhoC

RHOC

0.72

0.25

0.00297

0.00691

cytokinesis,small GTPase mediated signal transduct…

signal transducer activity,protein binding,GTP bin…

nucleus,cytosol,plasma membrane,cleavage furrow,ex…

7

5

7

_ISAFGYLEC[+57]SAK_.2|_ISAFGYLEC[+57]SAK_.3|_QEPVR…

SEN / CTL

Q14204

Cytoplasmic dynein 1 heavy chain 1

DYNC1H1

0.71

2.56

0.0103

0.0168

G2/M transition of mitotic cell cycle,ER to Golgi …

microtubule motor activity,protein binding,ATP bin…

centrosome,cytosol,cytoplasmic dynein complex,micr…

531

337

531

_ILDDDTIITTLENLKR_.3|_ILDDDTIITTLENLKR_.2|_FGNPLLV…

SEN / CTL

P04792

Heat shock protein beta-1

HSPB1

0.71

1.66

0.0167

0.023

retina homeostasis,regulation of protein phosphory…

protein kinase C binding,protein binding,protein k…

proteasome complex,extracellular space,nucleus,cyt…

44

23

44

_LFDQAFGLPR_.2|_QLSSGVSEIR_.2|_LATQSNEITIPVTFESR_….

SEN / CTL

P61106

Ras-related protein Rab-14

RAB14

0.71

0.96

0.0425

0.0446

Golgi to endosome transport,small GTPase mediated …

GTPase activity,protein binding,GTP binding,GDP bi…

Golgi membrane,intracellular,lysosome,lysosomal me…

36

21

36

_YIIIGDMGVGK_.2|_YIIIGDM[+16]GVGK_.2|_NLTNPNTVIILI…

SEN / CTL

Q96JM7

Lethal(3)malignant brain tumor-like protein 3

L3MBTL3

0.69

0.39

0.0167

0.023

transcription, DNA-templated,regulation of transcr…

molecular_function,protein binding

nucleus

7

7

7

_TLITPPGYPNVK_.2|_RTDANESSSSPEIR_.3|_EHQSFPYNK_.2|…

SEN / CTL

P08133

Annexin A6

ANXA6

0.68

1.5

1.36e-16

2.13e-15

calcium ion transport,regulation of muscle contrac…

calcium ion binding,protein binding,GTP binding,ca…

mitochondrion,lysosomal membrane,focal adhesion,me…

121

72

121

_ALIEILATR_.2|_SEIDLLNIRR_.3|_LVFDEYLK_.2|_C[+57]L…

SEN / CTL

P28799

Granulins

GRN

0.67

1.2

0.0211

0.0272

signal transduction

cytokine activity,protein binding,growth factor ac…

extracellular space,intracellular membrane-bounded…

23

18

23

_SRC[+57]PDGSTC[+57]C[+57]ELPSGK_.3|_QGWAC[+57]C[+…

SEN / CTL

Q9H4G4

Golgi-associated plant pathogenesis-related protein 1

GLIPR2

0.67

0.76

0.0214

0.0274

positive regulation of epithelial cell migration,p…

protein homodimerization activity

Golgi membrane,extracellular exosome

11

9

11

_ASASDGSSFVVAR_.2|_EAQQYSEALASTR_.2|_QFHNEVLK_.2|_…

SEN / CTL

P61019

Ras-related protein Rab-2A

RAB2A

0.66

1.51

0.0239

0.0294

Golgi organization,small GTPase mediated signal tr…

GTPase activity,protein binding,GTP binding,GDP bi…

Golgi membrane,nucleus,lysosomal membrane,endoplas…

32

17

32

_LQIWDTAGQESFR_.2|_LQIWDTAGQESFR_.3|_GAAGALLVYDITR…

SEN / CTL

P60866

40S ribosomal protein S20

RPS20

0.66

1.36

0.043

0.045

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,protein binding…

nucleoplasm,cytoplasm,cytosol,membrane,cytosolic s…

10

5

10

_TPVEPEVAIHR_.3|_TPVEPEVAIHR_.2|_VC[+57]ADLIR_.2|_…

SEN / CTL

P35222

Catenin beta-1

CTNNB1

0.64

1.22

0.00383

0.00811

negative regulation of transcription from RNA poly…

RNA polymerase II transcription factor binding,RNA…

spindle pole,nucleus,nucleoplasm,transcription fac…

61

36

61

_AGDREDITEPAIC[+57]ALR_.3|_LVQLLVR_.2|_LLNDEDQVVVN…

SEN / CTL

P62241

40S ribosomal protein S8

RPS8

0.64

1.36

0.00474

0.00931

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,poly(A) RNA bin…

nucleus,nucleoplasm,cytoplasm,cytosol,focal adhesi…

39

23

39

_ELEFYLR_.2|_LLAC[+57]IASRPGQC[+57]GR_.3|_LLAC[+57…

SEN / CTL

P00338

L-lactate dehydrogenase A chain

LDHA

0.63

1.52

0.000587

0.00189

response to hypoxia,lactate metabolic process,pyru…

L-lactate dehydrogenase activity,protein binding,k…

nucleus,cytosol,cell-cell adherens junction,membra…

92

38

92

_VTLTSEEEAR_.2|_SADTLWGIQK_.2|_LVIITAGAR_.2|_FIIPN…

SEN / CTL

P67936

Tropomyosin alpha-4 chain

TPM4

0.63

1.54

0.00222

0.00569

osteoblast differentiation,movement of cell or sub…

calcium ion binding,protein binding,structural con…

stress fiber,podosome,cytosol,cytoskeleton,muscle …

51

32

51

_IQLVEEELDRAQER_.3|_LATALQKLEEAEKAADESER_.4|_LATAL…

SEN / CTL

P62879

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

GNB2

0.63

1.65

0.0141

0.0208

protein folding,G-protein coupled receptor signali…

GTPase activity,signal transducer activity,calcium…

extracellular space,lysosomal membrane,cytosol,pla…

31

18

31

_ELPGHTGYLSC[+57]C[+57]R_.3|_ELPGHTGYLSC[+57]C[+57…

SEN / CTL

P62937

Peptidyl-prolyl cis-trans isomerase A

PPIA

0.61

1.4

0.000529

0.00176

protein peptidyl-prolyl isomerization,RNA-dependen…

peptidyl-prolyl cis-trans isomerase activity,prote…

extracellular region,extracellular space,nucleus,c…

52

24

52

_VSFELFADKVPK_.3|_VSFELFADKVPK_.2|_VNPTVFFDIAVDGEP…

SEN / CTL

P63000

Ras-related C3 botulinum toxin substrate 1

RAC1

0.61

1.04

0.00068

0.00215

positive regulation of protein phosphorylation,aud…

GTPase activity,protein binding,GTP binding,Rab GT…

Golgi membrane,pericentriolar material,phagocytic …

21

12

21

_TVFDEAIR_.2|_YLEC[+57]SALTQR_.2|_HHC[+57]PNTPIILV…

SEN / CTL

P13929

Beta-enolase

ENO3

0.6

0.61

0.0019

0.00509

gluconeogenesis,aging,response to drug,skeletal mu…

magnesium ion binding,phosphopyruvate hydratase ac…

phosphopyruvate hydratase complex,extracellular sp…

25

17

25

_VNQIGSVTESIQAC[+57]K_.2|_VNQIGSVTESIQAC[+57]K_.3|…

SEN / CTL

P61981

14-3-3 protein gamma

YWHAG

0.6

1.17

0.0342

0.0383

G2/M transition of mitotic cell cycle,negative reg…

protein kinase C binding,insulin-like growth facto…

mitochondrion,cytosol,focal adhesion,membrane,cyto…

36

21

36

_NVTELNEPLSNEER_.2|_NVTELNEPLSNEER_.3|_YLAEVATGEKR…

SEN / CTL

P18206

Vinculin

VCL

0.57

1.41

0.00000599

0.000031

morphogenesis of an epithelium,platelet degranulat…

dystroglycan binding,actin binding,structural mole…

podosome,extracellular region,cytosol,cytoskeleton…

192

102

192

_ELTPQVVSAAR_.2|_ALASQLQDSLK_.2|_SLGEISALTSK_.2|_I…

SEN / CTL

P06733

Alpha-enolase

ENO1

0.55

1.24

0.00000506

0.0000273

gluconeogenesis,transcription, DNA-templated,respo…

magnesium ion binding,DNA binding,phosphopyruvate …

phosphopyruvate hydratase complex,extracellular sp…

115

54

115

_AAVPSGASTGIYEALELR_.3|_AAVPSGASTGIYEALELR_.2|_VNQ…

SEN / CTL

P31939

Bifunctional purine biosynthesis protein PURH

ATIC

0.55

0.41

0.0405

0.0428

brainstem development,nucleobase-containing compou…

IMP cyclohydrolase activity,phosphoribosylaminoimi…

mitochondrion,cytosol,cell-cell adherens junction,…

87

53

87

_LDFNLIR_.2|_DTSLETR_.2|_GVSQMPLR_.2|_GVSQM[+16]PL…

SEN / CTL

O60825

6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2

PFKFB2

0.54

0.35

0.0267

0.0322

fructose metabolic process,fructose 2,6-bisphospha…

6-phosphofructo-2-kinase activity,fructose-2,6-bis…

cytosol

63

46

63

_DMILNFAEQNSFK_.2|_DM[+16]ILNFAEQNSFK_.2|_HGESEFNL…

SEN / CTL

P04083

Annexin A1

ANXA1

0.52

1.48

0.0000149

0.0000734

DNA strand renaturation,neutrophil homeostasis,ada…

single-stranded DNA binding,single-stranded RNA bi…

cornified envelope,phagocytic cup,extracellular re…

69

38

69

_NALLSLAK_.2|_TPAQFDADELR_.2|_GLGTDEDTLIEILASR_.3|…

SEN / CTL

P61586

Transforming protein RhoA

RHOA

0.51

1.21

0.0116

0.018

transforming growth factor beta receptor signaling…

GTPase activity,protein binding,GTP binding,myosin…

endosome,endoplasmic reticulum membrane,cytosol,cy…

30

17

30

_HFC[+57]PNVPIILVGNKK_.4|_HFC[+57]PNVPIILVGNKK_.3|…

SEN / CTL

P08670

Vimentin

VIM

0.49

1.4

0.00000661

0.0000339

movement of cell or subcellular component,positive…

glycoprotein binding,double-stranded RNA binding,s…

cytoplasm,peroxisome,cytosol,cytoskeleton,intermed…

188

93

188

_EYQDLLNVK_.2|_ILLAELEQLK_.2|_ILLAELEQLKGQGK_.3|_I…

SEN / CTL

P61224

Ras-related protein Rap-1b

RAP1B

0.49

1.26

0.019

0.0254

Rap protein signal transduction,establishment of e…

GTPase activity,protein binding,GTP binding,GDP bi…

intracellular,lipid particle,cytosol,plasma membra…

32

18

32

_LVVLGSGGVGK_.2|_INVNEIFYDLVR_.2|_INVNEIFYDLVR_.3|…

SEN / CTL

P35579

Myosin-9

MYH9

0.43

1.86

0.0000104

0.0000522

meiotic spindle organization,cytokinesis,angiogene…

microfilament motor activity,motor activity,actin …

stress fiber,ruffle,uropod,nucleus,cytoplasm,spind…

487

247

487

_VVFQEFR_.2|_ALELDSNLYR_.2|_QLLQANPILEAFGNAK_.2|_Q…

SEN / CTL

P68104


Q5VTE0

Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3

EEF1A1


EEF1A1P5

0.42

1.71

0.0184

0.0248

transcription, DNA-templated,regulation of transcr…

tRNA binding,translation elongation factor activit…

extracellular space,nucleus,nucleolus,cytoplasm,cy…

24

16

24

_IGGIGTVPVGR_.2|_QTVAVGVIK_.2|_EHALLAYTLGVK_.3|_EH…

SEN / CTL

P68032

Actin, alpha cardiac muscle 1

ACTC1

0.3

1.77

0.0206

0.0268

apoptotic process,positive regulation of gene expr…

ATP binding,ATPase activity,myosin binding

extracellular space,cytoplasm,cytosol,actin filame…

48

27

48

_SYELPDGQVITIGNER_.2|_SYELPDGQVITIGNER_.3|_AGFAGDD…

SEN / CTL

Q09666

Neuroblast differentiation-associated protein AHNAK

AHNAK

0.28

1.54

0.00154

0.00437

regulation of RNA splicing,protein oligomerization…

protein binding,S100 protein binding,poly(A) RNA b…

nucleus,cytoplasm,lysosomal membrane,cytosol,plasm…

666

433

666

_LPTGQISGPEIK_.2|_ISMPEVDLNLKGPK_.3|_LNVGAPDVTLR_….

SEN / CTL

P21333

Filamin-A

FLNA

0.22

1.55

0.00604

0.011

platelet degranulation,adenylate cyclase-inhibitin…

G-protein coupled receptor binding,glycoprotein bi…

extracellular region,nucleus,nucleolus,cytoplasm,c…

388

207

388

_AWGPGLEGGVVGK_.2|_VHGPGIQSGTTNKPNKFTVETR_.5|_VHGP…

SEN / CTL

P68371

Tubulin beta-4B chain

TUBB4B

-0.2

1.39

0.0464

0.0473

G2/M transition of mitotic cell cycle,movement of …

double-stranded RNA binding,GTPase activity,struct…

nucleus,cytosol,cytoskeleton,microtubule,extracell…

123

42

123

_YLTVAAVFR_.2|_NSSYFVEWIPNNVK_.2|_NSSYFVEWIPNNVK_….

SEN / CTL

P11021

78 kDa glucose-regulated protein

HSPA5

-0.24

1.51

0.0401

0.0426

ER overload response,activation of signaling prote…

glycoprotein binding,calcium ion binding,protein b…

nucleus,mitochondrion,endoplasmic reticulum,endopl…

133

68

133

_LTPEEIER_.2|_ITPSYVAFTPEGER_.2|_ITPSYVAFTPEGER_.3…

SEN / CTL

P60709


P63261

Actin, cytoplasmic 1;Actin, cytoplasmic 2

ACTB


ACTG1

-0.26

1.5

0.0401

0.0426

retina homeostasis,movement of cell or subcellular…

structural constituent of cytoskeleton,protein bin…

nuclear chromatin,extracellular space,nucleoplasm,…

37

13

37

_GYSFTTTAER_.2|_VAPEEHPVLLTEAPLNPK_.3|_VAPEEHPVLLT…

SEN / CTL

P06744

Glucose-6-phosphate isomerase

GPI

-0.39

1.56

0.0344

0.0384

angiogenesis,in utero embryonic development,mesode…

glucose-6-phosphate isomerase activity,cytokine ac…

extracellular space,nucleoplasm,cytoplasm,cytosol,…

107

49

107

_TLAQLNPESSLFIIASK_.2|_TLAQLNPESSLFIIASK_.3|_ILLAN…

SEN / CTL

O00560

Syntenin-1

SDCBP

-0.4

1.44

0.0106

0.0173

negative regulation of receptor internalization,pr…

frizzled binding,interleukin-5 receptor binding,pr…

extracellular space,nucleus,cytoplasm,endoplasmic …

25

13

25

_DSTGHVGFIFK_.3|_DSTGHVGFIFK_.2|_SLMDHTIPEV_.2|_AN…

SEN / CTL

P01892

HLA class I histocompatibility antigen, A-2 alpha chain

HLA-A

-0.49

1.6

0.0396

0.0422

37

22

37

_WAAVVVPSGQEQR_.2|_MYGC[+57]DVGSDWR_.2|_AYLEGTC[+5…

SEN / CTL

P07237

Protein disulfide-isomerase

P4HB

-0.52

1.91

0.00196

0.0052

response to reactive oxygen species,peptidyl-proli…

protein disulfide isomerase activity,integrin bind…

extracellular region,endoplasmic reticulum,endopla…

113

62

113

_EADDIVNWLK_.2|_ILEFFGLK_.2|_THILLFLPK_.2|_VDATEES…

SEN / CTL

P08648

Integrin alpha-5

ITGA5

-0.59

1.33

0.00312

0.00711

angiogenesis,cell-substrate junction assembly,cell…

virus receptor activity,epidermal growth factor re…

ruffle,endoplasmic reticulum,Golgi apparatus,plasm…

32

23

32

_VTAPPEAEYSGLVR_.2|_SLQWFGATVR_.2|_ILEYAPC[+57]R_….

SEN / CTL

P56199

Integrin alpha-1

ITGA1

-0.6

1.5

0.0358

0.0393

activation of MAPK activity,muscle contraction,cel…

receptor binding,protein binding,collagen binding,…

acrosomal vesicle,plasma membrane,focal adhesion,i…

15

13

15

_ASQIIIPR_.2|_FGTAIAAVK_.2|_VIQDC[+57]EDENIQR_.2|_…

SEN / CTL

P28070

Proteasome subunit beta type-4

PSMB4

-0.62

1.79

0.0482

0.0484

MAPK cascade,protein polyubiquitination,stimulator…

lipopolysaccharide binding,threonine-type endopept…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

21

10

21

_FQIATVTEK_.2|_EVLEKQPVLSQTEAR_.3|_EVLEKQPVLSQTEAR…

SEN / CTL

O43707

Alpha-actinin-4

ACTN4

-0.64

1.31

0.00000318

0.0000177

response to hypoxia,platelet degranulation,protein…

RNA polymerase II regulatory region sequence-speci…

stress fiber,extracellular region,extracellular sp…

147

75

147

_ETTDTDTADQVIASFK_.2|_ETTDTDTADQVIASFK_.3|_DGLAFNA…

SEN / CTL

P36955

Pigment epithelium-derived factor

SERPINF1

-0.67

1.08

0.00489

0.00953

kidney development,multicellular organism developm…

serine-type endopeptidase inhibitor activity,prote…

extracellular region,basement membrane,extracellul…

26

20

26

_DTDTGALLFIGK_.2|_LAAAVSNFGYDLYR_.2|_LAAAVSNFGYDLY…

SEN / CTL

Q00610

Clathrin heavy chain 1

CLTC

-0.68

1.59

6.78e-13

8.55e-12

osteoblast differentiation,intracellular protein t…

double-stranded RNA binding,structural molecule ac…

spindle,cytosol,plasma membrane,focal adhesion,mem…

302

154

302

_LLLPWLEAR_.2|_IAAYLFK_.2|_C[+57]NEPAVWSQLAK_.2|_N…

SEN / CTL

P12814

Alpha-actinin-1

ACTN1

-0.7

1.54

5.81e-12

6.68e-11

platelet degranulation,actin filament organization…

double-stranded RNA binding,integrin binding,calci…

stress fiber,ruffle,extracellular region,extracell…

202

94

202

_VGWEQLLTTIAR_.2|_VGWEQLLTTIAR_.3|_EGLLLWC[+57]QR_…

SEN / CTL

P30101

Protein disulfide-isomerase A3

PDIA3

-0.7

1.36

6.35e-9

5.66e-8

antigen processing and presentation of peptide ant…

protein disulfide isomerase activity,cysteine-type…

nucleus,endoplasmic reticulum,endoplasmic reticulu…

120

62

120

_LAPEYEAAATR_.2|_YGVSGYPTLK_.2|_ELSDFISYLQR_.2|_EL…

SEN / CTL

Q15063

Periostin

POSTN

-0.73

2.29

0.0388

0.0416

skeletal system development,response to hypoxia,ne…

protein binding,heparin binding,metal ion binding,…

proteinaceous extracellular matrix,extracellular s…

80

48

80

_GFEPGVTNILK_.2|_AAAITSDILEALGR_.2|_IIDGVPVEITEKET…

SEN / CTL

P04216

Thy-1 membrane glycoprotein

THY1

-0.75

1.44

0.00829

0.0141

angiogenesis,negative regulation of protein kinase…

GTPase activator activity,integrin binding,protein…

endoplasmic reticulum,cytosol,plasma membrane,inte…

7

4

7

_VTSLTAC[+57]LVDQSLR_.2|_VTSLTAC[+57]LVDQSLR_.3|_V…

SEN / CTL

Q6NUM9

All-trans-retinol 13,14-reductase

RETSAT

-0.76

0.39

0.0124

0.0188

retinol metabolic process,oxidation-reduction proc…

oxidoreductase activity,all-trans-retinol 13,14-re…

nuclear outer membrane,endoplasmic reticulum membr…

12

11

12

_ATVQSVLLDSAGK_.2|_RVLVLEQHTK_.3|_GAC[+57]YGADHDLG…

SEN / CTL

P21589

5′-nucleotidase

NT5E

-0.77

1.6

6.65e-7

0.00000436

purine nucleotide catabolic process,AMP catabolic …

nucleotide binding,5′-nucleotidase activity,metal …

cytoplasm,plasma membrane,cell surface,membrane,an…

42

28

42

_TIVYLDGSSQSC[+57]R_.2|_VLPVGDEVVGIVGYTSK_.3|_VLPV…

SEN / CTL

P05387

60S acidic ribosomal protein P2

RPLP2

-0.77

1.14

0.0206

0.0268

nuclear-transcribed mRNA catabolic process, nonsen…

structural constituent of ribosome,protein binding…

cytosol,focal adhesion,membrane,cytosolic large ri…

30

13

30

_YVASYLLAALGGNSSPSAK_.3|_YVASYLLAALGGNSSPSAK_.2|_Y…

SEN / CTL

Q3ZCM7

Tubulin beta-8 chain

TUBB8

-0.78

1.52

0.0335

0.0379

oocyte maturation,spindle assembly involved in fem…

molecular_function,GTPase activity,structural cons…

cytoplasm,microtubule,extracellular exosome,meioti…

13

4

13

_LPTPTYGDLNHLVSATMSGVTTC[+57]LR_.3|_EAESC[+57]DC[+…

SEN / CTL

Q16851

UTP–glucose-1-phosphate uridylyltransferase

UGP2

-0.8

1.93

0.0499

0.0499

glycogen metabolic process,glycogen biosynthetic p…

UTP:glucose-1-phosphate uridylyltransferase activi…

nucleus,cytoplasm,cytosol,extracellular exosome

59

37

59

_LVEIAQVPK_.2|_GLPDNISSVLNK_.2|_EFPTVPLVK_.2|_SFEN…

SEN / CTL

P15529

Membrane cofactor protein

CD46

-0.83

0.57

0.0316

0.0364

adaptive immune response,T cell mediated immunity,…

virus receptor activity,complement binding,endopep…

inner acrosomal membrane,Golgi apparatus,plasma me…

6

5

6

_GSVAIWSGKPPIC[+57]EK_.3|_GSVAIWSGKPPIC[+57]EK_.2|…

SEN / CTL

Q9UNM6

26S proteasome non-ATPase regulatory subunit 13

PSMD13

-0.84

0.65

0.0446

0.046

MAPK cascade,protein polyubiquitination,stimulator…

structural molecule activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

52

35

52

_VLDLQQIK_.2|_GSIDEVDK_.2|_LEELYTK_.2|_VKSSDEAVILC…

SEN / CTL

P04075

Fructose-bisphosphate aldolase A

ALDOA

-0.85

1.32

7.5e-13

9.24e-12

platelet degranulation,fructose metabolic process,…

actin binding,fructose-bisphosphate aldolase activ…

extracellular region,extracellular space,nucleus,c…

110

51

110

_ALANSLAC[+57]QGK_.2|_ADDGRPFPQVIK_.3|_ADDGRPFPQVI…

SEN / CTL

Q9Y230

RuvB-like 2

RUVBL2

-0.88

0.5

0.0169

0.0232

box C/D snoRNP assembly,DNA repair,DNA recombinati…

RNA polymerase II core promoter sequence-specific …

Swr1 complex,intracellular,nucleus,nucleoplasm,nuc…

67

42

67

_IGLETSLR_.2|_RAAGVVLEMIR_.3|_RAAGVVLEMIR_.2|_MIES…

SEN / CTL

Q07954

Prolow-density lipoprotein receptor-related protein 1

LRP1

-0.89

1.59

1.65e-9

1.61e-8

retinoid metabolic process,receptor-mediated endoc…

protease binding,receptor activity,low-density lip…

nucleolus,cytoplasm,lysosomal membrane,endosome,pl…

72

65

72

_GVGGAPPTVTLLR_.2|_LDGLC[+57]IPLR_.2|_SERPPIFEIR_….

SEN / CTL

O14818

Proteasome subunit alpha type-7

PSMA7

-0.9

1.72

0.0000219

0.000103

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

28

16

28

_ALLEVVQSGGK_.2|_LTVEDPVTVEYITR_.2|_LTVEDPVTVEYITR…

SEN / CTL

P51884

Lumican

LUM

-0.91

2.02

0.00408

0.00839

visual perception,response to organic cyclic compo…

extracellular matrix structural constituent,protei…

extracellular region,proteinaceous extracellular m…

29

21

29

_SVPMVPPGIK_.2|_ILGPLSYSK_.2|_SLEYLDLSFNQIAR_.2|_S…

SEN / CTL

P04004

Vitronectin

VTN

-0.93

1.31

0.0159

0.0226

receptor-mediated endocytosis,immune response,cell…

scavenger receptor activity,integrin binding,prote…

extracellular region,basement membrane,extracellul…

33

22

33

_DVWGIEGPIDAAFTR_.2|_DVWGIEGPIDAAFTR_.3|_LIRDVWGIE…

SEN / CTL

P20618

Proteasome subunit beta type-1

PSMB1

-0.94

1.26

3.1e-8

2.63e-7

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytosol,pro…

37

17

37

_LSEGFSIHTR_.2|_AGGSASAMLQPLLDNQVGFK_.2|_AGGSASAML…

SEN / CTL

P98160

Basement membrane-specific heparan sulfate proteoglycan core protein

HSPG2

-0.96

1.66

9.1e-19

1.68e-17

retinoid metabolic process,angiogenesis,glycosamin…

calcium ion binding,protein binding,protein C-term…

extracellular region,basement membrane,extracellul…

239

163

239

_AGLSSGFIGC[+57]VR_.2|_LEGDTLIIPR_.2|_LPAVEPTDQAQY…

SEN / CTL

Q14764

Major vault protein

MVP

-0.98

1.65

7.79e-15

1.06e-13

protein transport,negative regulation of signaling…

protein binding,protein kinase binding,protein pho…

nucleus,nuclear pore,cytoplasm,cytoskeleton,membra…

128

78

128

_VLFAPMR_.2|_LFSVPDFVGDAC[+57]K_.2|_ELELVYAR_.2|_G…

SEN / CTL

Q06210

Glutamine–fructose-6-phosphate aminotransferase [isomerizing] 1

GFPT1

-0.98

1.02

0.0142

0.0209

carbohydrate metabolic process,fructose 6-phosphat…

glutamine-fructose-6-phosphate transaminase (isome…

cytosol,extracellular exosome

75

44

75

_EILETLIK_.2|_VIFLEDDDVAAVVDGR_.2|_VIFLEDDDVAAVVDG…

SEN / CTL

P27797

Calreticulin

CALR

-0.99

1.95

0.000064

0.000276

negative regulation of transcription from RNA poly…

complement component C1q binding,glycoprotein bind…

acrosomal vesicle,extracellular region,proteinaceo…

95

52

95

_EQFLDGDGWTSR_.2|_IKDPDASKPEDWDER_.4|_IKDPDASKPEDW…

SEN / CTL

Q9P265

Disco-interacting protein 2 homolog B

DIP2B

-0.99

0.78

0.0461

0.047

biological_process,metabolic process

molecular_function,catalytic activity

nucleus,cytoplasm,membrane,extracellular exosome

56

45

56

_EGSVMGVTVSR_.2|_TPLGGIHISQTK_.3|_TC[+57]VVVAEERPR…

SEN / CTL

P24821

Tenascin

TNC

-1

1.3

3.49e-12

4.1e-11

osteoblast differentiation,cell adhesion,negative …

syndecan binding

extracellular region,basement membrane,interstitia…

105

77

105

_VSIYGVIR_.2|_AVDIPGLK_.2|_FTTDLDSPR_.2|_GLEPGQEYN…

SEN / CTL

Q14697

Neutral alpha-glucosidase AB

GANAB

-1

1.61

0.00184

0.00505

carbohydrate metabolic process,protein folding

carbohydrate binding,glucan 1,3-alpha-glucosidase …

endoplasmic reticulum lumen,Golgi apparatus,membra…

141

70

141

_VVIIGAGKPAAVVLQTK_.3|_VVIIGAGKPAAVVLQTK_.2|_LSFQH…

SEN / CTL

P25788

Proteasome subunit alpha type-3

PSMA3

-1.01

1.24

0.00000194

0.0000114

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytoplasm,c…

25

15

25

_AVENSSTAIGIR_.2|_LFNVDRHVGMAVAGLLADAR_.4|_SLADIAR…

SEN / CTL

P26006

Integrin alpha-3

ITGA3

-1.01

1.62

0.000775

0.00241

neuron migration,cell-matrix adhesion,integrin-med…

glycoprotein binding,fibronectin binding,protease …

plasma membrane,focal adhesion,integrin complex,ex…

39

26

39

_YLLLAGAPR_.2|_SETVLTC[+57]ATGR_.2|_EAGNPGSLFGYSVA…

SEN / CTL

Q13443

Disintegrin and metalloproteinase domain-containing protein 9

ADAM9

-1.01

1.16

0.0225

0.0283

activation of MAPKK activity,membrane protein ecto…

metalloendopeptidase activity,protein kinase C bin…

extracellular space,focal adhesion,cell surface,in…

24

22

24

_FLPGGTLC[+57]R_.2|_LQC[+57]ENVQEIPVFGIVPAIIQTPSR_…

SEN / CTL

O14948

Transcription factor EC

TFEC

-1.02

0.81

0.0473

0.048

transcription, DNA-templated,regulation of transcr…

DNA binding,transcription factor activity, sequenc…

nucleoplasm,cytoplasm

1

1

1

_THGLPTLASLGTVDLGAHVTK_.3

SEN / CTL

P42892

Endothelin-converting enzyme 1

ECE1

-1.03

1.12

0.00312

0.00711

positive regulation of receptor recycling,regulati…

endopeptidase activity,metalloendopeptidase activi…

lysosomal membrane,endosome,external side of plasm…

34

21

34

_TPESSHEGLITDPHSPSR_.4|_TPESSHEGLITDPHSPSR_.3|_DNF…

SEN / CTL

P53396

ATP-citrate synthase

ACLY

-1.04

2.34

0.000263

0.000954

acetyl-CoA biosynthetic process,citrate metabolic …

ATP citrate synthase activity,protein binding,ATP …

nucleoplasm,cytoplasm,cytosol,plasma membrane,citr…

146

85

146

_EILIPVFK_.2|_TIAIIAEGIPEALTR_.2|_TIAIIAEGIPEALTR_…

SEN / CTL

Q99685

Monoglyceride lipase

MGLL

-1.04

0.81

0.0455

0.0466

lipid metabolic process,fatty acid biosynthetic pr…

lysophospholipase activity,protein homodimerizatio…

nucleoplasm,endoplasmic reticulum membrane,cytosol…

28

16

28

_MVVSDFHVFVR_.2|_MVVSDFHVFVR_.3|_M[+16]VVSDFHVFVR_…

SEN / CTL

P28074

Proteasome subunit beta type-5

PSMB5

-1.06

2.02

0.00014

0.000555

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,centrosome,…

28

17

28

_DAYSGGAVNLYHVR_.3|_DAYSGGAVNLYHVR_.2|_ATAGAYIASQT…

SEN / CTL

O43852

Calumenin

CALU

-1.06

1.64

0.000193

0.000727

biological_process

calcium ion binding,protein binding

extracellular region,endoplasmic reticulum,endopla…

62

34

62

_EQFVEFR_.2|_WIYEDVER_.2|_TFDQLTPEESKER_.3|_IDGDKD…

SEN / CTL

P35556

Fibrillin-2

FBN2

-1.06

0.58

0.0149

0.0217

extracellular matrix disassembly,extracellular mat…

extracellular matrix structural constituent,calciu…

microfibril,extracellular region,extracellular mat…

5

5

5

_C[+57]WGIGTIPEAC[+57]PVR_.2|_RPDGEGC[+57]VDENEC[+…

SEN / CTL

P20700

Lamin-B1

LMNB1

-1.06

1.21

0.0311

0.0362

structural molecule activity,protein binding,phosp…

nuclear envelope,nuclear inner membrane,lamin fila…

98

60

98

_LLEGEEERLK_.3|_LQIELGK_.2|_KESDLNGAQIK_.3|_KESDLN…

SEN / CTL

P49720

Proteasome subunit beta type-3

PSMB3

-1.07

1.78

0.00274

0.00662

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytoplasm,m…

31

13

31

_FGPYYTEPVIAGLDPK_.3|_FGPYYTEPVIAGLDPK_.2|_LYIGLAG…

SEN / CTL

Q8IVF2

Protein AHNAK2

AHNAK2

-1.07

0.54

0.0115

0.018

plasma membrane repair

protein binding

nucleus,cytoplasm,plasma membrane,Z disc,T-tubule,…

76

70

76

_VEADVSLPSMQGDLK_.2|_SIEASVHVSAPK_.3|_LPEGHVPEGAGL…

SEN / CTL

P39060

Collagen alpha-1(XVIII) chain

COL18A1

-1.07

1.82

0.0167

0.023

angiogenesis,endothelial cell morphogenesis,cell a…

structural molecule activity,metal ion binding

extracellular region,collagen trimer,basement memb…

46

31

46

_IFSFDGKDVLR_.3|_LQDLYSIVR_.2|_TEAPSATGQASSLLGGR_….

SEN / CTL

P21810

Biglycan

BGN

-1.09

1.57

0.00595

0.0109

blood vessel remodeling,negative regulation of pro…

protein kinase inhibitor activity,extracellular ma…

extracellular region,proteinaceous extracellular m…

37

23

37

_VVQC[+57]SDLGLK_.2|_IQAIELEDLLR_.2|_LAIQFGNYK_.2|…

SEN / CTL

P41221

Protein Wnt-5a

WNT5A

-1.11

0.33

0.00168

0.00471

activation of MAPK activity,establishment of plana…

transcription factor activity, sequence-specific D…

extracellular region,proteinaceous extracellular m…

2

2

2

_TC[+57]WLQLADFR_.2|_EGELSTC[+57]GC[+57]SR_.2

SEN / CTL

Q99584

Protein S100-A13

S100A13

-1.11

0.55

0.0107

0.0173

positive regulation of cell proliferation,regulati…

copper ion binding,calcium ion binding,protein bin…

extracellular space,nucleus,cytoplasm,cytosol,mast…

13

9

13

_ELVTQQLPHLLK_.3|_ELVTQQLPHLLK_.2|_DVGSLDEK_.2|_KD…

SEN / CTL

P59998

Actin-related protein 2/3 complex subunit 4

ARPC4

-1.13

1.3

0.0222

0.0283

actin filament polymerization,Arp2/3 complex-media…

structural constituent of cytoskeleton,protein bin…

cytosol,Arp2/3 protein complex,cell projection,ext…

18

12

18

_IVAEEFLK_.2|_AENFFILR_.2|_ELLLQPVTISR_.3|_ELLLQPV…

SEN / CTL

Q96AY3

Peptidyl-prolyl cis-trans isomerase FKBP10

FKBP10

-1.15

1.42

0.00012

0.000479

protein peptidyl-prolyl isomerization,chaperone-me…

peptidyl-prolyl cis-trans isomerase activity,calci…

endoplasmic reticulum lumen,endoplasmic reticulum …

53

34

53

_EVQMGDFVR_.2|_EVQM[+16]GDFVR_.2|_IIIPPFLAYGEK_.2|…

SEN / CTL

P01033

Metalloproteinase inhibitor 1

TIMP1

-1.15

1.92

0.00267

0.00651

cell activation,platelet degranulation,aging,posit…

protease binding,cytokine activity,protein binding…

extracellular region,proteinaceous extracellular m…

11

7

11

_EPGLC[+57]TWQSLR_.2|_GFQALGDAADIR_.2|_LQDGLLHITTC…

SEN / CTL

Q99436

Proteasome subunit beta type-7

PSMB7

-1.15

1.64

0.00529

0.0101

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytoplasm,c…

33

16

33

_ITPLEIEVLEETVQTMDTS_.3|_ITPLEIEVLEETVQTM[+16]DTS_…

SEN / CTL

P15151

Poliovirus receptor

PVR

-1.16

0.79

0.0307

0.0359

positive regulation of natural killer cell mediate…

virus receptor activity,receptor activity,receptor…

extracellular space,cytoplasm,plasma membrane,inte…

6

5

6

_VQLTGEPVPMAR_.2|_VLAKPQNTAEVQK_.3|_RLEFVAAR_.2|_H…

SEN / CTL

P11166

Solute carrier family 2, facilitated glucose transporter member 1

SLC2A1

-1.19

1.43

0.00606

0.011

lactose biosynthetic process,protein complex assem…

glucose transmembrane transporter activity,protein…

Golgi membrane,female pronucleus,cytosol,plasma me…

17

10

17

_TFDEIASGFR_.2|_VTILELFR_.2|_LRGTADVTHDLQEMKEESR_….

SEN / CTL

P17301

Integrin alpha-2

ITGA2

-1.2

1.42

1.7e-11

1.87e-10

response to hypoxia,positive regulation of leukocy…

virus receptor activity,integrin binding,protein b…

nucleus,plasma membrane,focal adhesion,integrin co…

31

27

31

_VVFNLNTYK_.2|_ILGSDGAFR_.2|_FGIAVLGYLNR_.2|_FVQGL…

SEN / CTL

P00734

Prothrombin

F2

-1.2

1.71

0.0000748

0.000315

positive regulation of protein phosphorylation,sig…

serine-type endopeptidase activity,receptor bindin…

extracellular region,extracellular space,endoplasm…

86

42

86

_SPQELLC[+57]GASLISDR_.2|_SPQELLC[+57]GASLISDR_.3|…

SEN / CTL

P07203

Glutathione peroxidase 1

GPX1

-1.2

0.45

0.00398

0.00831

response to reactive oxygen species,temperature ho…

glutathione peroxidase activity,SH3 domain binding

cytoplasm,mitochondrion,mitochondrial matrix,cytos…

27

17

27

_YVRPGGGFEPNFM[+16]LFEK_.3|_YVRPGGGFEPNFMLFEK_.3|_…

SEN / CTL

P21926

CD9 antigen

CD9

-1.2

1.37

0.00431

0.00874

platelet degranulation,movement of cell or subcell…

integrin binding,protein binding

extracellular space,plasma membrane,integral compo…

9

7

9

_KDVLETFTVK_.2|_AIHYALNC[+57]C[+57]GLAGGVEQFISDIC[…

SEN / CTL

P02462

Collagen alpha-1(IV) chain

COL4A1

-1.2

1.93

0.00482

0.00944

patterning of blood vessels,brain development,neur…

extracellular matrix structural constituent,protei…

extracellular region,collagen type IV trimer,basem…

11

7

11

_AHGQDLGTAGSC[+57]LR_.3|_AHGQDLGTAGSC[+57]LR_.2|_I…

SEN / CTL

Q7Z304

MAM domain-containing protein 2

MAMDC2

-1.2

0.8

0.0278

0.0332

proteinaceous extracellular matrix,endoplasmic ret…

1

1

1

_AGDHTTGLGYYLLANTK_.3

SEN / CTL

O14817

Tetraspanin-4

TSPAN4

-1.21

1.29

0.00268

0.00651

protein complex assembly,cell surface receptor sig…

antigen binding,integrin binding,protein binding

plasma membrane,integral component of plasma membr…

3

2

3

_GLHLYGTQGNVGLTNAWSIIQTDFR_.3|_GLHLYGTQGNVGLTNAWSI…

SEN / CTL

Q9Y696

Chloride intracellular channel protein 4

CLIC4

-1.21

1.61

0.0114

0.0179

angiogenesis,endothelial cell morphogenesis,chlori…

voltage-gated ion channel activity,chloride channe…

intracellular,cytoplasm,mitochondrion,centrosome,c…

43

24

43

_TDVNKIEEFLEEVLC[+57]PPK_.3|_TDVNKIEEFLEEVLC[+57]P…

SEN / CTL

Q96BY6

Dedicator of cytokinesis protein 10

DOCK10

-1.21

0.84

0.0328

0.0374

small GTPase mediated signal transduction,regulati…

molecular_function,guanyl-nucleotide exchange fact…

intracellular,membrane,extracellular exosome

71

55

71

_ASLASLDSNPSTNEK_.2|_ISADFHVDLNHAAVR_.4|_ISADFHVDL…

SEN / CTL

P23284

Peptidyl-prolyl cis-trans isomerase B

PPIB

-1.22

1.8

0.00000534

0.0000285

protein peptidyl-prolyl isomerization,positive reg…

peptidyl-prolyl cis-trans isomerase activity,prote…

nucleus,endoplasmic reticulum,endoplasmic reticulu…

56

28

56

_VLEGMEVVR_.2|_VLEGM[+16]EVVR_.2|_TVDNFVALATGEK_.2…

SEN / CTL

Q9UMS4

Pre-mRNA-processing factor 19

PRPF19

-1.22

0.8

0.0272

0.0326

protein polyubiquitination,spliceosomal tri-snRNP …

protein binding,ligase activity,ubiquitin-ubiquiti…

Prp19 complex,nucleus,nucleoplasm,cytoplasm,lipid …

48

24

48

_TVPEELVKPEELSK_.3|_TVPEELVKPEELSK_.2|_VAHPIRPKPPS…

SEN / CTL

P25787

Proteasome subunit alpha type-2

PSMA2

-1.24

1.93

0.00000565

0.0000296

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,cytoplasmic mRNA processing bod…

31

15

31

_RLTPTEVKDYLAAIA_.3|_LVQIEYALAAVAGGAPSVGIK_.3|_LVQ…

SEN / CTL

P25789

Proteasome subunit alpha type-4

PSMA4

-1.25

1.63

0.00000545

0.0000288

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,cytoplasmic mRNA processing bod…

30

18

30

_LLDEVFFSEK_.2|_TTIFSPEGR_.2|_LSAEKVEIATLTR_.3|_LS…

SEN / CTL

Q16853

Membrane primary amine oxidase

AOC3

-1.25

0.85

0.0301

0.0353

xenobiotic metabolic process,inflammatory response…

copper ion binding,calcium ion binding,protein bin…

cytoplasm,early endosome,endoplasmic reticulum,Gol…

22

18

22

_YQLAVTQR_.2|_AAALAHLDRGSPPPAR_.4|_AAALAHLDRGSPPPA…

SEN / CTL

Q9Y6C2

EMILIN-1

EMILIN1

-1.26

2

1.04e-7

7.39e-7

cell adhesion

protein binding,extracellular matrix constituent c…

extracellular region,proteinaceous extracellular m…

48

36

48

_LDTVAGGLQGLR_.2|_FRGLEEGQAQAGQC[+57]PSLEGR_.3|_VL…

SEN / CTL

Q6UVK1

Chondroitin sulfate proteoglycan 4

CSPG4

-1.27

1.21

7.99e-13

9.61e-12

activation of MAPK activity,angiogenesis,transmemb…

signal transducer activity,protein kinase binding

extracellular region,Golgi lumen,integral componen…

56

46

56

_TLSAFSWR_.2|_HGELELDIPGAQAR_.3|_ASSSAGTDPQLLLYR_….

SEN / CTL

Q92626

Peroxidasin homolog

PXDN

-1.27

1.77

6.92e-7

0.00000448

negative regulation of cytokine-mediated signaling…

peroxidase activity,interleukin-1 receptor antagon…

proteinaceous extracellular matrix,extracellular s…

36

30

36

_AFFSPFR_.2|_SPNDLLALFR_.2|_AEGNPKPEIIWLR_.3|_IVNE…

SEN / CTL

P60900

Proteasome subunit alpha type-6

PSMA6

-1.27

1.62

0.0000011

0.0000068

MAPK cascade,protein polyubiquitination,stimulator…

RNA binding,endopeptidase activity,threonine-type …

proteasome complex,cytoplasmic mRNA processing bod…

30

20

30

_LYQVEYAFK_.2|_HITIFSPEGR_.2|_C[+57]DPAGYYC[+57]GF…

SEN / CTL

P25786

Proteasome subunit alpha type-1

PSMA1

-1.28

2.01

1.96e-7

0.00000137

MAPK cascade,protein polyubiquitination,stimulator…

RNA binding,threonine-type endopeptidase activity,…

proteasome complex,nucleus,nucleoplasm,centrosome,…

45

25

45

_FVFDRPLPVSR_.3|_NQYDNDVTVWSPQGR_.2|_NQYDNDVTVWSPQ…

SEN / CTL

Q14766

Latent-transforming growth factor beta-binding protein 1

LTBP1

-1.31

1.88

0.0019

0.00509

ventricular septum development,transmembrane recep…

transforming growth factor beta-activated receptor…

microfibril,extracellular region,proteinaceous ext…

44

35

44

_C[+57]VDIDEC[+57]TQVQHLC[+57]SQGR_.3|_KC[+57]VDID…

SEN / CTL

Q08431

Lactadherin

MFGE8

-1.33

1.34

5.03e-15

7.04e-14

angiogenesis,phagocytosis, recognition,phagocytosi…

phosphatidylserine binding,integrin binding,phosph…

extracellular region,extracellular space,external …

19

15

19

_GDVFPSYTC[+57]TC[+57]LK_.2|_VTFLGLQHWVPELAR_.3|_V…

SEN / CTL

Q02809

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1

PLOD1

-1.37

1.61

1.38e-17

2.38e-16

response to hypoxia,cellular protein modification …

iron ion binding,procollagen-lysine 5-dioxygenase …

endoplasmic reticulum membrane,rough endoplasmic r…

56

37

56

_NVIAPLMTR_.2|_SEDYVDIVQGR_.2|_IFQNLDGALDEVVLK_.2|…

SEN / CTL

Q06330

Recombining binding protein suppressor of hairless

RBPJ

-1.38

0.77

0.0162

0.0228

negative regulation of transcription from RNA poly…

recombinase activity,RNA polymerase II core promot…

MAML1-RBP-Jkappa- ICN1 complex,nucleus,nucleoplasm…

12

11

12

_IIQFQATPC[+57]PK_.2|_ERGDQTVLILHAK_.3|_TLYISDSDK_…

SEN / CTL

P20908

Collagen alpha-1(V) chain

COL5A1

-1.4

1.2

6.07e-9

5.51e-8

blood vessel development,heart morphogenesis,cell …

integrin binding,extracellular matrix structural c…

extracellular region,collagen type V trimer,baseme…

18

15

18

_TGPIGPQGAPGKPGPDGLR_.3|_SPVFLYEDHTGKPGPEDYPLFR_.4…

SEN / CTL

P69905

Hemoglobin subunit alpha

HBA1

-1.4

1.71

0.000109

0.000443

receptor-mediated endocytosis,positive regulation …

oxygen transporter activity,iron ion binding,prote…

extracellular region,cytosol,hemoglobin complex,me…

78

23

78

_MFLSFPTTK_.2|_M[+16]FLSFPTTK_.2|_LRVDPVNFK_.2|_VG…

SEN / CTL

P62906

60S ribosomal protein L10a

RPL10A

-1.4

1.75

0.00772

0.0135

nuclear-transcribed mRNA catabolic process, nonsen…

RNA binding,structural constituent of ribosome,pro…

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion…

35

19

35

_DTLYEAVR_.2|_FSVC[+57]VLGDQQHC[+57]DEAK_.3|_FSVC[…

SEN / CTL

P28066

Proteasome subunit alpha type-5

PSMA5

-1.41

1.59

0.00000185

0.000011

MAPK cascade,protein polyubiquitination,stimulator…

threonine-type endopeptidase activity,protein bind…

proteasome complex,nucleus,nucleoplasm,cytoplasm,c…

34

17

34

_SEYDRGVNTFSPEGR_.3|_LFQVEYAIEAIK_.2|_LFQVEYAIEAIK…

SEN / CTL

P19823

Inter-alpha-trypsin inhibitor heavy chain H2

ITIH2

-1.42

1.68

0.0000707

0.000303

negative regulation of endopeptidase activity,hyal…

endopeptidase inhibitor activity,serine-type endop…

extracellular region,extracellular exosome,blood m…

62

38

62

_FYNQVSTPLLR_.2|_IQPSGGTNINEALLR_.2|_VQFELHYQEVK_….

SEN / CTL

Q58FF8

Putative heat shock protein HSP 90-beta 2

HSP90AB2P

-1.43

1.59

0.0188

0.0253

protein folding,response to stress,biological_proc…

molecular_function,ATP binding,unfolded protein bi…

cytoplasm,extracellular exosome

6

2

6

_HSQFLGYPITLYLEKER_.4|_HSQFLGYPITLYLEKER_.3|_HSQFL…

SEN / CTL

P35052

Glypican-1

GPC1

-1.45

1.48

0.00000149

0.00000895

retinoid metabolic process,glycosaminoglycan biosy…

copper ion binding,fibroblast growth factor bindin…

proteinaceous extracellular matrix,extracellular s…

13

13

13

_SFVQGLGVASDVVR_.2|_GFSLSDVPQAEISGEHLR_.3|_VLQAMLA…

SEN / CTL

P41252

Isoleucine–tRNA ligase, cytoplasmic

IARS

-1.45

0.77

0.0136

0.0202

osteoblast differentiation,tRNA aminoacylation for…

tRNA binding,aminoacyl-tRNA editing activity,isole…

nucleoplasm,cytoplasm,cytosol,membrane,extracellul…

116

74

116

_LYLINSPVVR_.2|_ESVDHLTIPSR_.3|_ESVDHLTIPSR_.2|_LY…

SEN / CTL

P13726

Tissue factor

F3

-1.48

0.81

0.000267

0.00096

positive regulation of endothelial cell proliferat…

protease binding,cytokine receptor activity,protei…

extracellular space,plasma membrane,cell surface,i…

3

3

3

_DLIYTLYYWK_.2|_TILEWEPKPVNQVYTVQISTK_.3|_C[+57]FY…

SEN / CTL

Q86VP6

Cullin-associated NEDD8-dissociated protein 1

CAND1

-1.48

0.93

0.0235

0.0292

SCF complex assembly,protein ubiquitination,cell d…

protein binding,TBP-class protein binding

ubiquitin ligase complex,nucleus,nucleoplasm,cytop…

119

81

119

_NVVAEC[+57]LGK_.2|_HC[+57]EC[+57]AEEGTR_.3|_HC[+5…

SEN / CTL

P07996

Thrombospondin-1

THBS1

-1.49

2.02

4.83e-18

8.62e-17

activation of MAPK activity,response to hypoxia,ne…

phosphatidylserine binding,glycoprotein binding,fi…

extracellular region,fibrinogen complex,extracellu…

89

63

89

_TIVTTLQDSIR_.2|_FVFGTTPEDILR_.2|_FQMIPLDPK_.2|_NA…

SEN / CTL

Q16610

Extracellular matrix protein 1

ECM1

-1.5

1.51

3.78e-8

3.16e-7

ossification,angiogenesis,positive regulation of e…

protease binding,signal transducer activity,interl…

extracellular region,proteinaceous extracellular m…

28

22

28

_ELLALIQLER_.2|_FC[+57]EAEFSVK_.2|_LVWEEAMSR_.2|_Q…

SEN / CTL

Q17RC7

Exocyst complex component 3-like protein 4

EXOC3L4

-1.54

0.64

0.00574

0.0107

exocytosis,exocyst localization

SNARE binding

exocyst

2

2

2

_ALGLFVPR_.2|_AAAGAAGAEAPR_.2

SEN / CTL

Q9UQE7

Structural maintenance of chromosomes protein 3

SMC3

-1.56

1.11

0.0345

0.0384

regulation of DNA replication,DNA repair,mitotic s…

chromatin binding,microtubule motor activity,prote…

chromosome, centromeric region,chromatin,lateral e…

116

84

116

_SLDQAINDK_.2|_RVDALNDEIR_.3|_RVDALNDEIR_.2|_KYEAI…

SEN / CTL

Q99715

Collagen alpha-1(XII) chain

COL12A1

-1.57

1.91

2.22e-39

1.05e-37

skeletal system development,cell adhesion,collagen…

extracellular matrix structural constituent confer…

extracellular region,collagen type XII trimer,extr…

114

96

114

_ALALGALQNIR_.2|_VLVVVTDGR_.2|_VTWEPAPGEVK_.2|_IIY…

SEN / CTL

P43355


P43358


P43361

Melanoma-associated antigen 1;Melanoma-associated antigen 4;Melanoma-associated antigen 8

MAGEA1


MAGEA4


MAGEA8

-1.58

0.9

0.0393

0.0419

negative regulation of transcription from RNA poly…

protein binding,histone deacetylase binding;molecu…

nucleus,cytoplasm,plasma membrane;cellular_compone…

1

1

1

_ALAETSYVK_.2

SEN / CTL

O95822

Malonyl-CoA decarboxylase, mitochondrial

MLYCD

-1.58

1.24

0.0468

0.0476

response to ischemia,acetyl-CoA biosynthetic proce…

receptor binding,malonyl-CoA decarboxylase activit…

cytoplasm,mitochondrion,mitochondrial matrix,perox…

16

15

16

_LVEGPDVR_.2|_AMDELLR_.2|_GFGVDHGQVAEQSAGVLHLR_.4|…

SEN / CTL

P51531

Probable global transcription activator SNF2L2

SMARCA2

-1.59

0.69

0.00655

0.0117

negative regulation of transcription from RNA poly…

RNA polymerase II transcription coactivator activi…

nuclear chromatin,nucleus,nucleoplasm,SWI/SNF comp…

15

12

15

_VLFGPEAPK_.2|_AVATWHANTER_.3|_GIVEDIHC[+57]GSMK_….

SEN / CTL

P09871

Complement C1s subcomponent

C1S

-1.62

2.17

9.77e-9

8.56e-8

complement activation, lectin pathway,proteolysis,…

serine-type endopeptidase activity,calcium ion bin…

extracellular region,extracellular exosome,blood m…

38

26

38

_LLEVPEGR_.2|_TNFDNDIALVR_.2|_MGPTVSPIC[+57]LPGTSS…

SEN / CTL

Q99798

Aconitate hydratase, mitochondrial

ACO2

-1.66

1.15

0.0322

0.0369

liver development,generation of precursor metaboli…

aconitate hydratase activity,iron ion binding,3 ir…

nucleus,mitochondrion,mitochondrial matrix,myelin …

142

75

142

_NDANPETHAFVTSPEIVTALAIAGTLK_.3|_NDANPETHAFVTSPEIV…

SEN / CTL

P01023

Alpha-2-macroglobulin

A2M

-1.68

3.2

0.000146

0.000568

negative regulation of complement activation, lect…

protease binding,serine-type endopeptidase inhibit…

extracellular region,cytosol,platelet alpha granul…

144

89

144

_QTVSWAVTPK_.2|_LPPNVVEESAR_.2|_ATVLNYLPK_.2|_DLKP…

SEN / CTL

Q6P2Q9

Pre-mRNA-processing-splicing factor 8

PRPF8

-1.68

0.57

0.0028

0.00667

spliceosomal tri-snRNP complex assembly,RNA splici…

second spliceosomal transesterification activity,p…

nucleus,nucleoplasm,U5 snRNP,membrane,nuclear spec…

204

138

204

_QNPFWWTHQR_.3|_QNPFWWTHQR_.2|_FGDLILK_.2|_HDVNLGR…

SEN / CTL

O00391

Sulfhydryl oxidase 1

QSOX1

-1.69

1.46

3.54e-19

6.77e-18

platelet degranulation,negative regulation of macr…

protein disulfide isomerase activity,flavin-linked…

extracellular region,extracellular space,Golgi app…

29

23

29

_LAGAPSEDPQFPK_.2|_DFNIPGFPTVR_.2|_SFYTAYLQR_.2|_V…

SEN / CTL

P08572

Collagen alpha-2(IV) chain

COL4A2

-1.7

1.77

3.89e-7

0.00000265

angiogenesis,transcription, DNA-templated,negative…

extracellular matrix structural constituent,protei…

extracellular region,collagen type IV trimer,extra…

19

15

19

_IAVQPGTVGPQGR_.2|_SVSIGYLLVK_.2|_FSTMPFLYC[+57]NP…

SEN / CTL

P04180

Phosphatidylcholine-sterol acyltransferase

LCAT

-1.7

0.61

0.00333

0.00745

phospholipid metabolic process,phosphatidylcholine…

phosphatidylcholine-sterol O-acyltransferase activ…

extracellular region,extracellular space,high-dens…

6

5

6

_LDKPDVVNWM[+16]C[+57]YR_.3|_LDKPDVVNWMC[+57]YR_.3…

SEN / CTL

Q5VWQ8

Disabled homolog 2-interacting protein

DAB2IP

-1.7

2.22

0.0385

0.0414

negative regulation of transcription from RNA poly…

GTPase activator activity,death receptor binding,p…

cytoplasm,cytosol,plasma membrane,cell-cell adhere…

33

29

33

_SKDELSQAEKDLAVLQDK_.3|_VTQNLANFAK_.2|_AIEEYLK_.2|…

SEN / CTL

Q14112

Nidogen-2

NID2

-1.71

1.73

1.42e-21

3.06e-20

cell adhesion,cell-matrix adhesion,extracellular m…

calcium ion binding,protein binding,collagen bindi…

extracellular region,basement membrane,extracellul…

60

46

60

_AIAVDPIR_.2|_VLYREDTSPAVLGLAAR_.3|_SHLYGITAVYPYC[…

SEN / CTL

A8MXV4

Nucleoside diphosphate-linked moiety X motif 19, mitochondrial

NUDT19

-1.71

1.07

0.023

0.0289

biological_process,fatty acid beta-oxidation using…

receptor binding,metal ion binding,acyl-CoA hydrol…

cellular_component,mitochondrion,peroxisomal matri…

27

19

27

_SADWLGLFAPHHGPPR_.2|_SADWLGLFAPHHGPPR_.4|_SADWLGL…

SEN / CTL

Q9H270

Vacuolar protein sorting-associated protein 11 homolog

VPS11

-1.74

0.79

0.00805

0.0138

intracellular protein transport,vesicle docking in…

nucleotide binding,protein binding,zinc ion bindin…

lysosome,lysosomal membrane,endosome,late endosome…

31

25

31

_ILMHHIPEQTTQLLK_.3|_ILMHHIPEQTTQLLK_.4|_ILM[+16]H…

SEN / CTL

O00468

Agrin

AGRN

-1.75

1.98

3.39e-19

6.75e-18

retinoid metabolic process,glycosaminoglycan biosy…

dystroglycan binding,structural constituent of cyt…

extracellular region,basal lamina,cytoplasm,Golgi …

64

54

64

_LELGIGPGAATR_.2|_SREPVTLGAWTR_.3|_FGALC[+57]EAETG…

SEN / CTL

P10909

Clusterin

CLU

-1.76

1.96

6.58e-8

5.01e-7

cell morphogenesis,microglial cell activation,rele…

protein binding,ubiquitin protein ligase binding,c…

extracellular region,extracellular space,nucleus,c…

42

25

42

_ASSIIDELFQDR_.2|_LFDSDPITVTVPVEVSR_.2|_LFDSDPITVT…

SEN / CTL

Q5VUM1

Succinate dehydrogenase assembly factor 4, mitochondrial

SDHAF4

-1.78

1.11

0.0233

0.0291

innate immune response

mitochondrial matrix

4

3

4

_FPDDVNPVTK_.2|_FDAPEDSHLEK_.3|_FDAPEDSHLEKEPLEKFP…

SEN / CTL

P26022

Pentraxin-related protein PTX3

PTX3

-1.79

1.25

2.26e-7

0.00000156

response to yeast,inflammatory response,opsonizati…

complement component C1q binding,(1->3)-beta-D-glu…

extracellular region,extracellular space

7

7

7

_ALAAVLEELR_.2|_LTSALDELLQATR_.2|_LAESLARPC[+57]AP…

SEN / CTL

Q58FF6

Putative heat shock protein HSP 90-beta 4

HSP90AB4P

-1.8

0.64

0.00326

0.00735

protein folding,response to stress

ATP binding,unfolded protein binding

cytoplasm

5

3

5

_MSLIINTFYSNK_.2|_SLIINTFYSNK_.3|_SLIINTFYSNK_.2|_…

SEN / CTL

Q96PE2

Rho guanine nucleotide exchange factor 17

ARHGEF17

-1.81

0.51

0.00135

0.00397

actin cytoskeleton organization,regulation of Rho …

guanyl-nucleotide exchange factor activity,Rho gua…

cytosol

62

49

62

_AQRPADGLHSWHIFSQPQAGAR_.4|_C[+57]C[+57]SKPQVDMR_….

SEN / CTL

P02751

Fibronectin

FN1

-1.82

1.71

6.4e-112

1.66e-109

angiogenesis,regulation of protein phosphorylation…

protease binding,integrin binding,protein binding,…

extracellular region,fibrinogen complex,proteinace…

209

126

209

_STTPDITGYR_.2|_WLPSSSPVTGYR_.2|_FTNIGPDTMR_.2|_SY…

SEN / CTL

P07942

Laminin subunit beta-1

LAMB1

-1.87

1.75

2.25e-52

1.66e-50

cell adhesion,neuronal-glial interaction involved …

structural molecule activity,extracellular matrix …

extracellular region,basement membrane,laminin-1 c…

100

76

100

_LHTLGDNLLDSR_.3|_LHTLGDNLLDSR_.2|_YVVLPRPVC[+57]F…

SEN / CTL

P16035

Metalloproteinase inhibitor 2

TIMP2

-1.87

1.78

0.00000304

0.0000173

central nervous system development,aging,negative …

protease binding,integrin binding,protein binding,…

extracellular region,proteinaceous extracellular m…

11

8

11

_GAAPPKQEFLDIEDP_.2|_AVSEKEVDSGNDIYGNPIKR_.4|_AVSE…

SEN / CTL

Q92688

Acidic leucine-rich nuclear phosphoprotein 32 family member B

ANP32B

-1.87

1.46

0.0452

0.0464

vasculature development,nucleosome assembly,activa…

protein binding,histone binding,RNA polymerase bin…

nucleus,cytoplasm,extracellular exosome,nucleolus

17

10

17

_ELVLDNC[+57]K_.2|_LKDISTLEPLK_.3|_LKDISTLEPLK_.2|…

SEN / CTL

P07585

Decorin

DCN

-1.89

1.89

2.58e-11

2.78e-10

kidney development,placenta development,negative r…

protein kinase inhibitor activity,protein binding,…

extracellular region,collagen type VI trimer,extra…

33

22

33

_VSPGAFTPLVK_.2|_NLHALILVNNK_.3|_NLHALILVNNK_.2|_A…

SEN / CTL

Q15293

Reticulocalbin-1

RCN1

-1.89

1.91

0.0000472

0.000209

in utero embryonic development,camera-type eye dev…

calcium ion binding,protein binding

endoplasmic reticulum,endoplasmic reticulum lumen

48

29

48

_YIFDNVAK_.2|_IVDRIDNDGDGFVTTEELK_.3|_IVDRIDNDGDGF…

SEN / CTL

P02461

Collagen alpha-1(III) chain

COL3A1

-1.91

2.53

2.45e-9

2.35e-8

skeletal system development,cell-matrix adhesion,t…

integrin binding,extracellular matrix structural c…

extracellular region,collagen type III trimer,extr…

27

25

27

_FTYTVLEDGC[+57]TK_.2|_GAAGEPGRDGVPGGPGMR_.3|_SGEY…

SEN / CTL

Q9BSJ8

Extended synaptotagmin-1

ESYT1

-1.92

0.74

0.00446

0.0089

lipid transport

protein binding,lipid binding,metal ion binding

plasma membrane,membrane,integral component of end…

75

52

75

_ALTLGALTLPLAR_.2|_ALTLGALTLPLAR_.3|_HLSPYATLTVGDS…

SEN / CTL

P23142

Fibulin-1

FBLN1

-1.93

1.67

2.24e-15

3.22e-14

negative regulation of protein phosphorylation,neg…

fibronectin binding,extracellular matrix structura…

extracellular region,proteinaceous extracellular m…

36

25

36

_DC[+57]SLPYATESK_.2|_TGYYFDGISR_.2|_MC[+57]VDVNEC…

SEN / CTL

P35555

Fibrillin-1

FBN1

-1.94

1.32

1.53e-16

2.33e-15

skeletal system development,metanephros developmen…

integrin binding,hormone activity,extracellular ma…

microfibril,extracellular region,proteinaceous ext…

32

32

32

_TLPGGNQC[+57]IVPIC[+57]R_.2|_C[+57]PVGYVLR_.2|_TG…

SEN / CTL

P09960

Leukotriene A-4 hydrolase

LTA4H

-1.95

1.38

0.034

0.0383

proteolysis,leukotriene metabolic process,leukotri…

aminopeptidase activity,epoxide hydrolase activity…

nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr…

79

45

79

_AILPC[+57]QDTPSVK_.2|_TLVWSEK_.2|_ASMHPVTAMLVGK_….

SEN / CTL

P54687

Branched-chain-amino-acid aminotransferase, cytosolic

BCAT1

-1.98

2.53

0.0351

0.0388

G1/S transition of mitotic cell cycle,aspartate bi…

branched-chain-amino-acid transaminase activity,py…

mitochondrion,cytosol

26

17

26

_GETIHIPTMENGPK_.2|_GETIHIPTMENGPK_.3|_ATLPVFDKEEL…

SEN / CTL

Q15582

Transforming growth factor-beta-induced protein ig-h3

TGFBI

-1.99

1.8

1.61e-36

5.94e-35

angiogenesis,chondrocyte differentiation,cell adhe…

integrin binding,protein binding,collagen binding,…

extracellular region,proteinaceous extracellular m…

60

38

60

_EGVYTVFAPTNEAFR_.2|_SPYQLVLQHSR_.3|_SPYQLVLQHSR_….

SEN / CTL

Q9UL54

Serine/threonine-protein kinase TAO2

TAOK2

-2.03

1.48

0.00186

0.00505

activation of MAPKK activity,regulation of cell gr…

protein serine/threonine kinase activity,receptor …

nucleus,nucleolus,cytoplasm,cytoskeleton,integral …

47

34

47

_LQHQTELGNQLEYNK_.3|_LQHQTELGNQLEYNK_.2|_LQHQTELGN…

SEN / CTL

P00736

Complement C1r subcomponent

C1R

-2.08

1.88

2.6e-16

3.85e-15

proteolysis,immune response,complement activation,…

serine-type endopeptidase activity,calcium ion bin…

extracellular region,extracellular exosome,blood m…

35

25

35

_TLDEFTIIQNLQPQYQFR_.3|_DYFIATC[+57]K_.2|_FC[+57]G…

SEN / CTL

O95445

Apolipoprotein M

APOM

-2.08

1.14

0.0153

0.0221

retinoid metabolic process,response to glucose,cho…

lipid transporter activity,phospholipid binding,an…

extracellular region,integral component of plasma …

4

4

4

_AFLLTPR_.2|_WIYHLTEGSTDLR_.3|_KWIYHLTEGSTDLR_.3|_…

SEN / CTL

P14543

Nidogen-1

NID1

-2.09

1.94

1.14e-22

2.69e-21

cell-matrix adhesion,positive regulation of cell-s…

calcium ion binding,collagen binding,laminin bindi…

extracellular region,basement membrane,basal lamin…

50

38

50

_VYYREDLSPSITQR_.3|_VLFETDLVNPR_.2|_YALSNSIGPVR_.2…

SEN / CTL

Q14008

Cytoskeleton-associated protein 5

CKAP5

-2.12

0.88

0.00575

0.0107

G2/M transition of mitotic cell cycle,spindle orga…

protein binding,microtubule plus-end binding,cadhe…

kinetochore,condensed chromosome kinetochore,spind…

132

100

132

_KEALESVEVLIKNPK_.3|_AVELMDR_.2|_GKPAAPGGAGNTGTK_….

SEN / CTL

Q14320

Protein FAM50A

FAM50A

-2.14

1.27

0.0197

0.026

spermatogenesis

poly(A) RNA binding

nucleus,nucleoplasm

22

14

22

_LLSDATVEKDESHAGK_.3|_LLSDATVEKDESHAGK_.4|_LLSDATV…

SEN / CTL

P46013

Antigen KI-67

MKI67

-2.26

1.79

0.0473

0.048

DNA metabolic process,regulation of mitotic nuclea…

DNA binding,protein binding,ATP binding,protein C-…

chromosome, centromeric region,nucleus,nucleolus,c…

86

77

86

_SGGSGHAVAEPASPEQELDQNKGK_.3|_VGVKEELLAVGK_.3|_VGV…

SEN / CTL

P05997

Collagen alpha-2(V) chain

COL5A2

-2.27

1.49

3.21e-9

3.02e-8

skeletal system development,ossification,extracell…

molecular_function,extracellular matrix structural…

extracellular region,collagen type V trimer,extrac…

15

14

15

_SPDNKPVWYGLDMNR_.3|_GSQFAYGDHQSPNTAITQMTFLR_.3|_Y…

SEN / CTL

Q16363

Laminin subunit alpha-4

LAMA4

-2.29

1.6

2.89e-45

1.87e-43

cell adhesion,regulation of cell adhesion,extracel…

receptor binding,extracellular matrix structural c…

extracellular region,basement membrane,basal lamin…

51

42

51

_VDRDVEVEDFQR_.3|_LAALSIEEGK_.2|_TLFPVVLEQLDDYNAK_…

SEN / CTL

P67809

Nuclease-sensitive element-binding protein 1

YBX1

-2.3

1.15

0.011

0.0177

negative regulation of transcription from RNA poly…

RNA polymerase II core promoter proximal region se…

nucleus,nucleoplasm,U12-type spliceosomal complex,…

58

29

58

_NYQQNYQNSESGEKNEGSESAPEGQAQQR_.4|_NYQQNYQNSESGEKN…

SEN / CTL

O60565


Q9H772

Gremlin-1;Gremlin-2

GREM1


GREM2

-2.3

0.93

0.0162

0.0228

cell morphogenesis,branching involved in ureteric …

cytokine activity,protein binding,morphogen activi…

extracellular space,cell surface;extracellular reg…

1

1

1

_FC[+57]YGQC[+57]NSFYIPR_.2

SEN / CTL

Q16270

Insulin-like growth factor-binding protein 7

IGFBP7

-2.31

1.19

9.2e-10

9.33e-9

regulation of cell growth,cell adhesion,embryo imp…

protein binding,insulin-like growth factor binding

extracellular region,extracellular space,extracell…

15

12

15

_SRYPVC[+57]GSDGTTYPSGC[+57]QLR_.3|_GYC[+57]APGMEC…

SEN / CTL

P28072

Proteasome subunit beta type-6

PSMB6

-2.43

0.92

7.54e-8

5.65e-7

MAPK cascade,protein polyubiquitination,stimulator…

endopeptidase activity,threonine-type endopeptidas…

proteasome complex,nucleus,nucleoplasm,cytoplasm,G…

17

11

17

_LAAIAESGVER_.2|_QVLLGDQIPK_.2|_SGSAADTQAVADAVTYQL…

SEN / CTL

Q15113

Procollagen C-endopeptidase enhancer 1

PCOLCE

-2.43

1.55

0.0000297

0.000137

proteolysis,multicellular organism development,pos…

protein binding,collagen binding,heparin binding,p…

extracellular space,extracellular exosome,extracel…

10

9

10

_YDALEVFAGSGTSGQR_.2|_TGGLDLPSPPTGASLK_.2|_FDLEPDT…

SEN / CTL

P20742

Pregnancy zone protein

PZP

-2.44

3.26

0.0117

0.018

female pregnancy,negative regulation of endopeptid…

endopeptidase inhibitor activity,serine-type endop…

extracellular region,extracellular exosome,blood m…

26

23

26

_DLFHC[+57]VSFTLPR_.3|_DLFHC[+57]VSFTLPR_.2|_GSFAL…

SEN / CTL

P08123

Collagen alpha-2(I) chain

COL1A2

-2.45

1.83

9.23e-41

5.31e-39

skeletal system development,blood vessel developme…

extracellular matrix structural constituent,protei…

extracellular region,collagen type I trimer,extrac…

57

44

57

_VYC[+57]DFSTGETC[+57]IR_.2|_EMATQLAFMR_.2|_GIPGPV…

SEN / CTL

P12110

Collagen alpha-2(VI) chain

COL6A2

-2.47

2.1

3.8e-30

1.03e-28

cell adhesion,response to glucose,extracellular ma…

protein binding

extracellular region,proteinaceous extracellular m…

57

42

57

_NFVINVVNR_.2|_LFAVAPNQNLK_.2|_VFAVVITDGR_.2|_DIAS…

SEN / CTL

P13611

Versican core protein

VCAN

-2.49

1.98

3.6e-20

7.45e-19

skeletal system development,osteoblast differentia…

extracellular matrix structural constituent,calciu…

extracellular region,proteinaceous extracellular m…

23

17

23

_LLASDAGLYR_.2|_LATVGELQAAWR_.2|_VSVPTHPEAVGDASLTV…

SEN / CTL

Q92608

Dedicator of cytokinesis protein 2

DOCK2

-2.49

3.11

0.0318

0.0365

membrane raft polarization,establishment of T cell…

GTPase activator activity,protein binding,Rac guan…

cytosol,cytoskeleton,endomembrane system,membrane,…

62

51

62

_SSSSVGGLSVSSR_.2|_TYLDTSSR_.2|_DDMQHQVLER_.3|_DNN…

SEN / CTL

P12111

Collagen alpha-3(VI) chain

COL6A3

-2.5

1.93

3.82e-184

1.98e-181

cell adhesion,muscle organ development,negative re…

serine-type endopeptidase inhibitor activity

extracellular region,proteinaceous extracellular m…

233

165

233

_LLVLITGGK_.2|_YIAYLVR_.2|_ALILVGLER_.2|_VVESLDVGQ…

SEN / CTL

P29762

Cellular retinoic acid-binding protein 1

CRABP1

-2.5

1.41

0.0166

0.023

transport,signal transduction,multicellular organi…

retinoic acid binding,transporter activity,retinoi…

cytosol

10

8

10

_ALGVNAMLR_.2|_IHC[+57]TQTLLEGDGPK_.3|_IHC[+57]TQT…

SEN / CTL

P12109

Collagen alpha-1(VI) chain

COL6A1

-2.51

2.1

2.1e-40

1.09e-38

osteoblast differentiation,cell adhesion,extracell…

platelet-derived growth factor binding

extracellular region,collagen type VI trimer,extra…

69

49

69

_IALVITDGR_.2|_VPSYQALLR_.2|_VFSVAITPDHLEPR_.3|_VF…

SEN / CTL

Q00341

Vigilin

HDLBP

-2.51

1.25

0.011

0.0177

lipid transport,cholesterol metabolic process,cell…

protein binding,lipid binding,poly(A) RNA binding,…

nucleus,cytoplasm,plasma membrane,cell-cell adhere…

123

82

123

_IVGELEQM[+16]VSEDVPLDHR_.3|_IVGELEQMVSEDVPLDHR_.3…

SEN / CTL

Q9Y3B3

Transmembrane emp24 domain-containing protein 7

TMED7

-2.52

1.4

0.0157

0.0225

ER to Golgi vesicle-mediated transport,retrograde …

Golgi membrane,endoplasmic reticulum,endoplasmic r…

11

9

11

_SVIDYQTHFR_.3|_SVIDYQTHFR_.2|_SRAEDLNTR_.2|_FC[+5…

SEN / CTL

A6NC98

Coiled-coil domain-containing protein 88B

CCDC88B

-2.59

0.79

0.00184

0.00505

positive regulation of cytokine production,cytoske…

microtubule binding,dynein light intermediate chai…

cytoplasm,endoplasmic reticulum,Golgi apparatus,ce…

27

24

27

_LAELLLEREPLC[+57]LRPEAPSR_.4|_RAELYREEAEALR_.4|_L…

SEN / CTL

P11047

Laminin subunit gamma-1

LAMC1

-2.66

1.84

8.37e-62

8.65e-60

protein complex assembly,cell adhesion,endoderm de…

extracellular matrix structural constituent

extracellular region,basement membrane,laminin-1 c…

97

77

97

_LSAEDLVLEGAGLR_.2|_LSAEDLVLEGAGLR_.3|_AFDITYVR_.2…

SEN / CTL

Q08380

Galectin-3-binding protein

LGALS3BP

-2.67

2.01

3.55e-27

8.74e-26

platelet degranulation,receptor-mediated endocytos…

scavenger receptor activity

extracellular region,proteinaceous extracellular m…

30

23

30

_ELSEALGQIFDSQR_.2|_ELSEALGQIFDSQR_.3|_SDLAVPSELAL…

SEN / CTL

Q05707

Collagen alpha-1(XIV) chain

COL14A1

-2.71

0.98

0.00346

0.00761

single organismal cell-cell adhesion,extracellular…

extracellular matrix structural constituent,collag…

extracellular region,proteinaceous extracellular m…

92

66

92

_IGILITDGK_.2|_HVFFVDDFDAFKK_.4|_HVFFVDDFDAFKK_.3|…

SEN / CTL

P02452

Collagen alpha-1(I) chain

COL1A1

-2.72

2.2

6.99e-38

2.78e-36

skeletal system development,blood vessel developme…

extracellular matrix structural constituent,protei…

extracellular region,collagen type I trimer,extrac…

55

47

55

_VLC[+57]DDVIC[+57]DETK_.2|_GVQGPPGPAGPR_.2|_SLSQQ…

SEN / CTL

Q9Y2Z0

Protein SGT1 homolog

SUGT1

-2.72

1.02

0.00399

0.00831

mitotic nuclear division,regulation of protein sta…

protein binding

ubiquitin ligase complex,kinetochore,nucleus,cytos…

43

29

43

_SFMESGGTVLSTNWSDVGK_.3|_SFMESGGTVLSTNWSDVGK_.2|_Q…

SEN / CTL

Q92900

Regulator of nonsense transcripts 1

UPF1

-2.72

1.82

0.0288

0.0341

nuclear-transcribed mRNA catabolic process, nonsen…

chromatin binding,RNA binding,ATP-dependent RNA he…

nuclear chromosome, telomeric region,chromatin,cyt…

84

59

84

_EAIIPGSVYDR_.2|_ANEHQGIGFLNDPRR_.4|_ANEHQGIGFLNDP…

SEN / CTL

Q86SZ2

Trafficking protein particle complex subunit 6B

TRAPPC6B

-2.99

1.92

0.0253

0.0308

ER to Golgi vesicle-mediated transport,COPII vesic…

protein binding

Golgi membrane,endoplasmic reticulum,cis-Golgi net…

7

6

7

_TNHQGIYVLQDNK_.3|_TNHQGIYVLQDNK_.2|_GGLSNLGIK_.2|…

SEN / CTL

Q15067

Peroxisomal acyl-coenzyme A oxidase 1

ACOX1

-3.04

0.82

0.00117

0.0035

very long-chain fatty acid metabolic process,gener…

fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti…

nucleus,nucleoplasm,nucleolus,mitochondrion,peroxi…

48

32

48

_FGYDEIDNGYLK_.2|_AC[+57]TIAIR_.2|_YAQVKPDGTYVK_.3…

SEN / CTL

Q9NZP8

Complement C1r subcomponent-like protein

C1RL

-3.05

2.22

0.0373

0.0404

proteolysis,complement activation, classical pathw…

serine-type endopeptidase activity

extracellular space,extracellular exosome

11

9

11

_WILTAAHTIYPK_.3|_WILTAAHTIYPK_.2|_VVVHPDYR_.2|_EA…

SEN / CTL

Q9BVP2

Guanine nucleotide-binding protein-like 3

GNL3

-3.11

1.86

0.0203

0.0266

cell proliferation,positive regulation of telomere…

GTPase activity,protein binding,GTP binding,poly(A…

extracellular space,nucleus,nucleoplasm,nucleolus,…

45

34

45

_DIHEELPK_.2|_KDPGVPNSAPFK_.3|_KDPGVPNSAPFK_.2|_YT…

SEN / CTL

Q5T0Z8

Uncharacterized protein C6orf132

C6orf132

-3.16

1.45

0.00832

0.0141

5

4

5

_GGAAGPGEPVEVK_.2|_GSALGPNPEPHLTFPR_.3|_GSALGPNPEP…

SEN / CTL

Q9HA77

Probable cysteine–tRNA ligase, mitochondrial

CARS2

-3.18

1.65

0.0127

0.0191

cysteinyl-tRNA aminoacylation

cysteine-tRNA ligase activity,ATP binding,metal io…

cytoplasm,mitochondrial matrix

17

14

17

_VLPPTVYLR_.2|_VVDAILGLAHHGNGQLR_.4|_VVDAILGLAHHGN…

SEN / CTL

P21359

Neurofibromin

NF1

-3.25

1.83

0.0166

0.023

MAPK cascade,osteoblast differentiation,metanephro…

GTPase activator activity,protein binding,phosphat…

nucleus,nucleolus,cytoplasm,cytosol,membrane,axon,…

124

95

124

_LTSHQMLSSTEILK_.2|_AVQGC[+57]GAHPAIR_.3|_AVQGC[+5…

SEN / CTL

Q8N573

Oxidation resistance protein 1

OXR1

-3.27

1.32

0.00523

0.01

response to oxidative stress,adult walking behavio…

molecular_function,oxidoreductase activity

cellular_component,nucleolus,mitochondrion

44

34

44

_KIEESETIEDSSNQAAAR_.3|_KIEESETIEDSSNQAAAR_.2|_RID…

SEN / CTL

O75907

Diacylglycerol O-acyltransferase 1

DGAT1

-3.32

1.4

0.00604

0.011

triglyceride metabolic process,triglyceride biosyn…

2-acylglycerol O-acyltransferase activity,diacylgl…

endoplasmic reticulum membrane,integral component …

4

3

4

_DAAAGPDVGAAGDAPAPAPNK_.2|_ASSAAAPHTVSYPDNLTYR_.3|…

SEN / CTL

P02671

Fibrinogen alpha chain

FGA

-3.36

0.78

0.000648

0.00206

adaptive immune response,platelet degranulation,pr…

structural molecule activity,protein binding,prote…

extracellular region,fibrinogen complex,extracellu…

97

54

97

_NPSSAGSWNSGSSGPGSTGNR_.3|_NPSSAGSWNSGSSGPGSTGNR_….

SEN / CTL

P01763

Ig heavy chain V-III region WEA

NaN

-3.41

1.5

0.00697

0.0123

proteolysis,receptor-mediated endocytosis,immune r…

antigen binding,serine-type endopeptidase activity

extracellular region,plasma membrane

2

2

2

_NSLYLQMSSLR_.2|_AEDTAVYYC[+57]AR_.2

SEN / CTL

P17050

Alpha-N-acetylgalactosaminidase

NAGA

-3.44

0.13

5.35e-7

0.00000355

carbohydrate catabolic process,glycoside catabolic…

alpha-galactosidase activity,alpha-N-acetylgalacto…

cytoplasm,lysosome,extracellular exosome

16

11

16

_LDGC[+57]FSTPEER_.2|_RFPHGIPFLADYVHSLGLK_.5|_RFPH…

SEN / CTL

Q15599

Na(+)/H(+) exchange regulatory cofactor NHE-RF2

SLC9A3R2

-3.46

2.74

0.0479

0.0482

protein complex assembly,cell-cell adhesion

receptor binding,protein binding,beta-catenin bind…

nucleus,plasma membrane,cell-cell adherens junctio…

23

18

23

_RVEPGSPAEAAALR_.2|_RVEPGSPAEAAALR_.3|_LLVVDPETDEH…

SEN / CTL

Q8IZD4

mRNA-decapping enzyme 1B

DCP1B

-3.51

0.47

0.0000731

0.00031

nuclear-transcribed mRNA catabolic process, nonsen…

mRNA binding,protein binding,enzyme activator acti…

cytoplasmic mRNA processing body,nucleus,cytoplasm…

15

13

15

_IVDVASQVALYTFGHR_.3|_IVDVASQVALYTFGHR_.2|_LQSTPGA…

SEN / CTL

Q13459

Unconventional myosin-IXb

MYO9B

-3.51

1.27

0.00343

0.00758

Rho protein signal transduction,actin filament-bas…

microfilament motor activity,actin binding,GTPase …

cytoplasm,cytosol,actin filament,cell cortex,actin…

41

34

41

_ASVPIVLEK_.2|_LASAVELWR_.2|_LENFPIHAITGVLK_.3|_LE…

SEN / CTL

Q68CQ4

Digestive organ expansion factor homolog

DIEXF

-3.56

2.12

0.0198

0.0261

maturation of SSU-rRNA from tricistronic rRNA tran…

protein binding,rRNA binding,U3 snoRNA binding,pol…

nucleoplasm,nucleolus,small-subunit processome

28

21

28

_NVPMTGSISHVLVQLPHVFQR_.4|_NVPMTGSISHVLVQLPHVFQR_….

SEN / CTL

P16435

NADPH–cytochrome P450 reductase

POR

-3.57

0.86

0.000745

0.00233

regulation of growth plate cartilage chondrocyte p…

NADPH-hemoprotein reductase activity,cytochrome-b5…

mitochondrion,endoplasmic reticulum membrane,membr…

46

32

46

_TNVLYELAQYASEPSEQELLRK_.4|_TNVLYELAQYASEPSEQELLRK…

SEN / CTL

P16144

Integrin beta-4

ITGB4

-3.67

1.53

0.00587

0.0108

autophagy,cell adhesion,cell-matrix adhesion,integ…

G-protein coupled receptor binding,receptor activi…

nucleus,plasma membrane,integrin complex,cell surf…

55

46

55

_THQEVPSEPGR_.2|_THQEVPSEPGR_.3|_SEHSHSTTLPR_.3|_R…

SEN / CTL

P11388

DNA topoisomerase 2-alpha

TOP2A

-4.23

1.77

0.00591

0.0109

resolution of meiotic recombination intermediates,…

magnesium ion binding,DNA binding,chromatin bindin…

condensed chromosome,nucleus,nucleoplasm,nucleolus…

66

55

66

_IKNENTEGSPQEDGVELEGLK_.3|_EKQDEQVGLPGK_.3|_RDPALN…

SEN / CTL

O60828

Polyglutamine-binding protein 1

PQBP1

-4.43

1.53

0.00293

0.00685

alternative mRNA splicing, via spliceosome,transcr…

DNA binding,transcription coactivator activity,pro…

nucleus,nucleoplasm,cytoplasm,cytoplasmic stress g…

10

8

10

_TGADTTAAGPLFQQR_.2|_SSNADAEEKLDR_.3|_GTWSTGLPK_.2…

SEN / CTL

P50238

Cysteine-rich protein 1

CRIP1

-4.68

1.21

0.00099

0.00298

immune response,heart development,cell proliferati…

AT DNA binding,zinc ion binding,DNA binding, bendi…

cytoplasm

13

6

13

_C[+57]NKEVYFAER_.2|_C[+57]NKEVYFAER_.3|_TLTSGGHAE…

SEN / CTL

P31629

Transcription factor HIVEP2

HIVEP2

-4.99

1.41

0.00137

0.00398

regulation of transcription, DNA-templated,transcr…

DNA binding,transcription factor activity, sequenc…

nucleus,nucleoplasm

26

22

26

_DISC[+57]LSSLK_.2|_GKGDIHGDKDIGSK_.3|_SGFAMAGHENL…

SEN / CTL

Q969Y2

tRNA modification GTPase GTPBP3, mitochondrial

GTPBP3

-5.02

0.72

0.000101

0.000416

tRNA wobble uridine modification,tRNA methylation

GTPase activity,protein binding,GTP binding

mitochondrion

13

13

13

_EGVGPVEQEGVR_.2|_QLDGELGHLC[+57]R_.3|_SGVHVVVTGPP…

SEN / CTL

Q16774

Guanylate kinase

GUK1

-6.13

1.65

0.00114

0.00341

purine nucleotide metabolic process,dGDP biosynthe…

guanylate kinase activity,ATP binding

cytosol

23

15

23

_LAAAQADMESSK_.2|_LAAAQADM[+16]ESSK_.2|_NTETEESLVK…


[/raw]