Post-radiation exosome SASP in human fibroblasts (day 10)

Comparison

UniProtIds

Protein Description

Genes

Log2 Ratio

Std. Dev.

PValue

QValue

GO Biological Process

GO Molecular Process

GO Cellular Process

Ratios

Unique Peptides

Elution Groups

Elution Group

SEN / CTL

A6NCE7

Q9GZQ8

Q9H492

Microtubule-associated proteins 1A/1B light chain 3 beta 2;Microtubule-associated proteins 1A/1B light chain 3B;Microtubule-associated proteins 1A/1B light chain 3A

MAP1LC3B2

MAP1LC3B

MAP1LC3A

5.99

2.42

0.0158

0.0226

autophagosome assembly,mitophagy,cellular response...

microtubule binding;protein binding,microtubule bi...

autophagosome membrane,cytosol,microtubule,endomem...

1

1

1

_IPVIIER_.2

SEN / CTL

Q96CN9

GRIP and coiled-coil domain-containing protein 1

GCC1

5.73

1.68

0.00159

0.00448

protein targeting to Golgi

protein binding

Golgi membrane,cytoplasm,Golgi apparatus,cytosol,p...

13

11

13

_ALAVLTEK_.2|_SHFQAQLQQEMR_.3|_SHFQAQLQQEMR_.2|_TA...

SEN / CTL

Q5TAP6

Q9BVJ6

U3 small nucleolar RNA-associated protein 14 homolog C;U3 small nucleolar RNA-associated protein 14 homolog A

UTP14C

UTP14A

5.41

2.36

0.0195

0.0259

multicellular organism development,spermatogenesis...

protein binding;protein binding,poly(A) RNA bindin...

nucleolus,small-subunit processome;nucleoplasm,nuc...

1

1

1

_TPLEQEIFNLLHK_.3

SEN / CTL

O75175

CCR4-NOT transcription complex subunit 3

CNOT3

5.2

4.01

0.0442

0.0456

nuclear-transcribed mRNA catabolic process, deaden...

protein binding

cytoplasmic mRNA processing body,nucleus,cytosol,C...

19

15

19

_TWVASNEIK_.2|_APEPLSSLK_.2|_LIETQMER_.2|_EGFTFEYR...

SEN / CTL

P68400

Q8NEV1

Casein kinase II subunit alpha;Casein kinase II subunit alpha 3

CSNK2A1

CSNK2A3

4.89

1.31

0.00495

0.00958

transcription, DNA-templated,regulation of transcr...

protein serine/threonine kinase activity,protein b...

nucleus,nucleoplasm,cytosol,plasma membrane,Sin3 c...

1

1

1

_FNDILGR_.2

SEN / CTL

P42677

Q71UM5

40S ribosomal protein S27;40S ribosomal protein S27-like

RPS27

RPS27L

4.87

0.94

0.0019

0.00509

ribosomal small subunit assembly,nuclear-transcrib...

DNA binding,structural constituent of ribosome,pro...

nucleus,nucleoplasm,cytosol,ribosome,cytosolic sma...

1

1

1

_LTEGC[+57]SFR_.2

SEN / CTL

O15075

Serine/threonine-protein kinase DCLK1

DCLK1

4.87

3.35

0.0314

0.0363

neuron migration,protein phosphorylation,nervous s...

protein kinase activity,protein serine/threonine k...

intracellular,integral component of plasma membran...

60

39

60

_DASGM[+16]LYNLASAIK_.2|_DASGMLYNLASAIK_.2|_GKEHMI...

SEN / CTL

Q9BTM9

Ubiquitin-related modifier 1

URM1

4.31

2.84

0.0273

0.0327

tRNA wobble uridine modification,tRNA modification...

protein binding,sulfurtransferase activity

cytosol,extracellular exosome

4

3

4

_NLLIWIK_.2|_HRVTLPGQEEPWDIR_.4|_HRVTLPGQEEPWDIR_....

SEN / CTL

Q5T440

Putative transferase CAF17, mitochondrial

IBA57

4.13

1.31

0.00217

0.00557

heme biosynthetic process,iron-sulfur cluster asse...

transferase activity,poly(A) RNA binding

mitochondrial matrix

18

12

18

_GC[+57]YIGQELTAR_.2|_AGAAAILIRDPR_.3|_AGAAAILIR_....

SEN / CTL

O00267

Transcription elongation factor SPT5

SUPT5H

3.91

2.11

0.0144

0.0211

negative regulation of transcription from RNA poly...

chromatin binding,mRNA binding,protein binding,enz...

nucleus,nucleoplasm,DSIF complex

67

43

67

_LVENGGMFVC[+57]K_.2|_TPHYGSQTPLHDGSR_.4|_TPHYGSQT...

SEN / CTL

Q9Y520

Protein PRRC2C

PRRC2C

3.79

0.94

0.00085

0.00261

hematopoietic progenitor cell differentiation

protein C-terminus binding,poly(A) RNA binding

membrane

86

68

86

_STTPTSSPFR_.2|_HGLQSLGK_.2|_LLAQQHPPPDR_.3|_LLAQQ...

SEN / CTL

Q92797

Symplekin

SYMPK

3.75

1.45

0.00443

0.0089

mRNA polyadenylation,cell adhesion,positive regula...

protein binding

nucleoplasm,cytoplasm,cytoskeleton,plasma membrane...

66

48

66

_QFQYLHVLLDLSSHEK_.3|_RQEHDISLDRIPR_.4|_RQEHDISLDR...

SEN / CTL

P61009

Signal peptidase complex subunit 3

SPCS3

3.74

2.35

0.0236

0.0292

signal peptide processing,proteolysis

peptidase activity

endoplasmic reticulum,signal peptidase complex,end...

4

3

4

_NVEDFTGPR_.2|_NNALNQVVLWDK_.3|_NNALNQVVLWDK_.2|_Y...

SEN / CTL

Q92692

Nectin-2

PVRL2

3.73

1.9

0.0117

0.018

acrosome assembly,positive regulation of natural k...

virus receptor activity,receptor binding,protein b...

plasma membrane,integral component of plasma membr...

10

9

10

_FTLVPSGR_.2|_YHELPTLEER_.3|_ADGVTVTC[+57]K_.2|_AE...

SEN / CTL

Q6ZS30

Neurobeachin-like protein 1

NBEAL1

3.66

1.19

0.00237

0.0059

phospholipid binding

endomembrane system,extrinsic component of membran...

15

15

15

_NISNYFTFIK_.2|_LLNSDHSALPNQR_.3|_DLHSLNLSINPLAMR_...

SEN / CTL

P55212

Caspase-6

CASP6

3.65

2.04

0.0162

0.0228

proteolysis,apoptotic process,cellular component d...

cysteine-type endopeptidase activity,protein bindi...

nucleoplasm,cytoplasm,cytosol

18

14

18

_AEELLLK_.2|_FFWHLTLPER_.3|_FFWHLTLPER_.2|_IFIIQAC...

SEN / CTL

Q9NZT1

Calmodulin-like protein 5

CALML5

3.6

1.68

0.0000824

0.000342

signal transduction,epidermis development

calcium ion binding

extracellular exosome

7

6

7

_NLSEAQLR_.2|_AFSAVDTDGNGTINAQELGAALK_.3|_AFSAVDTD...

SEN / CTL

Q9HAV4

Exportin-5

XPO5

3.55

1.78

0.0112

0.0179

protein export from nucleus,gene silencing by RNA,...

tRNA binding,RNA binding,mRNA binding,nuclear expo...

nucleus,nucleoplasm,cytoplasm,cytosol,RNA nuclear ...

71

48

71

_DIQQTLTQNMER_.2|_IVVEMIK_.2|_ASMTNLVK_.2|_ASM[+16...

SEN / CTL

Q92974

Rho guanine nucleotide exchange factor 2

ARHGEF2

3.53

2.45

0.0322

0.0369

establishment of mitotic spindle orientation,cell ...

guanyl-nucleotide exchange factor activity,Rho gua...

podosome,cytoplasm,Golgi apparatus,spindle,cytosol...

78

49

78

_ALVELLR_.2|_VIQQSVR_.2|_LIHDGC[+57]LLWK_.3|_LIHDG...

SEN / CTL

P47929

Galectin-7

LGALS7

3.49

2.38

0.00123

0.00363

apoptotic process,heterophilic cell-cell adhesion ...

carbohydrate binding

extracellular space,nucleus,cytoplasm,extracellula...

5

5

5

_SSLPEGIRPGTVLR_.3|_LDTSEVVFNSK_.2|_AVVGDAQYHHFR_....

SEN / CTL

Q05086

Ubiquitin-protein ligase E3A

UBE3A

3.46

1.75

0.0114

0.0179

ovarian follicle development,proteolysis,ubiquitin...

transcription coactivator activity,ubiquitin-prote...

proteasome complex,nucleus,cytoplasm,cytosol

37

31

37

_DHIIDDALVR_.2|_GFHMVTNESPLK_.3|_GFHMVTNESPLK_.2|_...

SEN / CTL

Q9NPH0

Lysophosphatidic acid phosphatase type 6

ACP6

3.46

1.91

0.0154

0.0222

phospholipid metabolic process,dephosphorylation,l...

acid phosphatase activity,lysophosphatidic acid ph...

cytoplasm,mitochondrion

10

9

10

_EWFVQLYYHGK_.2|_EWFVQLYYHGK_.3|_GGMFAGQLTK_.2|_QT...

SEN / CTL

Q9H7Z7

Prostaglandin E synthase 2

PTGES2

3.41

1.95

0.0175

0.024

prostaglandin biosynthetic process,cell redox home...

DNA binding,protein binding,electron carrier activ...

Golgi membrane,nucleus,mitochondrion,cytosol,integ...

40

22

40

_YWLMLNEK_.2|_YMGAAAMYLISK_.3|_YMGAAAMYLISK_.2|_YM...

SEN / CTL

P54886

Delta-1-pyrroline-5-carboxylate synthase

ALDH18A1

3.4

0.67

0.000339

0.00119

glutamate metabolic process,proline biosynthetic p...

glutamate 5-kinase activity,glutamate-5-semialdehy...

cytoplasm,mitochondrion,mitochondrial inner membra...

83

48

83

_FASYLTFSPSEVK_.2|_FASYLTFSPSEVK_.3|_LGSAVVTR_.2|_...

SEN / CTL

Q9NW64

Pre-mRNA-splicing factor RBM22

RBM22

3.35

2.03

0.0212

0.0273

protein import into nucleus, translocation,spliceo...

nucleotide binding,nucleocytoplasmic transporter a...

Prp19 complex,nucleus,nucleoplasm,cytoplasm,U2-typ...

17

14

17

_YYGINDPVADK_.2|_KTEVC[+57]QTC[+57]SK_.3|_DRYYGIND...

SEN / CTL

Q99459

Cell division cycle 5-like protein

CDC5L

3.3

1.92

0.0184

0.0248

mitotic cell cycle,mRNA splicing, via spliceosome,...

RNA polymerase II transcription factor activity, s...

Prp19 complex,nucleus,nucleoplasm,nucleolus,cytopl...

61

46

61

_IASLLHR_.2|_AAGIEIQK_.2|_LRQQDLDGELRSEK_.4|_LRQQD...

SEN / CTL

Q9Y2Q3

Glutathione S-transferase kappa 1

GSTK1

3.25

2.07

0.0246

0.03

glutathione metabolic process,epithelial cell diff...

glutathione transferase activity,glutathione perox...

intracellular,mitochondrion,mitochondrial inner me...

31

17

31

_DFLSVM[+16]LEK_.2|_DFLSVMLEK_.2|_DSGNKPPGLLPR_.3|...

SEN / CTL

Q6KB66

Keratin, type II cytoskeletal 80

KRT80

3.24

1.62

0.0112

0.0179

structural molecule activity,protein binding

keratin filament

22

21

22

_SLEEAEAYSR_.2|_APGPGFSSR_.2|_IRYEDEISKR_.3|_AQYDA...

SEN / CTL

P15170

Q8IYD1

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A;Eukaryotic peptide chain release factor GTP-binding subunit ERF3B

GSPT1

GSPT2

3.21

1.46

0.0217

0.0278

G1/S transition of mitotic cell cycle,nuclear-tran...

translation release factor activity,GTPase activit...

intracellular,cytosol,translation release factor c...

1

1

1

_DMGTVVLGK_.2

SEN / CTL

Q9ULV3

Cip1-interacting zinc finger protein

CIZ1

3.12

0.88

0.00137

0.00398

nucleic acid binding,protein binding,zinc ion bind...

nucleus

20

16

20

_LGEIQHMSQAC[+57]LLSLLPVPR_.3|_LGEIQHMSQAC[+57]LLS...

SEN / CTL

Q7Z794

Keratin, type II cytoskeletal 1b

KRT77

3.03

1.12

0.0000129

0.0000641

biological_process

molecular_function,structural molecule activity

cytoskeleton,keratin filament,extracellular exosom...

16

13

16

_YQELQITAGR_.2|_SLDLDSIIDAVR_.2|_TGSENDFVVLKK_.3|_...

SEN / CTL

P05062

Fructose-bisphosphate aldolase B

ALDOB

3.02

1.14

0.00409

0.00839

fructose metabolic process,gluconeogenesis,glycoly...

fructose-bisphosphate aldolase activity,protein bi...

microtubule organizing center,cytosol,centriolar s...

58

32

58

_GILAADESVGTMGNR_.2|_GILAADESVGTM[+16]GNR_.2|_AANK...

SEN / CTL

Q02818

Nucleobindin-1

NUCB1

3

2.69

0.000725

0.00228

response to cisplatin,regulation of protein target...

G-protein alpha-subunit binding,DNA binding,calciu...

extracellular space,nucleus,early endosome,rough e...

46

33

46

_DLELLIQTATR_.2|_LSQETEALGR_.2|_LVTLEEFLASTQRK_.3|...

SEN / CTL

Q14847

LIM and SH3 domain protein 1

LASP1

3

0.96

0.00216

0.00557

ion transport,positive regulation of signal transd...

SH3/SH2 adaptor activity,protein binding,zinc ion ...

cytoplasm,cell-cell adherens junction,focal adhesi...

35

20

35

_TGDTGMLPANYVEAI_.2|_TGDTGM[+16]LPANYVEAI_.2|_AC[+...

SEN / CTL

P11498

Pyruvate carboxylase, mitochondrial

PC

2.96

1.32

0.00744

0.013

pyruvate metabolic process,gluconeogenesis,lipid m...

DNA binding,biotin carboxylase activity,pyruvate c...

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

148

76

148

_LFLQGPK_.2|_SGEGMGIR_.2|_SGEGM[+16]GIR_.2|_FIGPSP...

SEN / CTL

Q6GQQ9

OTU domain-containing protein 7B

OTUD7B

2.96

2.24

0.0417

0.0439

negative regulation of transcription from RNA poly...

DNA binding,thiol-dependent ubiquitin-specific pro...

nucleus,cytoplasm

15

13

15

_NWDVNAALSDFEQLR_.2|_LLPLHFAVDPGK_.3|_HQYQEEMIQR_....

SEN / CTL

O60637

Tetraspanin-3

TSPAN3

2.93

1.72

0.0191

0.0255

cell surface receptor signaling pathway,biological...

molecular_function

integral component of plasma membrane,extracellula...

2

2

2

_AIDYVQR_.2|_SRDPAYELLITGGTYA_.2

SEN / CTL

Q6UXS9

Inactive caspase-12

CASP12

2.92

0.99

0.00277

0.00665

endoplasmic reticulum unfolded protein response,re...

cysteine-type endopeptidase activity involved in a...

endoplasmic reticulum,IPAF inflammasome complex,NL...

2

1

2

_AGADTHGRLLQGNIC[+57]NDAVTK_.3|_AGADTHGRLLQGNIC[+5...

SEN / CTL

Q9GZR2

RNA exonuclease 4

REXO4

2.91

1.03

0.00319

0.00724

regulation of transcription, DNA-templated,nucleic...

transcription factor activity, sequence-specific D...

nucleus,nucleolus

11

11

11

_ALALDC[+57]EMVGVGPK_.2|_YVKPTEPVTDYR_.3|_ALQEWLLK...

SEN / CTL

Q8N1Q1

Carbonic anhydrase 13

CA13

2.87

1.98

0.0314

0.0363

one-carbon metabolic process,bicarbonate transport

carbonate dehydratase activity,zinc ion binding

cytosol,myelin sheath,intracellular membrane-bound...

4

4

4

_ITDTLDSIK_.2|_EHNGPIHWK_.2|_SLLC[+57]TAEGEAAAFLVS...

SEN / CTL

Q9NYU2

UDP-glucose:glycoprotein glucosyltransferase 1

UGGT1

2.85

3.38

0.0353

0.0389

protein N-linked glycosylation via asparagine,endo...

UDP-glucose:glycoprotein glucosyltransferase activ...

endoplasmic reticulum,endoplasmic reticulum lumen,...

111

69

111

_VDALLSAQPK_.2|_KYHISALYVVDLK_.3|_LSDMPLK_.2|_SGYW...

SEN / CTL

Q9BY43

Charged multivesicular body protein 4a

CHMP4A

2.83

0.88

0.00197

0.0052

cell separation after cytokinesis,posttranslationa...

protein binding,lipid binding,identical protein bi...

ESCRT III complex,nucleus,cytoplasm,cytosol,cytopl...

12

11

12

_FEQQLAQTDGTLSTLEFQR_.3|_FEQQLAQTDGTLSTLEFQR_.2|_L...

SEN / CTL

P02647

Apolipoprotein A-I

APOA1

2.83

1.28

0.00784

0.0136

retinoid metabolic process,regulation of protein p...

beta-amyloid binding,protein binding,phospholipid ...

extracellular region,extracellular space,nucleus,e...

68

43

68

_VQPYLDDFQK_.2|_VQPYLDDFQK_.3|_ATEHLSTLSEK_.3|_ATE...

SEN / CTL

Q9NR30

Nucleolar RNA helicase 2

DDX21

2.82

2.28

0.00353

0.0077

osteoblast differentiation,rRNA processing,transcr...

double-stranded RNA binding,ATP-dependent RNA heli...

nucleus,nucleoplasm,nucleolus,membrane

100

64

100

_AAVIGDVIR_.2|_TIIFC[+57]ETK_.2|_GVTFLFPIQAK_.3|_G...

SEN / CTL

Q8WTW3

Conserved oligomeric Golgi complex subunit 1

COG1

2.82

1.18

0.00597

0.0109

retrograde transport, vesicle recycling within Gol...

protein binding

Golgi membrane,Golgi apparatus,Golgi transport com...

36

27

36

_LLLEIPEK_.2|_TLAHPISQEYLK_.3|_TLAHPISQEYLK_.2|_C[...

SEN / CTL

P25685

DnaJ homolog subfamily B member 1

DNAJB1

2.81

0.89

0.00000373

0.0000206

response to unfolded protein,positive regulation o...

ATPase activator activity,protein binding,Hsp70 pr...

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,ce...

28

21

28

_ILTIEVK_.2|_EIAEAYDVLSDPR_.2|_EIAEAYDVLSDPR_.3|_R...

SEN / CTL

Q96CG8

Collagen triple helix repeat-containing protein 1

CTHRC1

2.81

2.27

0.00356

0.00774

cell migration,positive regulation of protein bind...

frizzled binding,Wnt-protein binding

proteinaceous extracellular matrix,collagen trimer...

3

3

3

_IIIEELPK_.2|_GDASTGWNSVSR_.2|_QC[+57]SWSSLNYGIDLG...

SEN / CTL

O14773

Tripeptidyl-peptidase 1

TPP1

2.81

1.41

0.0113

0.0179

proteolysis,lipid metabolic process,lysosome organ...

endopeptidase activity,serine-type endopeptidase a...

mitochondrion,lysosome,melanosome,lysosomal lumen,...

26

16

26

_AYPDVAALSDGYWVVSNRVPIPWVSGTSASTPVFGGILSLINEHR_.4|...

SEN / CTL

Q9Y6R1

Electrogenic sodium bicarbonate cotransporter 1

SLC4A4

2.81

1.69

0.0205

0.0267

transport,sodium ion transport,inorganic anion tra...

inorganic anion exchanger activity,protein binding...

plasma membrane,integral component of plasma membr...

14

13

14

_FLFILLGPK_.2|_LIVPSEFKPTSPNR_.3|_MFTNPDNGSPAMTHR_...

SEN / CTL

Q99735

Microsomal glutathione S-transferase 2

MGST2

2.78

1.03

0.00377

0.00803

glutathione biosynthetic process,xenobiotic metabo...

glutathione transferase activity,leukotriene-C4 sy...

nuclear envelope,endoplasmic reticulum,endoplasmic...

5

3

5

_HLYFWGYSEAAK_.2|_HLYFWGYSEAAK_.3|_VTPPAVTGSPEFER_...

SEN / CTL

Q8WUA2

Peptidyl-prolyl cis-trans isomerase-like 4

PPIL4

2.78

1.9

0.0308

0.0359

protein peptidyl-prolyl isomerization,protein fold...

nucleotide binding,peptidyl-prolyl cis-trans isome...

nucleoplasm,cytoplasm

25

21

25

_DFIIQTGDPTGTGR_.2|_IHVDFSQSVAK_.3|_IHVDFSQSVAK_.2...

SEN / CTL

P36871

Phosphoglucomutase-1

PGM1

2.77

1.16

0.00585

0.0108

glycogen biosynthetic process,glycogen catabolic p...

magnesium ion binding,phosphoglucomutase activity,...

cytoplasm,cytosol,actin cytoskeleton,extracellular...

76

47

76

_ELLSGPNR_.2|_VDLGVLGK_.2|_IRIDAMHGVVGPYVK_.4|_IRI...

SEN / CTL

P40261

Nicotinamide N-methyltransferase

NNMT

2.77

2.1

0.0423

0.0444

response to organonitrogen compound,animal organ r...

nicotinamide N-methyltransferase activity,pyridine...

cytosol

20

13

20

_DTYLSHFNPR_.2|_DTYLSHFNPR_.3|_IFC[+57]LDGVK_.2|_H...

SEN / CTL

P31151

Protein S100-A7

S100A7

2.75

2.9

0.00252

0.00622

response to reactive oxygen species,angiogenesis,e...

calcium ion binding,protein binding,zinc ion bindi...

extracellular region,nucleus,cytoplasm,endoplasmic...

13

9

13

_SIIGMIDMFHK_.3|_SIIGMIDMFHK_.2|_GTNYLADVFEK_.2|_K...

SEN / CTL

Q5T9A4

ATPase family AAA domain-containing protein 3B

ATAD3B

2.74

0.92

0.00263

0.00643

ATP binding

mitochondrial inner membrane

18

13

18

_EYEAAVEQLK_.2|_HILLYGPPGTGK_.3|_HILLYGPPGTGK_.2|_...

SEN / CTL

O95772

MLN64 N-terminal domain homolog

STARD3NL

2.74

1.19

0.00676

0.012

lysosomal membrane,membrane,integral component of ...

3

2

3

_LLIVQDASER_.2|_NIHSINPTQLMAR_.3|_NIHSINPTQLMAR_.2

SEN / CTL

Q9UHL4

Dipeptidyl peptidase 2

DPP7

2.73

1.27

0.0000794

0.000332

proteolysis

serine-type carboxypeptidase activity,serine-type ...

lysosome,Golgi apparatus,cytosol,cytoplasmic vesic...

27

18

27

_YC[+57]LDTWGVWPR_.2|_LYHSC[+57]ADPTGC[+57]GTGPDAR...

SEN / CTL

Q96PM9

Zinc finger protein 385A

ZNF385A

2.73

1.09

0.00507

0.00978

transcription, DNA-templated,regulation of transcr...

p53 binding,DNA binding,mRNA 3'-UTR binding,zinc i...

nucleoplasm,nucleolus,cytoplasm,dendrite,neuronal ...

4

4

4

_GAGELAGTLTFSK_.2|_VAVNSLSQLEAHNK_.3|_TAHGPILFSPY_...

SEN / CTL

Q9Y4R8

Telomere length regulation protein TEL2 homolog

TELO2

2.73

1.97

0.0361

0.0395

regulation of TOR signaling,protein stabilization,...

protein binding,protein kinase binding,protein com...

chromosome, telomeric region,intracellular,nucleus...

30

24

30

_QQEILGVLVPR_.2|_EKEEFASAHFSPVLR_.4|_ALEGLVYR_.2|_...

SEN / CTL

O15204

ADAM DEC1

ADAMDEC1

2.72

1.68

0.0223

0.0283

proteolysis,immune response,negative regulation of...

metalloendopeptidase activity,zinc ion binding

cellular_component,extracellular region

10

8

10

_NNVALVGVMSHELGHVLGMPDVPFNTK_.4|_NNVALVGVMSHELGHVL...

SEN / CTL

P35900

Keratin, type I cytoskeletal 20

KRT20

2.71

0.94

0.00298

0.00691

apoptotic process,cellular response to stress,inte...

structural constituent of cytoskeleton,protein bin...

cytoplasm,intermediate filament

60

37

60

_MAMQNLNDR_.2|_M[+16]AMQNLNDR_.2|_MAM[+16]QNLNDR_....

SEN / CTL

P31944

Caspase-14

CASP14

2.71

1.6

0.0191

0.0255

proteolysis,apoptotic process,epidermis developmen...

cysteine-type endopeptidase activity,protein bindi...

nucleus,cytoplasm,extracellular matrix,keratin fil...

18

15

18

_TNPEIQSTLR_.2|_FQQAIDSR_.2|_GHILELLTEVTRR_.3|_VYI...

SEN / CTL

Q9BVK6

Transmembrane emp24 domain-containing protein 9

TMED9

2.7

3.04

0.00398

0.00831

ER to Golgi vesicle-mediated transport,retrograde ...

protein binding,syntaxin binding

Golgi membrane,endoplasmic reticulum,endoplasmic r...

17

12

17

_LSELQLR_.2|_QLVEQVEQIQKEQNYQR_.3|_FSLFAGGMLR_.2|_...

SEN / CTL

O95865

N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

DDAH2

2.7

2.13

0.0475

0.048

citrulline metabolic process,arginine catabolic pr...

catalytic activity,protein binding,dimethylarginin...

cytoplasm,mitochondrion,centrosome,cytosol,extrace...

24

14

24

_GGGDLPNSQEALQK_.2|_ALQDLGLR_.2|_GLC[+57]GMGGPR_.2...

SEN / CTL

O43399

Tumor protein D54

TPD52L2

2.68

1.63

0.0214

0.0274

poly(A) RNA binding

28

18

28

_LGEWNEK_.2|_KTQETLSQAGQK_.3|_KTQETLSQAGQK_.2|_TSA...

SEN / CTL

Q8N1N4

Keratin, type II cytoskeletal 78

KRT78

2.67

2.1

1.06e-8

9.12e-8

structural molecule activity

extracellular space,keratin filament,extracellular...

14

13

14

_YLDFSSIITEVR_.2|_TLNNQFASFIDKVR_.3|_VQISQLHQEIQR_...

SEN / CTL

P25705

ATP synthase subunit alpha, mitochondrial

ATP5A1

2.67

1.42

0.00022

0.000815

negative regulation of endothelial cell proliferat...

protein binding,ATP binding,transmembrane transpor...

mitochondrion,mitochondrial inner membrane,mitocho...

105

55

105

_EAYPGDVFYLHSR_.3|_EAYPGDVFYLHSR_.2|_AVDSLVPIGR_.2...

SEN / CTL

Q8IWL1

Q8IWL2

Pulmonary surfactant-associated protein A2;Pulmonary surfactant-associated protein A1

SFTPA2

SFTPA1

2.67

0.98

0.00362

0.00778

respiratory gaseous exchange,cellular protein meta...

carbohydrate binding;lipid transporter activity,pr...

extracellular region,proteinaceous extracellular m...

11

9

11

_KYNTYAYVGLTEGPSPGDFR_.3|_HQILQTR_.2|_NPEENEAIASFV...

SEN / CTL

P11226

Mannose-binding protein C

MBL2

2.67

1.42

0.0137

0.0202

complement activation, lectin pathway,proteolysis,...

serine-type endopeptidase activity,receptor bindin...

extracellular region,collagen trimer,extracellular...

3

3

3

_EEAFLGITDEK_.2|_SPDGDSSLAASER_.2|_TEGQFVDLTGNR_.2

SEN / CTL

Q86VN1

Vacuolar protein-sorting-associated protein 36

VPS36

2.67

3.11

0.0238

0.0294

transcription, DNA-templated,regulation of transcr...

protein binding,protein C-terminus binding,phospha...

ESCRT II complex,nucleus,lysosome,endosome,cytosol...

26

20

26

_NISEAFEDLSK_.2|_LVGMSVLLAK_.2|_FDAGTLLLSTHR_.3|_F...

SEN / CTL

Q14134

Tripartite motif-containing protein 29

TRIM29

2.66

0.84

0.00207

0.00538

negative regulation of transcription from RNA poly...

p53 binding,transcription factor activity, sequenc...

nucleoplasm,cytoplasm,cell-cell adherens junction,...

9

8

9

_VIMDALDER_.2|_TSYQPSSPGR_.2|_SC[+57]LVC[+57]QASFC...

SEN / CTL

P09234

U1 small nuclear ribonucleoprotein C

SNRPC

2.65

0.83

0.00201

0.00527

spliceosomal snRNP assembly,mRNA 5'-splice site re...

single-stranded RNA binding,protein binding,zinc i...

commitment complex,nucleoplasm,U1 snRNP,Cajal body...

13

8

13

_WMEEQAQSLIDK_.2|_WM[+16]EEQAQSLIDK_.2|_TTAAFQQGK_...

SEN / CTL

P05109

Protein S100-A8

S100A8

2.64

1.72

0.000921

0.00279

cytokine production,leukocyte migration involved i...

calcium ion binding,protein binding,microtubule bi...

extracellular region,extracellular space,nucleus,c...

29

17

29

_LLETEC[+57]PQYIR_.2|_LLETEC[+57]PQYIR_.3|_ALNSIID...

SEN / CTL

P55084

Trifunctional enzyme subunit beta, mitochondrial

HADHB

2.64

2.03

0.0434

0.0452

fatty acid beta-oxidation,cardiolipin acyl-chain r...

3-hydroxyacyl-CoA dehydrogenase activity,acetyl-Co...

mitochondrion,mitochondrial envelope,mitochondrial...

75

41

75

_EVVDYIIFGTVIQEVK_.3|_EVVDYIIFGTVIQEVK_.2|_LMLDLNK...

SEN / CTL

Q9UBQ7

Glyoxylate reductase/hydroxypyruvate reductase

GRHPR

2.63

1.48

0.0164

0.0229

excretion,metabolic process,dicarboxylic acid meta...

glycerate dehydrogenase activity,hydroxypyruvate r...

cytoplasm,peroxisomal matrix,cytosol,extracellular...

47

28

47

_GDVVNQDDLYQALASGK_.2|_GDVVNQDDLYQALASGK_.3|_GVAGA...

SEN / CTL

Q9UPW0

Forkhead box protein J3

FOXJ3

2.63

1.87

0.0345

0.0384

transcription, DNA-templated,regulation of transcr...

RNA polymerase II transcription factor activity, s...

nucleus

10

7

10

_GSYWAIDTNPK_.2|_SDATQNAHGTGISK_.3|_SDATQNAHGTGISK...

SEN / CTL

Q5VZM2

Q7L523

Ras-related GTP-binding protein B;Ras-related GTP-binding protein A

RRAGB

RRAGA

2.59

0.98

0.0132

0.0197

cell cycle arrest,regulation of autophagy,macroaut...

GTPase activity,protein binding,GTP binding,guanyl...

nucleus,cytoplasm,lysosome,lysosomal membrane,Golg...

1

1

1

_SIIFANYIAR_.2

SEN / CTL

Q9HCY8

Protein S100-A14

S100A14

2.55

1.34

0.0131

0.0196

apoptotic process,response to lipopolysaccharide,t...

calcium ion binding,protein binding,chemokine rece...

nucleoplasm,cytoplasm,plasma membrane,microtubule ...

9

8

9

_SFWELIGEAAK_.2|_NFHQYSVEGGK_.3|_NFHQYSVEGGK_.2|_E...

SEN / CTL

Q9BQ75

Protein CMSS1

CMSS1

2.53

1.02

0.0051

0.0098

poly(A) RNA binding

nucleus,90S preribosome

8

6

8

_SEPKPGLPEDLQK_.3|_SEPKPGLPEDLQK_.2|_ANDLTHSLSSYLK...

SEN / CTL

O14974

Protein phosphatase 1 regulatory subunit 12A

PPP1R12A

2.51

1.32

0.000193

0.000727

G2/M transition of mitotic cell cycle,protein deph...

enzyme inhibitor activity,signal transducer activi...

kinetochore,nucleoplasm,cytoplasm,centrosome,cytos...

66

47

66

_SLLSSTSTTTK_.2|_KLYEQILAENEK_.2|_KLYEQILAENEK_.3|...

SEN / CTL

Q02218

2-oxoglutarate dehydrogenase, mitochondrial

OGDH

2.47

1.52

0.0000199

0.0000952

generation of precursor metabolites and energy,gly...

oxoglutarate dehydrogenase (succinyl-transferring)...

mitochondrion,mitochondrial matrix,mitochondrial m...

124

77

124

_FGLEGC[+57]EVLIPALK_.2|_SWDIFFR_.2|_LVEDHLAVQSLIR...

SEN / CTL

Q5T749

Keratinocyte proline-rich protein

KPRP

2.46

2.21

4.19e-11

4.43e-10

protein binding

cytoplasm,extracellular exosome

17

15

17

_RLDQC[+57]PESPLQR_.3|_RLDQC[+57]PESPLQR_.2|_IEISS...

SEN / CTL

P01133

Pro-epidermal growth factor

EGF

2.45

1.63

0.0283

0.0337

MAPK cascade,activation of MAPKK activity,activati...

protein tyrosine kinase activity,Ras guanyl-nucleo...

extracellular region,extracellular space,lysosomal...

1

1

1

_QSVIEM[+16]ANLDGSK_.2

SEN / CTL

Q9Y3P9

Rab GTPase-activating protein 1

RABGAP1

2.44

0.95

0.00444

0.0089

intracellular protein transport,cell cycle,regulat...

DNA binding,GTPase activator activity,protein bind...

centrosome,cytosol,microtubule associated complex,...

34

30

34

_SYVITGSWNPK_.2|_QQTANKVEIEK_.3|_IQDLEHHLGLALNEVQA...

SEN / CTL

P51659

Peroxisomal multifunctional enzyme type 2

HSD17B4

2.44

1.94

0.0477

0.0481

very long-chain fatty acid metabolic process,osteo...

C-3 sterol dehydrogenase (C-4 sterol decarboxylase...

mitochondrion,peroxisome,peroxisomal membrane,pero...

84

51

84

_DIGPEVVK_.2|_IDVVVNNAGILR_.3|_IDVVVNNAGILR_.2|_TA...

SEN / CTL

Q16629

Serine/arginine-rich splicing factor 7

SRSF7

2.43

0.69

0.00143

0.0041

mRNA splicing, via spliceosome,termination of RNA ...

nucleotide binding,protein binding,zinc ion bindin...

nucleus,nucleoplasm,cytoplasm,extracellular exosom...

17

10

17

_AFSYYGPLR_.2|_VRVELSTGM[+16]PR_.3|_VRVELSTGMPR_.3...

SEN / CTL

Q969Q5

Ras-related protein Rab-24

RAB24

2.42

0.83

0.00285

0.00669

autophagy,small GTPase mediated signal transductio...

protein binding,GTP binding

mitochondrion,autophagosome,cytosol,membrane

7

6

7

_TGQSVDELFQK_.2|_SDLLEEDR_.2|_VDFHDVQDYADNIK_.3|_F...

SEN / CTL

Q9NVN3

Synembryn-B

RIC8B

2.41

1.46

0.0208

0.027

regulation of G-protein coupled receptor protein s...

G-protein alpha-subunit binding,guanyl-nucleotide ...

cytoplasm,centrosome,cytosol,plasma membrane,cell ...

1

1

1

_GSSYREGLTPVLSLLTEC[+57]SR_.3

SEN / CTL

O14980

Exportin-1

XPO1

2.4

0.87

0.00349

0.00764

ribosomal subunit export from nucleus,ribosomal la...

RNA binding,nuclear export signal receptor activit...

kinetochore,nucleus,nuclear envelope,annulate lame...

96

55

96

_PAIMTMLADHAAR_.2|_PAIM[+16]TMLADHAAR_.3|_PAIMTM[+...

SEN / CTL

P21796

Voltage-dependent anion-selective channel protein 1

VDAC1

2.4

1.12

0.00861

0.0144

behavioral fear response,anion transport,mitochond...

protein binding,voltage-gated anion channel activi...

nucleus,mitochondrion,mitochondrial outer membrane...

53

31

53

_GYGFGLIK_.2|_VTGSLETK_.2|_GYGFGLIKLDLK_.3|_GYGFGL...

SEN / CTL

P11908

Ribose-phosphate pyrophosphokinase 2

PRPS2

2.4

1.18

0.0104

0.0169

5-phosphoribose 1-diphosphate biosynthetic process...

magnesium ion binding,ribose phosphate diphosphoki...

ribose phosphate diphosphokinase complex,protein c...

17

12

17

_ENIAEWK_.2|_PNIVLFSGSSHQDLSQR_.4|_PNIVLFSGSSHQDLS...

SEN / CTL

O75717

WD repeat and HMG-box DNA-binding protein 1

WDHD1

2.39

1.84

0.0439

0.0455

DNA binding,protein binding

nucleoplasm,cytoplasm

61

46

61

_LLAIPVEK_.2|_LSELAVEK_.2|_QILHGDPLPLTR_.3|_C[+57]...

SEN / CTL

P04843

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1

RPN1

2.38

0.83

0.00306

0.00706

cellular protein modification process,protein N-li...

protein binding,poly(A) RNA binding,dolichyl-dipho...

endoplasmic reticulum membrane,rough endoplasmic r...

79

48

79

_ATSFLLALEPELEAR_.2|_ATSFLLALEPELEAR_.3|_RTVDLSSHL...

SEN / CTL

P05089

Arginase-1

ARG1

2.38

2.44

0.0129

0.0193

urea cycle,liver development,positive regulation o...

arginase activity,manganese ion binding

extracellular space,nucleus,cytoplasm,mitochondria...

20

15

20

_TIGIIGAPFSK_.2|_GGVEEGPTVLR_.2|_ISLVLGGDHSLAIGSIS...

SEN / CTL

Q5T6S3

PHD finger protein 19

PHF19

2.32

0.75

0.00226

0.00571

transcription, DNA-templated,regulation of transcr...

protein binding,zinc ion binding,methylated histon...

nucleoplasm,ESC/E(Z) complex

3

3

3

_C[+57]IFALAVR_.2|_DSYGATSHLPNK_.2|_WVDVVHLALYNLGV...

SEN / CTL

Q96JH8

Ras-associating and dilute domain-containing protein

RADIL

2.32

1.05

0.00776

0.0135

signal transduction,multicellular organism develop...

protein binding

microtubule

19

17

19

_VVSVYQAALDLLR_.2|_SDVEELAAK_.2|_GTPTPALGDAR_.2|_L...

SEN / CTL

Q15323

Keratin, type I cuticular Ha1

KRT31

2.31

1.82

0.00000138

0.00000844

cytoskeleton organization,epidermis development

structural constituent of cytoskeleton,protein bin...

extracellular space,intermediate filament,extracel...

11

11

11

_LVVQIDNAK_.2|_ILDELTLC[+57]K_.2|_QNQEYQVLLDVR_.2|...

SEN / CTL

P16152

Carbonyl reductase [NADPH] 1

CBR1

2.31

2.35

0.0127

0.0191

drug metabolic process,cyclooxygenase pathway,epit...

carbonyl reductase (NADPH) activity,oxidoreductase...

cytosol,extracellular exosome,extracellular vesicl...

39

24

39

_IGVTVLSR_.2|_ILLNAC[+57]C[+57]PGWVR_.2|_ILLNAC[+5...

SEN / CTL

Q9ULG6

Cell cycle progression protein 1

CCPG1

2.3

0.96

0.00582

0.0108

cell cycle,positive regulation of cell proliferati...

molecular_function,protein binding

integral component of membrane

2

2

2

_GELQQLSGSQLHGK_.2|_FFLNGVFIHDQK_.3

SEN / CTL

P01009

Alpha-1-antitrypsin

SERPINA1

2.3

1.82

0.0478

0.0482

platelet degranulation,ER to Golgi vesicle-mediate...

glycoprotein binding,protease binding,serine-type ...

Golgi membrane,extracellular region,proteinaceous ...

85

44

85

_RLGMFNIQHC[+57]K_.3|_KLSSWVLLMK_.3|_KLSSWVLLMK_.2...

SEN / CTL

P11216

Glycogen phosphorylase, brain form

PYGB

2.29

2.71

0.00308

0.00706

glycogen catabolic process

protein binding,glycogen phosphorylase activity,py...

cytoplasm,membrane,extracellular exosome

104

61

104

_NLAENISR_.2|_VLYPNDNFFEGK_.2|_ILVDVEK_.2|_LKQEYFV...

SEN / CTL

P61254

Q9UNX3

60S ribosomal protein L26;60S ribosomal protein L26-like 1

RPL26

RPL26L1

2.29

0.63

0.00527

0.0101

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

cytosol,membrane,cytosolic large ribosomal subunit...

1

1

1

_FNPFVTSDR_.2

SEN / CTL

P02743

Serum amyloid P-component

APCS

2.28

0.83

0.00358

0.00774

negative regulation of acute inflammatory response...

complement component C1q binding,calcium ion bindi...

extracellular region,extracellular space,nucleus,e...

16

14

16

_IVLGQEQDSYGGK_.3|_IVLGQEQDSYGGK_.2|_AYSDLSR_.2|_E...

SEN / CTL

Q08554

Desmocollin-1

DSC1

2.27

1.5

0.0000408

0.000187

homophilic cell adhesion via plasma membrane adhes...

calcium ion binding

plasma membrane,gap junction,membrane,integral com...

12

9

12

_VTIFTVPENC[+57]R_.2|_VTATDLDEPDTLHTR_.3|_VTATDLDE...

SEN / CTL

P50135

Histamine N-methyltransferase

HNMT

2.24

1.39

0.0225

0.0283

histamine catabolic process,response to tumor cell...

histamine N-methyltransferase activity

nucleoplasm,cytoplasm,cytosol,neuron projection,ex...

16

11

16

_FFHSLLGTNAK_.3|_FFHSLLGTNAK_.2|_TSNLENVK_.2|_ETSS...

SEN / CTL

Q6YHK3

CD109 antigen

CD109

2.23

1.49

0.0288

0.0341

negative regulation of protein phosphorylation,hai...

serine-type endopeptidase inhibitor activity,trans...

extracellular space,plasma membrane,cell surface,a...

34

27

34

_SNLIQQWLSQQSDLGVISK_.3|_SNLIQQWLSQQSDLGVISK_.2|_I...

SEN / CTL

P35606

Coatomer subunit beta'

COPB2

2.23

2.76

0.0312

0.0362

intracellular protein transport,ER to Golgi vesicl...

structural molecule activity,protein binding

Golgi membrane,endoplasmic reticulum membrane,cyto...

94

61

94

_VWC[+57]VASLR_.2|_TGRLPEAAFLAR_.3|_TGRLPEAAFLAR_....

SEN / CTL

P02538

Keratin, type II cytoskeletal 6A

KRT6A

2.21

2.68

1.31e-35

4.24e-34

morphogenesis of an epithelium,cytoskeleton organi...

structural constituent of cytoskeleton,protein bin...

nucleus,membrane,keratin filament,extracellular ex...

85

61

85

_WTLLQEQGTK_.2|_QLDSIVGER_.2|_YEELQVTAGR_.2|_AQYEE...

SEN / CTL

Q02952

A-kinase anchor protein 12

AKAP12

2.21

1.12

0.0118

0.0181

protein targeting,G-protein coupled receptor signa...

protein binding,adenylate cyclase binding,protein ...

cytoplasm,cytoskeleton,plasma membrane,focal adhes...

109

84

109

_LVQNIIQTAVDQFVR_.3|_LVQNIIQTAVDQFVR_.2|_DKTEKPDTV...

SEN / CTL

P78310

Coxsackievirus and adenovirus receptor

CXADR

2.21

1.47

0.0286

0.034

mitochondrion organization,heterophilic cell-cell ...

virus receptor activity,integrin binding,protein b...

acrosomal vesicle,extracellular region,nucleoplasm...

15

14

15

_EGSLPLQYEWQK_.2|_AKGETAYLPC[+57]K_.3|_VAAPNLSR_.2...

SEN / CTL

P31153

S-adenosylmethionine synthase isoform type-2

MAT2A

2.19

1.69

0.0441

0.0456

S-adenosylmethionine biosynthetic process,one-carb...

methionine adenosyltransferase activity,protein bi...

cytosol,methionine adenosyltransferase complex

40

24

40

_FVIGGPQGDAGLTGR_.2|_FVIGGPQGDAGLTGR_.3|_DSFPWEVPK...

SEN / CTL

P13647

Keratin, type II cytoskeletal 5

KRT5

2.18

2.11

3.78e-30

1.03e-28

cytoskeleton organization,epidermis development,he...

structural constituent of cytoskeleton,protein bin...

nucleus,cytoplasm,mitochondrion,cytosol,intermedia...

51

31

51

_ISISTSGGSFR_.2|_AQYEEIANR_.2|_YEELQQTAGR_.2|_LAEL...

SEN / CTL

P14923

Junction plakoglobin

JUP

2.18

2.02

3.78e-22

8.49e-21

desmosome assembly,cytoskeletal anchoring at plasm...

transcription coactivator activity,signal transduc...

nucleus,cytoplasm,cytosol,cytoskeleton,intermediat...

62

39

62

_LVQLLVK_.2|_LVQNC[+57]LWTLR_.2|_LLNDEDPVVVTK_.2|_...

SEN / CTL

P68431

P84243

Q16695

Q71DI3

Histone H3.1;Histone H3.3;Histone H3.1t;Histone H3.2

HIST1H3A

H3F3A

HIST3H3

HIST2H3A

2.18

1.59

0.0000638

0.000276

chromatin silencing at rDNA,nucleosome assembly,DN...

protein binding,nucleosomal DNA binding,histone bi...

nuclear chromosome,nuclear chromosome, telomeric r...

4

3

4

_EIAQDFKTDLR_.3|_EIAQDFKTDLR_.2|_STELLIR_.2|_YRPGT...

SEN / CTL

Q9P260

LisH domain and HEAT repeat-containing protein KIAA1468

KIAA1468

2.18

0.83

0.00426

0.00866

37

30

37

_RALNFLVNEFLLK_.3|_RALNFLVNEFLLK_.2|_VKPQFQEILR_.3...

SEN / CTL

Q02413

Desmoglein-1

DSG1

2.16

1.69

2.24e-17

3.63e-16

cell-cell junction assembly,homophilic cell adhesi...

calcium ion binding,protein binding,toxic substanc...

cytosol,plasma membrane,cytoplasmic side of plasma...

32

21

32

_VIAPSSSLPTSLTIHHPR_.4|_VIAPSSSLPTSLTIHHPR_.3|_YVM...

SEN / CTL

P42765

3-ketoacyl-CoA thiolase, mitochondrial

ACAA2

2.16

0.97

0.00779

0.0135

fatty acid beta-oxidation,cholesterol biosynthetic...

acetyl-CoA C-acyltransferase activity,protein bind...

mitochondrion,mitochondrial inner membrane,extrace...

72

38

72

_VGIPKETPALTINR_.3|_RTPFGAYGGLLK_.3|_RTPFGAYGGLLK_...

SEN / CTL

Q9NX74

tRNA-dihydrouridine(20) synthase [NAD(P)+]-like

DUS2

2.16

2.41

0.0195

0.0259

tRNA dihydrouridine synthesis,negative regulation ...

double-stranded RNA binding,protein kinase inhibit...

cytoplasm,mitochondrion,endoplasmic reticulum,cyto...

14

11

14

_AAM[+16]WNPSIFLK_.2|_AAMWNPSIFLK_.2|_YAVQYDNHYTNT...

SEN / CTL

Q8WVV4

Protein POF1B

POF1B

2.13

1.84

0.000532

0.00176

actin binding

bicellular tight junction,desmosome

38

28

38

_C[+57]QALEENNLSLR_.2|_VVQALDPFNSR_.2|_YFGELLADLSR...

SEN / CTL

P13645

Keratin, type I cytoskeletal 10

KRT10

2.1

1.83

2.54e-59

2.19e-57

keratinocyte differentiation

structural constituent of epidermis

extracellular space,nucleus,cytoplasm,intermediate...

100

51

100

_LKYENEVALR_.3|_LKYENEVALR_.2|_IRLENEIQTYR_.3|_IRL...

SEN / CTL

Q03154

Aminoacylase-1

ACY1

2.1

0.86

0.00533

0.0101

proteolysis,cellular amino acid metabolic process,...

aminoacylase activity,protein binding,zinc ion bin...

cytosol,extracellular exosome

55

37

55

_GVDIYTR_.2|_TPVLLHDHDER_.3|_TPVLLHDHDER_.2|_VAPDV...

SEN / CTL

P25311

Zinc-alpha-2-glycoprotein

AZGP1

2.1

1.1

0.013

0.0195

detection of chemical stimulus involved in sensory...

glycoprotein binding,antigen binding,ribonuclease ...

extracellular region,extracellular space,nucleus,p...

31

20

31

_QKWEAEPVYVQR_.3|_QKWEAEPVYVQR_.2|_AREDIFMETLK_.3|...

SEN / CTL

P31150

Rab GDP dissociation inhibitor alpha

GDI1

2.08

1.36

0.0268

0.0322

signal transduction,protein transport,Rab protein ...

GDP-dissociation inhibitor activity,Rab GDP-dissoc...

cytoplasm,Golgi apparatus,cytosol,midbody,neuron p...

53

28

53

_FQLLEGPPESMGR_.2|_FQLLEGPPESM[+16]GR_.2|_MAGTAFDF...

SEN / CTL

Q96BM9

ADP-ribosylation factor-like protein 8A

ARL8A

2.07

0.46

0.000557

0.0018

chromosome segregation,mitotic nuclear division,sm...

GTPase activity,protein binding,GTP binding,alpha-...

cytoplasm,lysosomal membrane,membrane,midbody,late...

19

11

19

_LWDIGGQPR_.2|_DLPGALDEK_.2|_PQLQGIPVLVLGNK_.3|_PQ...

SEN / CTL

Q07960

Rho GTPase-activating protein 1

ARHGAP1

2.07

1.29

0.0232

0.029

small GTPase mediated signal transduction,Rho prot...

SH3/SH2 adaptor activity,GTPase activator activity...

cytoplasm,cytosol,cell-cell adherens junction,peri...

48

27

48

_YNM[+16]GLPVDFDQYNELHLPAVILK_.3|_YNMGLPVDFDQYNELH...

SEN / CTL

P35527

Keratin, type I cytoskeletal 9

KRT9

2.06

1.65

5.62e-66

9.69e-64

spermatogenesis,epidermis development,skin develop...

structural constituent of cytoskeleton

extracellular space,nucleus,intermediate filament,...

121

54

121

_TLLDIDNTR_.2|_QGVDADINGLR_.2|_QFSSSYLSR_.2|_QVLDN...

SEN / CTL

Q12982

Q86WG3

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2;Caytaxin

BNIP2

ATCAY

2.06

1.14

0.0363

0.0396

apoptotic process,negative regulation of apoptotic...

GTPase activator activity,calcium ion binding,prot...

nuclear envelope,cytoplasm,cytosol,intracellular m...

1

1

1

_SLIIVHPSWFIR_.2

SEN / CTL

Q96ST3

Paired amphipathic helix protein Sin3a

SIN3A

2.05

0.84

0.00546

0.0103

negative regulation of transcription from RNA poly...

transcription regulatory region sequence-specific ...

kinetochore,nucleus,nucleoplasm,transcription fact...

44

35

44

_C[+57]LVIFNQEVISR_.2|_QILEDAAALIIHHVK_.4|_QILEDAA...

SEN / CTL

Q99536

Synaptic vesicle membrane protein VAT-1 homolog

VAT1

2.04

1.74

5.11e-8

4.14e-7

negative regulation of mitochondrial fusion,oxidat...

zinc ion binding,oxidoreductase activity

mitochondrial outer membrane,integral component of...

53

28

53

_VLLVPGPEKEN_.2|_AC[+57]GLNFADLMAR_.2|_AC[+57]GLNF...

SEN / CTL

Q9H2V7

Protein spinster homolog 1

SPNS1

2.03

0.76

0.00407

0.00839

sphingosine-1-phosphate signaling pathway,lipid tr...

protein binding,sphingolipid transporter activity

mitochondrial inner membrane,lysosomal membrane,in...

4

4

4

_SEEPEVPDQEGLQR_.2|_AQLHVQGLLHEAGSTDDR_.4|_AQLHVQG...

SEN / CTL

P61289

Proteasome activator complex subunit 3

PSME3

2.03

1.44

0.0342

0.0383

MAPK cascade,protein polyubiquitination,stimulator...

p53 binding,protein binding,identical protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

41

23

41

_LIISELR_.2|_KLLELDSFLK_.3|_KLLELDSFLK_.2|_YPHVEDY...

SEN / CTL

P04264

Keratin, type II cytoskeletal 1

KRT1

2

1.94

9.78e-64

1.26e-61

complement activation, lectin pathway,retina homeo...

receptor activity,structural molecule activity,pro...

extracellular space,nucleus,cytoskeleton,plasma me...

114

63

114

_SLDLDSIIAEVK_.2|_SLDLDSIIAEVK_.3|_SISISVAR_.2|_WE...

SEN / CTL

P56539

Q03135

Caveolin-3;Caveolin-1

CAV3

CAV1

1.99

0.88

0.0203

0.0266

plasma membrane repair,regulation of heart rate,ne...

calcium channel regulator activity,protein binding...

Golgi membrane,endoplasmic reticulum,plasma membra...

1

1

1

_EIDLVNRDPK_.2

SEN / CTL

P62979

Ubiquitin-40S ribosomal protein S27a

RPS27A

1.98

1.61

1.28e-9

1.28e-8

G2/M transition of mitotic cell cycle,negative reg...

structural constituent of ribosome,protein binding...

extracellular space,nucleus,nucleoplasm,nucleolus,...

17

11

17

_TLSDYNIQK_.2|_TITLEVEPSDTIENVK_.3|_TITLEVEPSDTIEN...

SEN / CTL

O15173

Membrane-associated progesterone receptor component 2

PGRMC2

1.97

1.89

0.00911

0.0151

steroid hormone mediated signaling pathway

steroid hormone receptor activity,steroid binding,...

nuclear envelope,endomembrane system,membrane,inte...

13

10

13

_FYGPAGPYGIFAGR_.2|_FYGPAGPYGIFAGR_.3|_DFSLEQLR_.2...

SEN / CTL

Q96KG9

N-terminal kinase-like protein

SCYL1

1.97

1.27

0.0257

0.0312

transcription, DNA-templated,regulation of transcr...

DNA binding,protein tyrosine kinase activity,ATP b...

nucleus,cytoplasm,endoplasmic reticulum-Golgi inte...

50

34

50

_SMLLLAPK_.2|_VLTSAFSR_.2|_APGGFMSNR_.2|_C[+57]LHV...

SEN / CTL

O43504

Ragulator complex protein LAMTOR5

LAMTOR5

1.96

0.72

0.00368

0.00787

cell cycle arrest,regulation of cell size,response...

protein binding,guanyl-nucleotide exchange factor ...

lysosome,lysosomal membrane,cytosol,Ragulator comp...

6

4

6

_GTLSDEHAGVISVLAQQAAK_.3|_GTLSDEHAGVISVLAQQAAK_.2|...

SEN / CTL

P15924

Desmoplakin

DSP

1.95

2.16

4.1e-32

1.25e-30

desmosome organization,ventricular compact myocard...

protein kinase C binding,structural molecule activ...

cornified envelope,nucleus,cytoplasm,plasma membra...

227

165

227

_YIELLTR_.2|_QLQNIIQATSR_.2|_IEVLEEELR_.2|_VLLQEEG...

SEN / CTL

O15400

Syntaxin-7

STX7

1.94

1.42

0.00193

0.00514

positive regulation of T cell mediated cytotoxicit...

SNARE binding,SNAP receptor activity,protein bindi...

immunological synapse,lysosome,lysosomal membrane,...

12

10

12

_ITQC[+57]SVEIQR_.2|_TLNQLGTPQDSPELR_.2|_TLNQLGTPQ...

SEN / CTL

P35908

Keratin, type II cytoskeletal 2 epidermal

KRT2

1.91

1.93

6.95e-36

2.4e-34

keratinocyte development,epidermis development,ker...

structural constituent of cytoskeleton,protein bin...

extracellular space,nucleus,cytoplasm,Golgi appara...

106

57

106

_FLEQQNQVLQTK_.2|_FLEQQNQVLQTK_.3|_IEISELNR_.2|_YL...

SEN / CTL

Q15758

Neutral amino acid transporter B(0)

SLC1A5

1.89

1.46

0.00000104

0.00000655

amino acid transmembrane transport,extracellular a...

virus receptor activity,receptor activity,protein ...

Golgi apparatus,plasma membrane,integral component...

21

16

21

_STEPELIQVK_.2|_SELPLDPLPVPTEEGNPLLK_.3|_SELPLDPLP...

SEN / CTL

Q9UHD8

Septin-9

9-Sep

1.89

1.21

0.000803

0.00248

cell cycle,protein heterooligomerization,cell divi...

GTPase activity,protein binding,GTP binding,cadher...

stress fiber,cytoplasm,microtubule,cell-cell adher...

76

46

76

_VVNIVPVIAK_.2|_APVDFGYVGIDSILEQM[+16]R_.3|_APVDFG...

SEN / CTL

Q9Y5B9

FACT complex subunit SPT16

SUPT16H

1.88

1.41

0.0403

0.0427

DNA replication,DNA repair,nucleosome disassembly,...

protein binding,nucleosome binding,histone binding...

nucleus,nucleoplasm,chromosome,FACT complex

104

69

104

_IIFMASK_.2|_RMQGSLEAHVNGFR_.4|_RMQGSLEAHVNGFR_.3|...

SEN / CTL

Q00325

Phosphate carrier protein, mitochondrial

SLC25A3

1.87

0.95

0.0115

0.018

generation of precursor metabolites and energy,tra...

symporter activity,phosphate ion carrier activity,...

nucleus,nucleolus,mitochondrion,mitochondrial inne...

40

23

40

_TVEALYK_.2|_TVEALYKFVVPKPR_.4|_TVEALYKFVVPKPR_.3|...

SEN / CTL

P53990

IST1 homolog

IST1

1.87

1.38

0.0391

0.0418

cytokinesis,protein localization,abscission,protei...

protein binding,protein domain specific binding,pr...

nuclear envelope,endoplasmic reticulum-Golgi inter...

15

12

15

_YLIEIAK_.2|_LSVEAPPK_.2|_FGLIQSMK_.2|_EIADYLAAGKD...

SEN / CTL

O75569

Interferon-inducible double-stranded RNA-dependent protein kinase activator A

PRKRA

1.85

0.84

0.00801

0.0138

protein phosphorylation,immune response,negative r...

double-stranded RNA binding,protein binding,enzyme...

nucleoplasm,cytoplasm,cytosol,membrane,perinuclear...

27

16

27

_LPEYTLSQEGGPAHKR_.4|_LPEYTLSQEGGPAHKR_.3|_LPEYTLS...

SEN / CTL

P08708

P0CW22

40S ribosomal protein S17;40S ribosomal protein S17-like

RPS17

RPS17L

1.85

1.27

0.031

0.0361

ribosomal small subunit assembly,nuclear-transcrib...

structural constituent of ribosome,poly(A) RNA bin...

nucleoplasm,cytosol,ribosome,focal adhesion,membra...

23

13

23

_VC[+57]EEIAIIPSKK_.3|_VC[+57]EEIAIIPSKK_.2|_LGNDF...

SEN / CTL

P06576

ATP synthase subunit beta, mitochondrial

ATP5B

1.84

1.47

0.00336

0.00748

angiogenesis,osteoblast differentiation,generation...

transporter activity,protein binding,ATP binding,t...

nucleus,mitochondrion,mitochondrial proton-transpo...

115

47

115

_IGLFGGAGVGK_.2|_FTQAGSEVSALLGR_.2|_FTQAGSEVSALLGR...

SEN / CTL

P32119

Peroxiredoxin-2

PRDX2

1.83

0.68

5.13e-8

4.14e-7

response to reactive oxygen species,response to ox...

thioredoxin peroxidase activity,antioxidant activi...

cytoplasm,cytosol,extracellular exosome

40

24

40

_GLFIIDGK_.2|_KEGGLGPLNIPLLADVTR_.3|_KEGGLGPLNIPLL...

SEN / CTL

P10412

P16402

P16403

Histone H1.4;Histone H1.3;Histone H1.2

HIST1H1E

HIST1H1D

HIST1H1C

1.83

2.36

0.0000456

0.000205

negative regulation of transcription from RNA poly...

protein binding,chromatin DNA binding,poly(A) RNA ...

nucleosome,nucleus,nuclear heterochromatin,extrace...

9

7

9

_KASGPPVSELITK_.3|_KASGPPVSELITK_.2|_ALAAAGYDVEK_....

SEN / CTL

P02533

Keratin, type I cytoskeletal 14

KRT14

1.82

2.34

2.2e-38

9.5e-37

aging,epidermis development,response to zinc ion,r...

structural constituent of cytoskeleton,protein bin...

nucleus,cytoplasm,cytosol,intermediate filament,ke...

89

50

89

_VLDELTLAR_.2|_LAADDFR_.2|_LASYLDKVR_.2|_ISSVLAGGS...

SEN / CTL

P09211

Glutathione S-transferase P

GSTP1

1.82

1.33

1.38e-10

1.43e-9

response to reactive oxygen species,negative regul...

glutathione transferase activity,glutathione perox...

extracellular space,intracellular,nucleus,cytoplas...

44

20

44

_ASC[+57]LYGQLPK_.2|_PPYTVVYFPVR_.2|_PPYTVVYFPVR_....

SEN / CTL

Q14344

Guanine nucleotide-binding protein subunit alpha-13

GNA13

1.82

1.1

0.00053

0.00176

patterning of blood vessels,in utero embryonic dev...

GTPase activity,signal transducer activity,protein...

nucleus,cytoplasm,heterotrimeric G-protein complex...

25

19

25

_ILLLGAGESGK_.2|_VFLQYLPAIR_.2|_IIHGQDFDQR_.3|_IIH...

SEN / CTL

P33176

Kinesin-1 heavy chain

KIF5B

1.82

1.3

0.0351

0.0388

microtubule-based movement,cytoplasm organization,...

microtubule motor activity,protein binding,ATP bin...

cytoplasm,microtubule organizing center,kinesin co...

283

140

283

_EYELLSDELNQK_.2|_EYELLSDELNQK_.3|_ALESALKEAKENASR...

SEN / CTL

Q9Y394

Dehydrogenase/reductase SDR family member 7

DHRS7

1.81

0.84

0.00842

0.0142

oxidation-reduction process

oxidoreductase activity

membrane

18

13

18

_SLC[+57]M[+16]DTSLDVYR_.2|_SLC[+57]MDTSLDVYR_.2|_...

SEN / CTL

Q9UJF2

Ras GTPase-activating protein nGAP

RASAL2

1.79

0.83

0.00829

0.0141

MAPK cascade,signal transduction,positive regulati...

GTPase activator activity,protein binding

cytoplasm,cytosol,intrinsic component of the cytop...

124

73

124

_IVSLDSANTR_.2|_HTVPDRHIPLALPR_.4|_HTVPDRHIPLALPR_...

SEN / CTL

O75368

SH3 domain-binding glutamic acid-rich-like protein

SH3BGRL

1.76

1.49

0.00473

0.00931

positive regulation of signal transduction

SH3/SH2 adaptor activity,SH3 domain binding

extracellular space,nucleus,cytoplasm,extracellula...

17

12

17

_VYIASSSGSTAIK_.2|_ENNAVYAFLGLTAPPGSK_.3|_ENNAVYAF...

SEN / CTL

P61026

Ras-related protein Rab-10

RAB10

1.76

0.76

0.00661

0.0118

Golgi to plasma membrane transport,small GTPase me...

GTPase activity,protein binding,GTP binding,GDP bi...

Golgi membrane,endosome,endoplasmic reticulum memb...

19

14

19

_AFLTLAEDILR_.2|_ANINIEK_.2|_SFENISK_.2|_FHTITTSYY...

SEN / CTL

Q01469

Fatty acid-binding protein, epidermal

FABP5

1.75

1.85

0.0000161

0.0000786

glucose metabolic process,lipid metabolic process,...

transporter activity,fatty acid binding,protein bi...

nucleoplasm,cytoplasm,cytosol,extracellular exosom...

34

17

34

_ELGVGIALR_.2|_TQTVC[+57]NFTDGALVQHQEWDGKESTITR_.4...

SEN / CTL

O43175

D-3-phosphoglycerate dehydrogenase

PHGDH

1.74

1.63

0.0000166

0.0000803

glutamine metabolic process,glycine metabolic proc...

phosphoglycerate dehydrogenase activity,electron c...

cytosol,myelin sheath,extracellular exosome

65

33

65

_DLPLLLFR_.2|_GGIVDEGALLR_.2|_VTADVINAAEK_.2|_TLGI...

SEN / CTL

O94788

Retinal dehydrogenase 2

ALDH1A2

1.74

1.83

0.0147

0.0214

blood vessel development,kidney development,liver ...

retinal dehydrogenase activity,3-chloroallyl aldeh...

cytoplasm,cytosol,perinuclear region of cytoplasm

30

23

30

_FKTMDEVIER_.3|_LADLVER_.2|_ILELIQSGVAEGAK_.3|_ILE...

SEN / CTL

O43242

26S proteasome non-ATPase regulatory subunit 3

PSMD3

1.73

1.75

0.0121

0.0185

MAPK cascade,protein polyubiquitination,stimulator...

protein binding,enzyme regulator activity

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

64

43

64

_SLMPYFLLTQAVR_.2|_SLMPYFLLTQAVR_.3|_SLM[+16]PYFLL...

SEN / CTL

O15260

Surfeit locus protein 4

SURF4

1.72

1.47

0.000467

0.00158

retrograde vesicle-mediated transport, Golgi to ER...

protein binding

Golgi membrane,endoplasmic reticulum membrane,endo...

11

6

11

_LC[+57]LISTFLEDGIR_.2|_SMFAGVPTMR_.2|_SM[+16]FAGV...

SEN / CTL

O95819

Q8N4C8

Q9UKE5

Mitogen-activated protein kinase kinase kinase kinase 4;Misshapen-like kinase 1;TRAF2 and NCK-interacting protein kinase

MAP4K4

MINK1

TNIK

1.72

0.93

0.00127

0.00373

protein phosphorylation,signal transduction by pro...

creatine kinase activity,protein serine/threonine ...

cytoplasm;cytoplasm,Golgi apparatus,cytosol,postsy...

2

2

2

_ALFLIPR_.2|_VFFASVR_.2

SEN / CTL

P29218

Inositol monophosphatase 1

IMPA1

1.72

0.65

0.00409

0.00839

inositol metabolic process,inositol biosynthetic p...

magnesium ion binding,protein binding,inositol mon...

cytoplasm,cytosol,extracellular exosome

22

16

22

_MVLSNMEK_.2|_LFC[+57]IPVHGIR_.3|_LFC[+57]IPVHGIR_...

SEN / CTL

P18283

Glutathione peroxidase 2

GPX2

1.72

1.22

0.0348

0.0386

response to reactive oxygen species,oxidation-redu...

glutathione peroxidase activity,electron carrier a...

cytoplasm,cytosol,extracellular exosome

16

12

16

_VDFNTFR_.2|_SDVAWNFEK_.2|_FLIGPEGEPFR_.2|_RSDVAWN...

SEN / CTL

P06899

P23527

P33778

Q16778

Q8N257

Histone H2B type 1-J;Histone H2B type 1-O;Histone H2B type 1-B;Histone H2B type 2-E;Histone H2B type 3-B

HIST1H2BJ

HIST1H2BO

HIST1H2BB

HIST2H2BE

HIST3H2BB

1.71

1.67

4.79e-7

0.00000322

innate immune response in mucosa,nucleosome assemb...

DNA binding,protein heterodimerization activity;DN...

nucleosome,nuclear nucleosome,extracellular space,...

9

4

9

_LLLPGELAK_.2|_KESYSIYVYK_.3|_AMGIMNSFVNDIFER_.2|_...

SEN / CTL

Q16647

Prostacyclin synthase

PTGIS

1.71

1.29

0.0411

0.0433

prostaglandin biosynthetic process,icosanoid metab...

monooxygenase activity,iron ion binding,protein bi...

extracellular space,nucleus,endoplasmic reticulum,...

7

7

7

_VLDSTPVLDSVLSESLR_.2|_VHSADVFHTFR_.3|_GSLSVGDKDHM...

SEN / CTL

P08779

Keratin, type I cytoskeletal 16

KRT16

1.7

2.99

6.54e-14

8.46e-13

morphogenesis of an epithelium,inflammatory respon...

structural constituent of cytoskeleton,protein bin...

nucleus,cytoskeleton,intermediate filament,extrace...

45

25

45

_APSTYGGGLSVSSR_.2|_DAETWFLSK_.2|_QTVEADVNGLRR_.3|...

SEN / CTL

P02675

Fibrinogen beta chain

FGB

1.7

1.07

0.0238

0.0294

adaptive immune response,platelet degranulation,ce...

structural molecule activity,protein binding,prote...

extracellular region,fibrinogen complex,extracellu...

93

48

93

_SILENLR_.2|_YQISVNK_.2|_GSWYSMR_.2|_KREEAPSLRPAPP...

SEN / CTL

O76013

Keratin, type I cuticular Ha6

KRT36

1.7

1.2

0.0334

0.0379

biological_process,regulation of keratinocyte diff...

structural constituent of epidermis

intermediate filament,extracellular exosome

3

3

3

_QLVEADINGLR_.2|_ENAELESR_.2|_QNQEYQVLLDVK_.2

SEN / CTL

Q6EMK4

Vasorin

VASN

1.69

1.69

0.0117

0.018

negative regulation of epithelial to mesenchymal t...

protein binding,transforming growth factor beta bi...

extracellular space,mitochondrion,lysosomal membra...

8

8

8

_YLQGSSVQLR_.2|_LAGLGLQQLDEGLFSR_.2|_ESHVTLASPEETR...

SEN / CTL

Q9BTY7

Protein HGH1 homolog

HGH1

1.68

0.6

0.0033

0.00741

biological_process

molecular_function

cellular_component

22

17

22

_HVLALTGC[+57]GPGR_.3|_HVLALTGC[+57]GPGR_.2|_ADLQA...

SEN / CTL

P10599

Thioredoxin

TXN

1.68

1.75

0.0143

0.021

negative regulation of transcription from RNA poly...

thioredoxin-disulfide reductase activity,protein b...

nucleus,nucleoplasm,cytoplasm,mitochondrion,cytoso...

20

12

20

_C[+57]MPTFQFFK_.2|_C[+57]M[+16]PTFQFFK_.2|_MIKPFF...

SEN / CTL

Q09028

Q16576

Histone-binding protein RBBP4;Histone-binding protein RBBP7

RBBP4

RBBP7

1.68

0.77

0.0225

0.0283

DNA replication,DNA replication-dependent nucleoso...

histone deacetylase activity,protein binding,histo...

nuclear chromatin,nucleus,nucleoplasm,Sin3 complex...

1

1

1

_LMIWDTR_.2

SEN / CTL

P45880

Voltage-dependent anion-selective channel protein 2

VDAC2

1.67

1.79

0.0161

0.0228

anion transport,negative regulation of protein pol...

nucleotide binding,protein binding,voltage-gated a...

nucleus,mitochondrion,mitochondrial outer membrane...

28

21

28

_YQLDPTASISAK_.2|_GFGFGLVK_.2|_VTGTLETK_.2|_LTLSAL...

SEN / CTL

P27695

DNA-(apurinic or apyrimidinic site) lyase

APEX1

1.66

0.2

0.0000543

0.000239

telomere maintenance,DNA repair,base-excision repa...

DNA binding,damaged DNA binding,double-stranded te...

nuclear chromosome, telomeric region,nucleus,nucle...

52

28

52

_QRWDEAFRK_.3|_KGAVAEDGDELR_.3|_KGAVAEDGDELR_.2|_G...

SEN / CTL

P01857

Ig gamma-1 chain C region

IGHG1

1.66

2.97

0.00224

0.00569

proteolysis,phagocytosis, recognition,phagocytosis...

antigen binding,serine-type endopeptidase activity...

extracellular region,extracellular space,external ...

54

25

54

_ALPAPIEK_.2|_GPSVFPLAPSSK_.2|_NQVSLTC[+57]LVK_.2|...

SEN / CTL

Q9HD45

Transmembrane 9 superfamily member 3

TM9SF3

1.66

0.93

0.0162

0.0228

integral component of membrane

17

14

17

_YFSLPFC[+57]VGSK_.2|_VNAVPRPIPEK_.3|_VNAVPRPIPEK_...

SEN / CTL

P30876

DNA-directed RNA polymerase II subunit RPB2

POLR2B

1.66

1.3

0.046

0.047

mRNA splicing, via spliceosome,transcription-coupl...

DNA binding,chromatin binding,protein binding,ribo...

nucleus,nucleoplasm,DNA-directed RNA polymerase II...

72

51

72

_LLLAALGR_.2|_LTFASTLSHLR_.3|_LTFASTLSHLR_.2|_KGFD...

SEN / CTL

Q04695

Keratin, type I cytoskeletal 17

KRT17

1.65

2.56

9.09e-12

1.02e-10

signal transduction,epidermis development,positive...

structural constituent of cytoskeleton,protein bin...

cytoplasm,intermediate filament,extracellular exos...

41

27

41

_ALEEANTELEVK_.2|_DYSQYYR_.2|_LSVEADINGLRR_.2|_LSV...

SEN / CTL

Q9Y5M8

Signal recognition particle receptor subunit beta

SRPRB

1.65

2.09

0.0341

0.0383

SRP-dependent cotranslational protein targeting to...

signal recognition particle binding,GTP binding

cytoplasm,signal recognition particle receptor com...

25

19

25

_VEFLEC[+57]SAK_.2|_LLTGLYR_.2|_GKEFEFSQLPLK_.3|_G...

SEN / CTL

P17302

Gap junction alpha-1 protein

GJA1

1.64

0.93

0.000357

0.00124

osteoblast differentiation,in utero embryonic deve...

signal transducer activity,receptor binding,gap ju...

Golgi membrane,mitochondrion,mitochondrial outer m...

5

4

5

_LAAGHELQPLAIVDQRPSSR_.4|_VAQTDGVNVDMHLK_.3|_SDPYH...

SEN / CTL

P84103

Serine/arginine-rich splicing factor 3

SRSF3

1.63

2.1

0.0366

0.0398

mRNA splicing, via spliceosome,termination of RNA ...

nucleotide binding,RNA binding,protein binding,pho...

nucleoplasm,cytoplasm,nuclear speck

16

10

16

_AFGYYGPLR_.2|_NPPGFAFVEFEDPRDAADAVR_.3|_NPPGFAFVE...

SEN / CTL

P00441

Superoxide dismutase [Cu-Zn]

SOD1

1.61

1.71

0.00000307

0.0000173

activation of MAPK activity,response to reactive o...

superoxide dismutase activity,copper ion binding,p...

extracellular region,extracellular space,nucleus,n...

39

20

39

_LAC[+57]GVIGIAQ_.2|_GLTEGLHGFHVHEFGDNTAGC[+57]TSA...

SEN / CTL

Q92930

Ras-related protein Rab-8B

RAB8B

1.61

1.59

0.00233

0.00583

vesicle docking involved in exocytosis,small GTPas...

GTPase activity,receptor binding,protein binding,G...

mitochondrion,peroxisomal membrane,plasma membrane...

9

6

9

_LAIDYGIK_.2|_TITTAYYR_.2|_SSANVEEAFFTLAR_.3|_SSAN...

SEN / CTL

Q14240

Eukaryotic initiation factor 4A-II

EIF4A2

1.61

0.68

0.00633

0.0114

nuclear-transcribed mRNA poly(A) tail shortening,t...

translation initiation factor activity,ATP-depende...

cytosol,eukaryotic translation initiation factor 4...

29

18

29

_GVAINFVTEEDKR_.2|_GVAINFVTEEDKR_.3|_KGVAINFVTEEDK...

SEN / CTL

Q5R372

Rab GTPase-activating protein 1-like

RABGAP1L

1.61

2.07

0.0366

0.0398

intracellular protein transport,regulation of vesi...

GTPase activator activity,Rab GTPase binding

nucleus,early endosome,Golgi apparatus

13

13

13

_ESQLQQEDPMDR_.2|_C[+57]FGMLLSPGR_.2|_DSAQESVITR_....

SEN / CTL

P50583

Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]

NUDT2

1.6

1.9

0.0258

0.0312

response to reactive oxygen species,nucleobase-con...

bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) ...

mitochondrial matrix

14

11

14

_DYDVEIR_.2|_AALQEGHQFLC[+57]SIEA_.2|_AC[+57]GLIIF...

SEN / CTL

Q8WWI5

Choline transporter-like protein 1

SLC44A1

1.58

0.93

0.0188

0.0253

phosphatidylcholine biosynthetic process,choline t...

choline transmembrane transporter activity

nucleoplasm,mitochondrion,mitochondrial outer memb...

15

12

15

_LPVPASAPIPFFHR_.3|_LPVPASAPIPFFHR_.2|_NTKLEAIPNSG...

SEN / CTL

P61313

60S ribosomal protein L15

RPL15

1.57

1.8

0.00437

0.00882

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,cytosol,ribosome,cell-cell adherens juncti...

23

16

23

_SLQSVAEER_.2|_QGYVIYR_.2|_FFEVILIDPFHK_.3|_FFEVIL...

SEN / CTL

Q8TCT8

Signal peptide peptidase-like 2A

SPPL2A

1.56

0.53

0.00284

0.00669

signal peptide processing,membrane protein ectodom...

protein binding,aspartic endopeptidase activity, i...

lysosomal membrane,late endosome,plasma membrane,m...

3

2

3

_AVVVPWGSC[+57]HFLEK_.3|_AVVVPWGSC[+57]HFLEK_.2|_I...

SEN / CTL

Q10713

Mitochondrial-processing peptidase subunit alpha

PMPCA

1.56

0.72

0.00855

0.0144

proteolysis,protein processing involved in protein...

metalloendopeptidase activity,zinc ion binding

extracellular space,mitochondrion,mitochondrial in...

47

29

47

_NYYTPDR_.2|_LPHELC[+57]TLIR_.3|_LPHELC[+57]TLIR_....

SEN / CTL

Q8IWA5

Choline transporter-like protein 2

SLC44A2

1.55

0.32

0.000412

0.00142

phosphatidylcholine biosynthetic process,signal tr...

signal transducer activity,choline transmembrane t...

lysosomal membrane,plasma membrane,integral compon...

7

7

7

_IFDDSPC[+57]PFTAK_.2|_KANGVLEAR_.2|_YLTYLNAR_.2|_...

SEN / CTL

Q15365

Poly(rC)-binding protein 1

PCBP1

1.54

1.92

0.0101

0.0165

mRNA splicing, via spliceosome,gene expression,vir...

RNA polymerase II transcription factor activity, s...

nucleoplasm,cytoplasm,cell-cell adherens junction,...

50

16

50

_INISEGNC[+57]PER_.2|_QIC[+57]LVMLETLSQSPQGR_.3|_Q...

SEN / CTL

P04179

Superoxide dismutase [Mn], mitochondrial

SOD2

1.53

1.6

0.000413

0.00142

response to reactive oxygen species,response to su...

superoxide dismutase activity,manganese ion bindin...

mitochondrion,mitochondrial matrix,extracellular e...

42

23

42

_AIWNVINWENVTER_.2|_AIWNVINWENVTER_.3|_GDVTAQIALQP...

SEN / CTL

P52597

Heterogeneous nuclear ribonucleoprotein F

HNRNPF

1.53

1.04

0.00231

0.00583

mRNA splicing, via spliceosome,RNA processing,fibr...

nucleotide binding,RNA binding,single-stranded RNA...

nucleus,nucleoplasm,cytoplasm,membrane,catalytic s...

46

22

46

_ATENDIYNFFSPLNPVR_.3|_SYSDPPLK_.2|_HSGPNSADSANDGF...

SEN / CTL

P53801

Pituitary tumor-transforming gene 1 protein-interacting protein

PTTG1IP

1.52

0.24

0.000144

0.000564

protein import into nucleus,positive regulation of...

p53 binding,molecular_function,protein binding

nucleus,cytoplasm,membrane,integral component of m...

4

3

4

_YGLFKEENPYAR_.3|_KYGLFKEENPYAR_.3|_AC[+57]LDYPVTS...

SEN / CTL

P20962

Parathymosin

PTMS

1.52

0.72

0.00907

0.0151

immune system process,DNA replication

zinc ion binding

nucleus,cytosol

8

5

8

_SVEAAAELSAK_.2|_AAEEEDEADPKR_.3|_AAEEEDEADPKR_.2|...

SEN / CTL

P38606

V-type proton ATPase catalytic subunit A

ATP6V1A

1.51

2.02

0.0117

0.018

transport,insulin receptor signaling pathway,ATP h...

ATP binding,proton-transporting ATPase activity, r...

mitochondrion,lysosomal membrane,cytosol,plasma me...

91

53

91

_ITWSIIR_.2|_VGSHITGGDIYGIVSENSLIK_.3|_VGSHITGGDIY...

SEN / CTL

Q00839

Heterogeneous nuclear ribonucleoprotein U

HNRNPU

1.51

0.95

0.0234

0.0292

mRNA splicing, via spliceosome,osteoblast differen...

core promoter binding,DNA binding,RNA binding,prot...

nucleus,nucleoplasm,cell surface,membrane,intracel...

129

64

129

_EKPYFPIPEEYTFIQNVPLEDR_.3|_EKPYFPIPEEYTFIQNVPLEDR...

SEN / CTL

P06753

Tropomyosin alpha-3 chain

TPM3

1.5

0.43

0.00147

0.00418

movement of cell or subcellular component,muscle c...

molecular_function,protein binding,structural cons...

stress fiber,cytosol,cytoskeleton,muscle thin fila...

47

31

47

_AADAEAEVASLNRR_.3|_KLVIIEGDLER_.3|_KLVIIEGDLER_.2...

SEN / CTL

P54764

Ephrin type-A receptor 4

EPHA4

1.5

1.15

0.0433

0.0452

cell adhesion,adult walking behavior,motor neuron ...

protein kinase activity,GPI-linked ephrin receptor...

cytoplasm,mitochondrial outer membrane,endoplasmic...

1

1

1

_FTVIQLVGMLR_.2

SEN / CTL

O00232

26S proteasome non-ATPase regulatory subunit 12

PSMD12

1.49

0.97

0.00088

0.00268

MAPK cascade,protein polyubiquitination,stimulator...

proteasome complex,nucleoplasm,cytoplasm,cytosol,p...

54

37

54

_LFTTMELMR_.2|_LQEVIETLLSLEK_.2|_LQEVIETLLSLEK_.3|...

SEN / CTL

P68871

Hemoglobin subunit beta

HBB

1.48

2.16

0.0034

0.00754

receptor-mediated endocytosis,blood coagulation,re...

oxygen transporter activity,iron ion binding,prote...

extracellular region,cytosol,hemoglobin complex,ha...

71

30

71

_LLVVYPWTQR_.2|_LLVVYPWTQR_.3|_LHVDPENFR_.2|_VNVDE...

SEN / CTL

P21980

Protein-glutamine gamma-glutamyltransferase 2

TGM2

1.48

1.26

0.0049

0.00953

blood vessel remodeling,isopeptide cross-linking v...

protein-glutamine gamma-glutamyltransferase activi...

mitochondrion,endoplasmic reticulum,cytosol,focal ...

73

46

73

_SEGTYC[+57]C[+57]GPVPVR_.2|_SVPLC[+57]ILYEK_.2|_L...

SEN / CTL

P14174

Macrophage migration inhibitory factor

MIF

1.47

1.13

0.000186

0.00071

prostaglandin biosynthetic process,negative regula...

dopachrome isomerase activity,receptor binding,cyt...

extracellular region,extracellular space,nucleopla...

22

10

22

_LLC[+57]GLLAER_.2|_PMFIVNTNVPR_.2|_PMFIVNTNVPR_.3...

SEN / CTL

P04259

Keratin, type II cytoskeletal 6B

KRT6B

1.45

2.2

0.00000953

0.0000484

cytoskeleton organization,ectoderm development

structural constituent of cytoskeleton,protein bin...

keratin filament,extracellular exosome

14

9

14

_SGFSSISVSR_.2|_YEELQITAGR_.2|_YEELQITAGR_.1|_QLDN...

SEN / CTL

Q8IVT5

Kinase suppressor of Ras 1

KSR1

1.44

0.54

0.00397

0.00831

MAPK cascade,protein phosphorylation,Ras protein s...

protein kinase activity,signal transducer activity...

endoplasmic reticulum,endoplasmic reticulum membra...

34

27

34

_FGLGVLESSNPK_.2|_IDDVSSMR_.2|_ISFLPLTR_.2|_WHGEVA...

SEN / CTL

Q9NZM1

Myoferlin

MYOF

1.43

1.28

4.39e-28

1.14e-26

plasma membrane repair,muscle contraction,blood ci...

protein binding,phospholipid binding

nuclear envelope,plasma membrane,caveola,integral ...

143

117

143

_GPVGTVSEAQLAR_.2|_VGETIIDLENR_.2|_SIFSPVVK_.2|_AN...

SEN / CTL

Q9UHD1

Cysteine and histidine-rich domain-containing protein 1

CHORDC1

1.42

0.88

0.0224

0.0283

regulation of centrosome duplication,chaperone-med...

protein binding,ATP binding,zinc ion binding,ADP b...

cellular_component

41

23

41

_FQEHIIQAPK_.2|_FQEHIIQAPK_.3|_HNSEKPPEPVKPEVK_.4|...

SEN / CTL

Q9BZQ8

Protein Niban

FAM129A

1.42

1

0.0336

0.038

negative regulation of protein phosphorylation,pos...

molecular_function,protein binding

cytoplasm,plasma membrane,membrane,extracellular e...

36

25

36

_EFPVYLWQPFFR_.2|_EFPVYLWQPFFR_.3|_FPHIDLVVQR_.3|_...

SEN / CTL

P15121

Aldose reductase

AKR1B1

1.41

1.51

0.0164

0.0229

tissue homeostasis,renal water homeostasis,carbohy...

alditol:NADP+ 1-oxidoreductase activity,aldo-keto ...

extracellular space,nucleoplasm,cytoplasm,cytosol,...

42

26

42

_VAIDVGYR_.2|_MPILGLGTWK_.2|_M[+16]PILGLGTWK_.2|_L...

SEN / CTL

Q14CN4

Keratin, type II cytoskeletal 72

KRT72

1.39

0.82

0.000111

0.000447

biological_process

molecular_function,structural molecule activity,pr...

keratin filament,extracellular exosome

3

2

3

_FLEQQNQVLETK_.3|_FLEQQNQVLETK_.2|_TAAENEFVVLKK_.3

SEN / CTL

P13010

X-ray repair cross-complementing protein 5

XRCC5

1.36

0.41

0.00183

0.00505

telomere maintenance,double-strand break repair,do...

DNA binding,damaged DNA binding,double-stranded DN...

nuclear telomere cap complex,nuclear chromosome, t...

120

62

120

_HLMLPDFDLLEDIESK_.3|_HLM[+16]LPDFDLLEDIESK_.3|_HL...

SEN / CTL

Q99497

Protein deglycase DJ-1

PARK7

1.36

1.44

0.00257

0.00633

negative regulation of protein phosphorylation,neg...

transcription coactivator activity,mRNA binding,re...

chromatin,nucleus,cytoplasm,mitochondrion,mitochon...

55

27

55

_VTVAGLAGKDPVQC[+57]SR_.3|_VTVAGLAGKDPVQC[+57]SR_....

SEN / CTL

Q96S97

Myeloid-associated differentiation marker

MYADM

1.34

0.3

0.000536

0.00176

negative regulation of protein phosphorylation,neg...

molecular_function

ruffle,plasma membrane,cell-cell junction,integral...

2

1

2

_TTITTTTTSSSGLGSPMIVGSPR_.3|_TTITTTTTSSSGLGSPMIVGS...

SEN / CTL

P07339

Cathepsin D

CTSD

1.34

1.88

0.0156

0.0225

proteolysis,autophagy,antigen processing and prese...

aspartic-type endopeptidase activity,cysteine-type...

extracellular region,extracellular space,lysosome,...

62

30

62

_VSTLPAITLK_.2|_LSPEDYTLK_.2|_FDGILGMAYPR_.2|_FDGI...

SEN / CTL

P09327

Villin-1

VIL1

1.34

0.81

0.0213

0.0274

intestinal D-glucose absorption,protein complex as...

calcium ion binding,protein binding,phosphatidylin...

ruffle,nucleoplasm,cytoplasm,plasma membrane,micro...

70

45

70

_KAAATTAQEYLK_.3|_KAAATTAQEYLK_.2|_EPPHLMSIFK_.3|_...

SEN / CTL

Q15464

SH2 domain-containing adapter protein B

SHB

1.34

0.97

0.0368

0.0399

angiogenesis,negative regulation of protein kinase...

glycoprotein binding,SH3/SH2 adaptor activity,prot...

cytosol,plasma membrane

6

5

6

_C[+57]AASAAEESGAGKK_.3|_HGSPEFC[+57]GILGER_.3|_HG...

SEN / CTL

Q9NQW7

Xaa-Pro aminopeptidase 1

XPNPEP1

1.33

1.58

0.00567

0.0107

proteolysis,bradykinin catabolic process

aminopeptidase activity,manganese ion binding,prot...

cytoplasm,extracellular exosome

49

33

49

_QMDSNWTLMK_.2|_IENVVLVVPVK_.2|_IENVVLVVPVK_.3|_GS...

SEN / CTL

O75955

Flotillin-1

FLOT1

1.32

1.31

0.000232

0.000853

membrane raft assembly,positive regulation of cyto...

protease binding,protein binding,ionotropic glutam...

uropod,lysosomal membrane,endosome,early endosome,...

45

31

45

_VQVQVVER_.2|_ISLNTLTLNVK_.2|_LTGVSISQVNHKPLR_.4|_...

SEN / CTL

P19338

Nucleolin

NCL

1.31

2.35

0.0489

0.049

angiogenesis,positive regulation of transcription ...

nucleotide binding,RNA binding,protein binding,pro...

nucleus,nucleoplasm,nucleolus,cell cortex,membrane...

97

63

97

_NDLAVVDVR_.2|_TGISDVFAK_.2|_VTQDELKEVFEDAAEIR_.3|...

SEN / CTL

Q9H4M9

EH domain-containing protein 1

EHD1

1.29

1.53

0.000176

0.000677

intracellular protein transport,endocytosis,blood ...

calcium ion binding,protein binding,ATP binding,GT...

lipid particle,plasma membrane,cell-cell adherens ...

54

29

54

_LLPLEEHYR_.2|_LNAFGNAFLNR_.2|_KLNAFGNAFLNR_.3|_FM...

SEN / CTL

Q14103

Heterogeneous nuclear ribonucleoprotein D0

HNRNPD

1.28

1.62

0.0114

0.0179

mRNA splicing, via spliceosome,telomere maintenanc...

nucleotide binding,AT DNA binding,chromatin bindin...

nucleus,nucleoplasm,cytosol,intracellular ribonucl...

52

26

52

_GFGFVLFK_.2|_KIFVGGLSPDTPEEK_.3|_KIFVGGLSPDTPEEK_...

SEN / CTL

Q9P0L0

Vesicle-associated membrane protein-associated protein A

VAPA

1.26

0.68

0.0147

0.0214

ER to Golgi vesicle-mediated transport,signal tran...

signal transducer activity,protein binding,microtu...

Golgi membrane,endoplasmic reticulum,endoplasmic r...

29

18

29

_LQGEMMK_.2|_VAHSDKPGSTSTASFR_.4|_VAHSDKPGSTSTASFR...

SEN / CTL

Q9Y625

Glypican-6

GPC6

1.26

1.35

0.0161

0.0228

retinoid metabolic process,glycosaminoglycan biosy...

heparan sulfate proteoglycan binding,coreceptor ac...

proteinaceous extracellular matrix,extracellular s...

3

3

3

_GFSLADIPYQEIAGEHLR_.3|_LEFENLVEETSHFVR_.3|_MFQLIN...

SEN / CTL

P81605

Dermcidin

DCD

1.25

1.49

0.000323

0.00114

proteolysis,killing of cells of other organism,def...

protein binding,peptidase activity,poly(A) RNA bin...

extracellular region,extracellular matrix,extracel...

6

4

6

_LGKDAVEDLESVGK_.3|_LGKDAVEDLESVGK_.2|_GAVHDVKDVLD...

SEN / CTL

P52907

F-actin-capping protein subunit alpha-1

CAPZA1

1.24

0.77

0.0000204

0.0000968

protein complex assembly,movement of cell or subce...

actin binding,protein binding,cadherin binding inv...

extracellular region,cytosol,cytoskeleton,cell-cel...

42

20

42

_LLLNNDNLLR_.2|_LLLNNDNLLR_.3|_KEASDPQPEEADGGLK_.3...

SEN / CTL

P0C0L4

Complement C4-A

C4A

1.24

1.56

0.00809

0.0138

proteolysis,inflammatory response,complement activ...

complement component C1q binding,serine-type endop...

extracellular region,extracellular space,plasma me...

175

104

175

_DSSTWLTAFVLK_.2|_ANSFLGEK_.2|_HLVPGAPFLLQALVR_.3|...

SEN / CTL

P61225

Ras-related protein Rap-2b

RAP2B

1.23

0.59

0.00984

0.0162

signal transduction,platelet activation,negative r...

protein binding,GTP binding,GDP binding,protein do...

cytosol,plasma membrane,bicellular tight junction,...

7

7

7

_ASVDELFAEIVR_.2|_VDLEGEREVSYGEGK_.3|_VPMILVGNKVDL...

SEN / CTL

O00159

Unconventional myosin-Ic

MYO1C

1.22

1.41

7.2e-7

0.00000461

protein targeting,protein targeting to membrane,po...

microfilament motor activity,receptor binding,prot...

nuclear pore,nucleoplasm,nucleolus,cytoplasm,cytos...

97

70

97

_LLSVEGSTLR_.2|_LGTDEISPR_.2|_NPQSYLYLVK_.2|_NPQSY...

SEN / CTL

Q96QK1

Vacuolar protein sorting-associated protein 35

VPS35

1.21

1.57

0.0374

0.0404

intracellular protein transport,positive regulatio...

protein binding,protein transporter activity,D1 do...

lysosomal membrane,endosome,early endosome,late en...

64

41

64

_ILVGTNLVR_.2|_SEDPDQQYLILNTAR_.2|_SEDPDQQYLILNTAR...

SEN / CTL

P01111

GTPase NRas

NRAS

1.2

1.17

0.000631

0.00202

MAPK cascade,stimulatory C-type lectin receptor si...

GTP binding,protein complex binding

Golgi membrane,Golgi apparatus,plasma membrane,mem...

6

6

6

_LVVVGAGGVGK_.2|_SFADINLYR_.2|_QGVEDAFYTLVR_.2|_SA...

SEN / CTL

Q13308

Inactive tyrosine-protein kinase 7

PTK7

1.18

1.56

6.09e-8

4.77e-7

establishment of planar polarity,ventricular septu...

protein kinase activity,protein binding,ATP bindin...

integral component of plasma membrane,cell-cell ju...

35

30

35

_VVLAPQDVVVAR_.2|_SEFGEVFLAK_.2|_SSLQPITTLGK_.2|_Y...

SEN / CTL

O60814

P57053

P58876

P62807

Q5QNW6

Q93079

Q99877

Q99879

Q99880

Histone H2B type 1-K;Histone H2B type F-S;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 2-F;Histone H2B type 1-H;Histone H2B type 1-N;Histone H2B type 1-M;Histone H2B type 1-L

HIST1H2BK

H2BFS

HIST1H2BD

HIST1H2BC

HIST2H2BF

HIST1H2BH

HIST1H2BN

HIST1H2BM

HIST1H2BL

1.18

1

0.00186

0.00505

innate immune response in mucosa,nucleosome assemb...

molecular_function,DNA binding,protein heterodimer...

nuclear nucleosome,extracellular space,nucleus,nuc...

3

2

3

_ESYSVYVYK_.2|_KESYSVYVYK_.3|_KESYSVYVYK_.2

SEN / CTL

P08727

Keratin, type I cytoskeletal 19

KRT19

1.18

2.17

0.0122

0.0186

Notch signaling pathway,viral process,response to ...

structural constituent of cytoskeleton,protein bin...

intermediate filament,plasma membrane,dystrophin-a...

87

44

87

_TKFETEQALR_.3|_TKFETEQALR_.2|_LTMQNLNDR_.2|_LTM[+...

SEN / CTL

P17931

Galectin-3

LGALS3

1.16

1.5

0.000216

0.000805

monocyte chemotaxis,mRNA processing,RNA splicing,n...

protein binding,IgE binding,carbohydrate binding,c...

immunological synapse,extracellular space,nucleus,...

19

12

19

_IALDFQR_.2|_MLITILGTVKPNANR_.3|_M[+16]LITILGTVKPN...

SEN / CTL

Q69YQ0

Cytospin-A

SPECC1L

1.16

0.69

0.0201

0.0264

microtubule cytoskeleton organization,cell cycle,c...

cytoplasm,microtubule organizing center,spindle,ga...

33

27

33

_LHDNLIISDLENTVK_.3|_LHDNLIISDLENTVK_.2|_IKPENSSSA...

SEN / CTL

P52565

Rho GDP-dissociation inhibitor 1

ARHGDIA

1.15

0.97

0.00449

0.00892

movement of cell or subcellular component,negative...

Rho GDP-dissociation inhibitor activity,GTPase act...

cytosol,cytoskeleton,extracellular exosome

29

15

29

_AEEYEFLTPVEEAPK_.2|_AEEYEFLTPVEEAPK_.3|_SIQEIQELD...

SEN / CTL

P15144

Aminopeptidase N

ANPEP

1.14

2.1

0.0028

0.00667

angiogenesis,proteolysis,cell differentiation,pept...

virus receptor activity,aminopeptidase activity,re...

extracellular space,lysosomal membrane,endoplasmic...

99

60

99

_ELWILNR_.2|_YLSYTLNPDLIR_.2|_YLSYTLNPDLIR_.3|_QVT...

SEN / CTL

Q6NZI2

Polymerase I and transcript release factor

PTRF

1.12

1.1

0.00142

0.0041

regulation of transcription, DNA-templated,transcr...

protein binding,rRNA primary transcript binding,po...

nucleus,nucleoplasm,cytoplasm,mitochondrion,endopl...

23

15

23

_KLEVNEAELLR_.3|_KLEVNEAELLR_.2|_VMIYQDEVKLPAK_.3|...

SEN / CTL

P62158

Calmodulin

CALM1

1.1

0.97

1e-7

7.18e-7

G2/M transition of mitotic cell cycle,MAPK cascade...

Ras guanyl-nucleotide exchange factor activity,cal...

spindle pole,extracellular region,nucleus,nucleopl...

30

13

30

_VFDKDGNGYISAAELR_.3|_VFDKDGNGYISAAELR_.2|_EAFSLFD...

SEN / CTL

P42785

Lysosomal Pro-X carboxypeptidase

PRCP

1.1

0.52

0.00888

0.0148

regulation of thyroid hormone mediated signaling p...

serine-type carboxypeptidase activity,protein bind...

lysosome,plasma membrane,basal part of cell,extrac...

19

11

19

_NALDPMSVLLAR_.2|_NALDPMSVLLAR_.3|_NALDPM[+16]SVLL...

SEN / CTL

P49368

T-complex protein 1 subunit gamma

CCT3

1.09

1.93

0.00207

0.00538

protein folding,'de novo' protein folding,binding ...

protein binding,ATP binding,protein binding involv...

zona pellucida receptor complex,cytoplasm,cytosol,...

102

49

102

_AVAQALEVIPR_.2|_TAVETAVLLLR_.2|_EILSEVER_.2|_SMIE...

SEN / CTL

P12429

Annexin A3

ANXA3

1.09

1.23

0.00425

0.00866

phagocytosis,positive regulation of endothelial ce...

calcium ion binding,calcium-dependent phospholipid...

cytoplasm,plasma membrane,membrane,axon,dendrite,p...

45

31

45

_SEIDLLDIR_.2|_MLISILTER_.2|_GAGTNEDALIEILTTR_.3|_...

SEN / CTL

Q9NVJ2

ADP-ribosylation factor-like protein 8B

ARL8B

1.08

1.5

0.000286

0.00101

cell cycle,chromosome segregation,small GTPase med...

GTPase activity,protein binding,GTP binding,GDP bi...

cytoplasm,membrane,midbody,late endosome membrane,...

17

10

17

_MNLSAIQDR_.2|_EIC[+57]C[+57]YSISC[+57]K_.2|_DLPNA...

SEN / CTL

Q5K4L6

Long-chain fatty acid transport protein 3

SLC27A3

1.04

0.6

0.018

0.0245

long-chain fatty acid metabolic process

nucleotide binding,long-chain fatty acid-CoA ligas...

membrane,integral component of membrane,mitochondr...

17

14

17

_YLVNQPPSK_.2|_AAHTFLIHGSR_.3|_AAHTFLIHGSR_.2|_LAE...

SEN / CTL

P63096

Guanine nucleotide-binding protein G(i) subunit alpha-1

GNAI1

1.03

0.66

0.0252

0.0307

protein folding,cell cycle,G-protein coupled recep...

magnesium ion binding,G-protein coupled receptor b...

nucleus,cytoplasm,lysosomal membrane,centrosome,he...

9

7

9

_IAQPNYIPTQQDVLR_.2|_IAQPNYIPTQQDVLR_.3|_IIHEAGYSE...

SEN / CTL

P60903

Protein S100-A10

S100A10

1.02

1.18

0.00000258

0.0000149

membrane raft assembly,membrane budding,positive r...

calcium ion binding,protein binding,protein homodi...

extrinsic component of plasma membrane,extracellul...

32

12

32

_EFPGFLENQKDPLAVDK_.3|_EFPGFLENQKDPLAVDK_.2|_FAGDK...

SEN / CTL

P83731

60S ribosomal protein L24

RPL24

1

0.86

0.000455

0.00155

ribosomal large subunit assembly,nuclear-transcrib...

RNA binding,structural constituent of ribosome,pro...

cytoplasm,cytosol,cell-cell adherens junction,memb...

16

10

16

_QINWTVLYR_.2|_VFQFLNAK_.2|_AITGASLADIMAK_.2|_AITG...

SEN / CTL

P60174

Triosephosphate isomerase

TPI1

0.99

1.52

1.96e-14

2.59e-13

gluconeogenesis,glycolytic process,pentose-phospha...

triose-phosphate isomerase activity,protein bindin...

extracellular space,nucleus,cytosol,extracellular ...

70

37

70

_IAVAAQNC[+57]YK_.2|_VVLAYEPVWAIGTGK_.2|_VVLAYEPVW...

SEN / CTL

Q9UBI6

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12

GNG12

0.99

1.44

0.00622

0.0112

signal transduction,G-protein coupled receptor sig...

signal transducer activity,protein binding,PDZ dom...

heterotrimeric G-protein complex,actin filament,pl...

10

6

10

_SDPLLIGIPTSENPFK_.2|_SDPLLIGIPTSENPFK_.3|_ASADLMS...

SEN / CTL

O75367

Q9P0M6

Core histone macro-H2A.1;Core histone macro-H2A.2

H2AFY

H2AFY2

0.97

1.08

0.0378

0.0408

negative regulation of transcription from RNA poly...

rDNA binding,RNA polymerase II regulatory region s...

nuclear chromosome,nuclear chromosome, telomeric r...

2

2

2

_AGVIFPVGR_.2|_HILLAVANDEELNQLLK_.3

SEN / CTL

P19013

Keratin, type II cytoskeletal 4

KRT4

0.97

1.64

0.038

0.0409

cytoskeleton organization,epithelial cell differen...

structural molecule activity,protein binding

nucleus,intermediate filament,cell surface,keratin...

28

26

28

_LALDIEIATYR_.2|_FASFIDKVQFLEQQNK_.3|_NLDLDSIIAEVR...

SEN / CTL

P02545

Prelamin-A/C

LMNA

0.96

1.19

0.00000255

0.0000148

mitotic nuclear envelope disassembly,mitotic nucle...

structural molecule activity,protein binding

nucleus,nuclear envelope,lamin filament,nucleoplas...

142

85

142

_ITESEEVVSR_.2|_LAVYIDR_.2|_LAVYIDR_.1|_LQLELSK_.2...

SEN / CTL

P23526

Adenosylhomocysteinase

AHCY

0.94

1.69

0.0047

0.0093

sulfur amino acid metabolic process,response to hy...

adenosylhomocysteinase activity,protein binding,ad...

nucleus,cytoplasm,cytosol,melanosome,neuron projec...

62

34

62

_SKFDNLYGC[+57]R_.3|_SKFDNLYGC[+57]R_.2|_IILLAEGR_...

SEN / CTL

P15822

Zinc finger protein 40

HIVEP1

0.94

0.64

0.0298

0.0351

negative regulation of transcription from RNA poly...

RNA polymerase II distal enhancer sequence-specifi...

nucleus,mitochondrion

58

50

58

_DTQQLAFPSLK_.2|_VGVTGHVPLLER_.3|_KLENFENHKK_.3|_V...

SEN / CTL

Q9NQH7

Probable Xaa-Pro aminopeptidase 3

XPNPEP3

0.94

0.67

0.036

0.0394

glomerular filtration,protein processing

aminopeptidase activity,metallopeptidase activity,...

mitochondrion,extracellular exosome

14

10

14

_AILFVPR_.2|_GVQQLIQR_.2|_YC[+57]PHHVGHYLGMDVHDTPD...

SEN / CTL

P0DMV8

P0DMV9

Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B

HSPA1A

HSPA1B

0.93

1.73

0.000108

0.00044

positive regulation of gene expression,negative re...

virus receptor activity,G-protein coupled receptor...

nucleoplasm,cytoplasm,mitochondrion,centriole,cyto...

132

60

132

_TTPSYVAFTDTER_.2|_TTPSYVAFTDTER_.3|_VEIIANDQGNR_....

SEN / CTL

P18669

Phosphoglycerate mutase 1

PGAM1

0.93

1.6

0.000164

0.000635

gluconeogenesis,glycolytic process,regulation of g...

bisphosphoglycerate mutase activity,phosphoglycera...

cytoplasm,cytosol,membrane,myelin sheath,extracell...

83

38

83

_ALPFWNEEIVPQIK_.2|_ALPFWNEEIVPQIK_.3|_YADLTEDQLPS...

SEN / CTL

P06396

Gelsolin

GSN

0.92

1.46

0.000277

0.00099

phagocytosis, engulfment,positive regulation of ge...

actin binding,calcium ion binding,protein binding,...

podosome,extracellular region,extracellular space,...

102

53

102

_HVVPNEVVVQR_.3|_HVVPNEVVVQR_.2|_AGALNSNDAFVLK_.2|...

SEN / CTL

P20340

Q14964

Q9NRW1

Ras-related protein Rab-6A;Ras-related protein Rab-39A;Ras-related protein Rab-6B

RAB6A

RAB39A

RAB6B

0.92

0.47

0.0299

0.0351

protein targeting to Golgi,retrograde vesicle-medi...

GTPase activity,protein binding,GTP binding,protei...

Golgi membrane,endoplasmic reticulum membrane,Golg...

1

1

1

_LQLWDTAGQER_.2

SEN / CTL

P62805

Histone H4

HIST1H4A

0.91

1.34

5.51e-9

5.09e-8

chromatin silencing at rDNA,double-strand break re...

DNA binding,protein binding,protein domain specifi...

nuclear chromosome,nuclear chromosome, telomeric r...

44

24

44

_DNIQGITKPAIR_.3|_DNIQGITKPAIR_.2|_ISGLIYEETR_.2|_...

SEN / CTL

P47756

F-actin-capping protein subunit beta

CAPZB

0.9

1.32

0.00638

0.0114

movement of cell or subcellular component,cytoskel...

actin binding,actin filament binding,cadherin bind...

cytosol,cytoskeleton,actin filament,cell-cell adhe...

40

22

40

_STLNEIYFGK_.2|_LVEDMENKIR_.3|_QMEKDETVSDC[+57]SPH...

SEN / CTL

Q14195

Dihydropyrimidinase-related protein 3

DPYSL3

0.9

1.13

0.0325

0.0371

positive regulation of neuron projection developme...

protein binding,hydrolase activity, acting on carb...

extracellular space,cytosol,lamellipodium,growth c...

39

27

39

_QIGDNLIVPGGVK_.2|_SAADLISQAR_.2|_IFNLYPR_.2|_QEVQ...

SEN / CTL

O43396

Thioredoxin-like protein 1

TXNL1

0.9

0.64

0.0351

0.0388

glycerol ether metabolic process,cellular response...

thioredoxin-disulfide reductase activity,protein d...

proteasome complex,nucleus,cytoplasm,extracellular...

33

21

33

_IFINLPR_.2|_EDGIVPLR_.2|_IKQHLENDPGSNEDTDIPK_.4|_...

SEN / CTL

P13489

Ribonuclease inhibitor

RNH1

0.89

1.43

0.0114

0.0179

mRNA catabolic process,negative regulation of cata...

protein binding,ribonuclease inhibitor activity

nucleoplasm,cytoplasm,angiogenin-PRI complex,extra...

55

31

55

_LDDC[+57]GLTEAR_.2|_VNPALAELNLR_.2|_VNPALAELNLR_....

SEN / CTL

Q14108

Lysosome membrane protein 2

SCARB2

0.88

1.13

0.00000499

0.0000272

protein targeting to lysosome,positive regulation ...

virus receptor activity,protein binding,enzyme bin...

lysosomal membrane,focal adhesion,membrane,integra...

24

15

24

_GETPRVEEVGPYTYR_.3|_KLDDFVETGDIR_.3|_KLDDFVETGDIR...

SEN / CTL

Q9H082

Ras-related protein Rab-33B

RAB33B

0.88

0.42

0.00936

0.0155

protein targeting to Golgi,intra-Golgi vesicle-med...

GTPase activity,protein binding,GTP binding

Golgi membrane,Golgi apparatus,Golgi lumen,extrace...

5

4

5

_IQLWDTAGQER_.2|_IKIQLWDTAGQER_.3|_IKIQLWDTAGQER_....

SEN / CTL

P16401

Histone H1.5

HIST1H1B

0.88

1.91

0.0177

0.0241

negative regulation of transcription from RNA poly...

chromatin DNA binding,histone deacetylase binding,...

nucleosome,nuclear chromatin,nuclear heterochromat...

17

13

17

_ALAAGGYDVEKNNSR_.3|_ALAAGGYDVEK_.2|_KATGPPVSELITK...

SEN / CTL

Q9UEU0

Vesicle transport through interaction with t-SNAREs homolog 1B

VTI1B

0.88

0.56

0.0242

0.0296

protein targeting to vacuole,ER to Golgi vesicle-m...

SNARE binding,SNAP receptor activity,protein bindi...

cytoplasm,lysosomal membrane,endoplasmic reticulum...

7

7

7

_GLHEDLQGVPER_.3|_LLGTAGTEEK_.2|_STPLTATPGGR_.2|_Y...

SEN / CTL

Q06830

Peroxiredoxin-1

PRDX1

0.87

1.21

8.05e-8

5.95e-7

response to reactive oxygen species,skeletal syste...

peroxidase activity,protein binding,thioredoxin pe...

extracellular space,nucleus,cytoplasm,mitochondrio...

60

29

60

_GLFIIDDKGILR_.3|_GLFIIDDKGILR_.2|_DISLSDYK_.2|_QI...

SEN / CTL

P51149

Ras-related protein Rab-7a

RAB7A

0.87

1.37

0.0000423

0.000192

protein targeting to lysosome,endocytosis,epiderma...

GTPase activity,protein binding,GTP binding,GDP bi...

autophagosome membrane,lysosome,lysosomal membrane...

34

23

34

_EAINVEQAFQTIAR_.2|_EAINVEQAFQTIAR_.3|_ATIGADFLTK_...

SEN / CTL

P04908

Q7L7L0

Q93077

Histone H2A type 1-B/E;Histone H2A type 3;Histone H2A type 1-C

HIST1H2AB

HIST3H2A

HIST1H2AC

0.87

1.82

0.00282

0.00668

chromatin silencing,negative regulation of cell pr...

DNA binding,protein heterodimerization activity;DN...

nucleosome,nuclear chromatin,nucleus,extracellular...

11

6

11

_AGLQFPVGR_.2|_VTIAQGGVLPNIQAVLLPK_.2|_VTIAQGGVLPN...

SEN / CTL

P47897

Glutamine--tRNA ligase

QARS

0.87

0.57

0.0266

0.0322

tRNA aminoacylation for protein translation,glutam...

RNA binding,glutamine-tRNA ligase activity,protein...

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

100

58

100

_AMAVLESLR_.2|_AM[+16]AVLESLR_.2|_LEADLEK_.2|_QHLE...

SEN / CTL

P07355

Annexin A2

ANXA2

0.86

1.61

2.23e-17

3.63e-16

angiogenesis,membrane raft assembly,positive regul...

protease binding,calcium ion binding,protein bindi...

ruffle,basement membrane,extracellular space,nucle...

99

49

99

_QDIAFAYQR_.2|_GVDEVTIVNILTNR_.2|_GVDEVTIVNILTNR_....

SEN / CTL

P27105

Erythrocyte band 7 integral membrane protein

STOM

0.86

1.46

5.35e-8

4.26e-7

positive regulation by host of viral genome replic...

protein binding,protein homodimerization activity,...

extracellular space,cytoplasm,mitochondrion,endopl...

38

20

38

_LLAQTTLR_.2|_LPVQLQR_.2|_VQNATLAVANITNADSATR_.3|_...

SEN / CTL

P46940

Ras GTPase-activating-like protein IQGAP1

IQGAP1

0.86

1.56

0.024

0.0295

regulation of cytokine production,signal transduct...

GTPase inhibitor activity,GTPase activator activit...

ruffle,nucleus,cytoplasm,cytosol,microtubule,actin...

200

128

200

_LIVDVIR_.2|_ILAIGLINEALDEGDAQK_.3|_ILAIGLINEALDEG...

SEN / CTL

P17980

26S protease regulatory subunit 6A

PSMC3

0.85

1.48

0.0017

0.00475

MAPK cascade,protein polyubiquitination,blastocyst...

transcription coactivator activity,transcription c...

proteasome complex,cytoplasmic mRNA processing bod...

62

35

62

_MSTEEIIQR_.2|_M[+16]STEEIIQR_.2|_LLDSEIK_.2|_KIEF...

SEN / CTL

P01031

Complement C5

C5

0.85

0.86

0.0118

0.0181

activation of MAPK activity,in utero embryonic dev...

endopeptidase inhibitor activity,receptor binding,...

extracellular region,membrane attack complex,extra...

93

68

93

_VFQFLEK_.2|_VTC[+57]TNAELVK_.2|_TGEAVAEK_.2|_FSYS...

SEN / CTL

P15311

Ezrin

EZR

0.85

1.22

0.0174

0.0238

negative regulation of transcription from RNA poly...

actin binding,protein binding,microtubule binding,...

ruffle,immunological synapse,uropod,extracellular ...

90

50

90

_IALLEEAR_.2|_AKFYPEDVAEELIQDITQK_.3|_AKFYPEDVAEEL...

SEN / CTL

Q9NZM3

Intersectin-2

ITSN2

0.84

0.41

0.0101

0.0165

endocytosis,positive regulation of signal transduc...

SH3/SH2 adaptor activity,Rho guanyl-nucleotide exc...

cytoplasm,centrosome,extracellular exosome

29

27

29

_SMSGYLSGFQAR_.2|_NLHLELEALNGK_.3|_SILENTPESHADHSS...

SEN / CTL

O43790

Q14533

Keratin, type II cuticular Hb6;Keratin, type II cuticular Hb1

KRT86

KRT81

0.84

1.91

0.0181

0.0246

;

structural molecule activity,protein binding;struc...

extracellular space,keratin filament,extracellular...

8

8

8

_LGLDIEIATYR_.2|_DVDC[+57]AYLR_.2|_AQYDDIVTR_.2|_A...

SEN / CTL

P04899

Guanine nucleotide-binding protein G(i) subunit alpha-2

GNAI2

0.83

1.35

8.21e-8

5.98e-7

activation of MAPKK activity,adenosine receptor si...

G-protein coupled receptor binding,GTPase activity...

nucleoplasm,cytoplasm,centrosome,cytosol,heterotri...

44

27

44

_IAQSDYIPTQQDVLR_.2|_IAQSDYIPTQQDVLR_.3|_QLFALSC[+...

SEN / CTL

P50995

Annexin A11

ANXA11

0.82

1.53

0.00000108

0.00000675

phagocytosis,cell cycle,cell division,response to ...

calcium ion binding,protein binding,calcium-depend...

nuclear envelope,nucleoplasm,cytoplasm,spindle,mem...

45

29

45

_SETDLLDIR_.2|_GVGTDEAC[+57]LIEILASR_.3|_GVGTDEAC[...

SEN / CTL

P09525

Annexin A4

ANXA4

0.82

1.69

0.0000471

0.000209

regulation of transcription from RNA polymerase II...

phospholipase inhibitor activity,calcium ion bindi...

nucleus,cytoplasm,plasma membrane,cell surface,ves...

70

45

70

_FLTVLC[+57]SR_.2|_GLGTDEDAIISVLAYR_.2|_GLGTDEDAII...

SEN / CTL

Q12884

Prolyl endopeptidase FAP

FAP

0.82

0.55

0.0289

0.0342

angiogenesis,proteolysis,cell adhesion,regulation ...

protease binding,endopeptidase activity,metalloend...

extracellular space,cytoplasm,plasma membrane,foca...

5

5

5

_GNELPRPIQYLC[+57]WSPVGSK_.3|_LAYVYQNNIYLK_.2|_YYA...

SEN / CTL

Q9Y281

Cofilin-2

CFL2

0.81

1.98

0.0335

0.0379

skeletal muscle tissue development,actin filament ...

protein binding,actin filament binding

extracellular space,actin cytoskeleton,nuclear mat...

27

17

27

_YALYDATYETK_.2|_YALYDATYETK_.3|_ESKKEDLVFIFWAPESA...

SEN / CTL

P09619

Platelet-derived growth factor receptor beta

PDGFRB

0.8

1.24

0.000261

0.000954

MAPK cascade,glycosaminoglycan biosynthetic proces...

protein tyrosine kinase activity,platelet activati...

nucleus,cytoplasm,plasma membrane,focal adhesion,c...

19

17

19

_IC[+57]DFGLAR_.2|_YVSELTLVR_.2|_YQQVDEEFLR_.2|_VL...

SEN / CTL

Q16881

Thioredoxin reductase 1, cytoplasmic

TXNRD1

0.79

1.23

0.000547

0.00178

response to reactive oxygen species,response to ox...

thioredoxin-disulfide reductase activity,protein b...

nucleus,mitochondrion,cytosol,extracellular exosom...

59

36

59

_VMVLDFVTPTPLGTR_.2|_VM[+16]VLDFVTPTPLGTR_.2|_VMVL...

SEN / CTL

P08758

Annexin A5

ANXA5

0.78

1.9

6.25e-8

4.83e-7

signal transduction,blood coagulation,response to ...

phospholipase inhibitor activity,calcium ion bindi...

intracellular,cytoplasm,focal adhesion,external si...

70

45

70

_VLTEIIASR_.2|_GLGTDEESILTLLTSR_.3|_GLGTDEESILTLLT...

SEN / CTL

P11279

Lysosome-associated membrane glycoprotein 1

LAMP1

0.77

1.75

0.00793

0.0137

granzyme-mediated apoptotic signaling pathway,posi...

virus receptor activity,protein binding,enzyme bin...

cytoplasm,lysosome,lysosomal membrane,late endosom...

13

9

13

_TVESITDIR_.2|_ALQATVGNSYK_.2|_FFLQGIQLNTILPDARDPA...

SEN / CTL

P62491

Q15907

Ras-related protein Rab-11A;Ras-related protein Rab-11B

RAB11A

RAB11B

0.76

1.17

0.0449

0.0462

cytokinesis,renal water homeostasis,mitotic metaph...

GTPase activity,protein binding,GTP binding,microt...

spindle pole,mitochondrion,multivesicular body,Gol...

3

3

3

_AQIWDTAGQER_.2|_VVLIGDSGVGK_.2|_STIGVEFATR_.2

SEN / CTL

P54652

Heat shock-related 70 kDa protein 2

HSPA2

0.75

1.51

0.000535

0.00176

response to unfolded protein,male meiosis,male mei...

protein binding,ATP binding,enzyme binding,unfolde...

synaptonemal complex,male germ cell nucleus,nucleu...

43

31

43

_STAGDTHLGGEDFDNR_.3|_STAGDTHLGGEDFDNR_.2|_ARFEELN...

SEN / CTL

Q9BZZ5

Apoptosis inhibitor 5

API5

0.75

0.28

0.00363

0.00778

apoptotic process,negative regulation of apoptotic...

protein binding,fibroblast growth factor binding,p...

nucleus,nucleoplasm,spliceosomal complex,cytoplasm...

42

33

42

_TLPDEVLTK_.2|_DLFHIPPSYK_.3|_DLFHIPPSYK_.2|_TGEAL...

SEN / CTL

P62873

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

GNB1

0.75

1.12

0.00737

0.013

protein folding,signal transduction,adenylate cycl...

GTPase activity,signal transducer activity,protein...

photoreceptor inner segment,intracellular,lysosoma...

16

10

16

_LFVSGAC[+57]DASAK_.2|_ELAGHTGYLSC[+57]C[+57]R_.3|...

SEN / CTL

Q16555

Dihydropyrimidinase-related protein 2

DPYSL2

0.74

0.89

0.000022

0.000103

response to amphetamine,nucleobase-containing comp...

dihydropyrimidinase activity,protein binding,micro...

mitochondrion,cytosol,dendrite,growth cone,neurona...

74

35

74

_GSPLVVISQGK_.2|_QIGENLIVPGGVK_.2|_VFNLYPR_.2|_GLY...

SEN / CTL

P62942

Peptidyl-prolyl cis-trans isomerase FKBP1A

FKBP1A

0.74

0.41

0.0154

0.0222

protein peptidyl-prolyl isomerization,heart morpho...

peptidyl-prolyl cis-trans isomerase activity,signa...

cytoplasm,endoplasmic reticulum membrane,cytosol,t...

23

8

23

_GVQVETISPGDGR_.2|_GVQVETISPGDGR_.3|_RGQTC[+57]VVH...

SEN / CTL

P0CG39

POTE ankyrin domain family member J

POTEJ

0.73

0.56

0.0436

0.0453

retina homeostasis

extracellular space,extracellular exosome

3

2

3

_LC[+57]YVALDFEQEMAMVASSSSLEK_.3|_LC[+57]YVALDFEQE...

SEN / CTL

P50914

60S ribosomal protein L14

RPL14

0.72

1.06

0.00237

0.0059

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

cytoplasm,cytosol,cell-cell adherens junction,memb...

14

10

14

_LVAIVDVIDQNR_.2|_LVAIVDVIDQNR_.3|_ALVDGPC[+57]TQV...

SEN / CTL

P08134

Rho-related GTP-binding protein RhoC

RHOC

0.72

0.25

0.00297

0.00691

cytokinesis,small GTPase mediated signal transduct...

signal transducer activity,protein binding,GTP bin...

nucleus,cytosol,plasma membrane,cleavage furrow,ex...

7

5

7

_ISAFGYLEC[+57]SAK_.2|_ISAFGYLEC[+57]SAK_.3|_QEPVR...

SEN / CTL

Q14204

Cytoplasmic dynein 1 heavy chain 1

DYNC1H1

0.71

2.56

0.0103

0.0168

G2/M transition of mitotic cell cycle,ER to Golgi ...

microtubule motor activity,protein binding,ATP bin...

centrosome,cytosol,cytoplasmic dynein complex,micr...

531

337

531

_ILDDDTIITTLENLKR_.3|_ILDDDTIITTLENLKR_.2|_FGNPLLV...

SEN / CTL

P04792

Heat shock protein beta-1

HSPB1

0.71

1.66

0.0167

0.023

retina homeostasis,regulation of protein phosphory...

protein kinase C binding,protein binding,protein k...

proteasome complex,extracellular space,nucleus,cyt...

44

23

44

_LFDQAFGLPR_.2|_QLSSGVSEIR_.2|_LATQSNEITIPVTFESR_....

SEN / CTL

P61106

Ras-related protein Rab-14

RAB14

0.71

0.96

0.0425

0.0446

Golgi to endosome transport,small GTPase mediated ...

GTPase activity,protein binding,GTP binding,GDP bi...

Golgi membrane,intracellular,lysosome,lysosomal me...

36

21

36

_YIIIGDMGVGK_.2|_YIIIGDM[+16]GVGK_.2|_NLTNPNTVIILI...

SEN / CTL

Q96JM7

Lethal(3)malignant brain tumor-like protein 3

L3MBTL3

0.69

0.39

0.0167

0.023

transcription, DNA-templated,regulation of transcr...

molecular_function,protein binding

nucleus

7

7

7

_TLITPPGYPNVK_.2|_RTDANESSSSPEIR_.3|_EHQSFPYNK_.2|...

SEN / CTL

P08133

Annexin A6

ANXA6

0.68

1.5

1.36e-16

2.13e-15

calcium ion transport,regulation of muscle contrac...

calcium ion binding,protein binding,GTP binding,ca...

mitochondrion,lysosomal membrane,focal adhesion,me...

121

72

121

_ALIEILATR_.2|_SEIDLLNIRR_.3|_LVFDEYLK_.2|_C[+57]L...

SEN / CTL

P28799

Granulins

GRN

0.67

1.2

0.0211

0.0272

signal transduction

cytokine activity,protein binding,growth factor ac...

extracellular space,intracellular membrane-bounded...

23

18

23

_SRC[+57]PDGSTC[+57]C[+57]ELPSGK_.3|_QGWAC[+57]C[+...

SEN / CTL

Q9H4G4

Golgi-associated plant pathogenesis-related protein 1

GLIPR2

0.67

0.76

0.0214

0.0274

positive regulation of epithelial cell migration,p...

protein homodimerization activity

Golgi membrane,extracellular exosome

11

9

11

_ASASDGSSFVVAR_.2|_EAQQYSEALASTR_.2|_QFHNEVLK_.2|_...

SEN / CTL

P61019

Ras-related protein Rab-2A

RAB2A

0.66

1.51

0.0239

0.0294

Golgi organization,small GTPase mediated signal tr...

GTPase activity,protein binding,GTP binding,GDP bi...

Golgi membrane,nucleus,lysosomal membrane,endoplas...

32

17

32

_LQIWDTAGQESFR_.2|_LQIWDTAGQESFR_.3|_GAAGALLVYDITR...

SEN / CTL

P60866

40S ribosomal protein S20

RPS20

0.66

1.36

0.043

0.045

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,protein binding...

nucleoplasm,cytoplasm,cytosol,membrane,cytosolic s...

10

5

10

_TPVEPEVAIHR_.3|_TPVEPEVAIHR_.2|_VC[+57]ADLIR_.2|_...

SEN / CTL

P35222

Catenin beta-1

CTNNB1

0.64

1.22

0.00383

0.00811

negative regulation of transcription from RNA poly...

RNA polymerase II transcription factor binding,RNA...

spindle pole,nucleus,nucleoplasm,transcription fac...

61

36

61

_AGDREDITEPAIC[+57]ALR_.3|_LVQLLVR_.2|_LLNDEDQVVVN...

SEN / CTL

P62241

40S ribosomal protein S8

RPS8

0.64

1.36

0.00474

0.00931

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,poly(A) RNA bin...

nucleus,nucleoplasm,cytoplasm,cytosol,focal adhesi...

39

23

39

_ELEFYLR_.2|_LLAC[+57]IASRPGQC[+57]GR_.3|_LLAC[+57...

SEN / CTL

P00338

L-lactate dehydrogenase A chain

LDHA

0.63

1.52

0.000587

0.00189

response to hypoxia,lactate metabolic process,pyru...

L-lactate dehydrogenase activity,protein binding,k...

nucleus,cytosol,cell-cell adherens junction,membra...

92

38

92

_VTLTSEEEAR_.2|_SADTLWGIQK_.2|_LVIITAGAR_.2|_FIIPN...

SEN / CTL

P67936

Tropomyosin alpha-4 chain

TPM4

0.63

1.54

0.00222

0.00569

osteoblast differentiation,movement of cell or sub...

calcium ion binding,protein binding,structural con...

stress fiber,podosome,cytosol,cytoskeleton,muscle ...

51

32

51

_IQLVEEELDRAQER_.3|_LATALQKLEEAEKAADESER_.4|_LATAL...

SEN / CTL

P62879

Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

GNB2

0.63

1.65

0.0141

0.0208

protein folding,G-protein coupled receptor signali...

GTPase activity,signal transducer activity,calcium...

extracellular space,lysosomal membrane,cytosol,pla...

31

18

31

_ELPGHTGYLSC[+57]C[+57]R_.3|_ELPGHTGYLSC[+57]C[+57...

SEN / CTL

P62937

Peptidyl-prolyl cis-trans isomerase A

PPIA

0.61

1.4

0.000529

0.00176

protein peptidyl-prolyl isomerization,RNA-dependen...

peptidyl-prolyl cis-trans isomerase activity,prote...

extracellular region,extracellular space,nucleus,c...

52

24

52

_VSFELFADKVPK_.3|_VSFELFADKVPK_.2|_VNPTVFFDIAVDGEP...

SEN / CTL

P63000

Ras-related C3 botulinum toxin substrate 1

RAC1

0.61

1.04

0.00068

0.00215

positive regulation of protein phosphorylation,aud...

GTPase activity,protein binding,GTP binding,Rab GT...

Golgi membrane,pericentriolar material,phagocytic ...

21

12

21

_TVFDEAIR_.2|_YLEC[+57]SALTQR_.2|_HHC[+57]PNTPIILV...

SEN / CTL

P13929

Beta-enolase

ENO3

0.6

0.61

0.0019

0.00509

gluconeogenesis,aging,response to drug,skeletal mu...

magnesium ion binding,phosphopyruvate hydratase ac...

phosphopyruvate hydratase complex,extracellular sp...

25

17

25

_VNQIGSVTESIQAC[+57]K_.2|_VNQIGSVTESIQAC[+57]K_.3|...

SEN / CTL

P61981

14-3-3 protein gamma

YWHAG

0.6

1.17

0.0342

0.0383

G2/M transition of mitotic cell cycle,negative reg...

protein kinase C binding,insulin-like growth facto...

mitochondrion,cytosol,focal adhesion,membrane,cyto...

36

21

36

_NVTELNEPLSNEER_.2|_NVTELNEPLSNEER_.3|_YLAEVATGEKR...

SEN / CTL

P18206

Vinculin

VCL

0.57

1.41

0.00000599

0.000031

morphogenesis of an epithelium,platelet degranulat...

dystroglycan binding,actin binding,structural mole...

podosome,extracellular region,cytosol,cytoskeleton...

192

102

192

_ELTPQVVSAAR_.2|_ALASQLQDSLK_.2|_SLGEISALTSK_.2|_I...

SEN / CTL

P06733

Alpha-enolase

ENO1

0.55

1.24

0.00000506

0.0000273

gluconeogenesis,transcription, DNA-templated,respo...

magnesium ion binding,DNA binding,phosphopyruvate ...

phosphopyruvate hydratase complex,extracellular sp...

115

54

115

_AAVPSGASTGIYEALELR_.3|_AAVPSGASTGIYEALELR_.2|_VNQ...

SEN / CTL

P31939

Bifunctional purine biosynthesis protein PURH

ATIC

0.55

0.41

0.0405

0.0428

brainstem development,nucleobase-containing compou...

IMP cyclohydrolase activity,phosphoribosylaminoimi...

mitochondrion,cytosol,cell-cell adherens junction,...

87

53

87

_LDFNLIR_.2|_DTSLETR_.2|_GVSQMPLR_.2|_GVSQM[+16]PL...

SEN / CTL

O60825

6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2

PFKFB2

0.54

0.35

0.0267

0.0322

fructose metabolic process,fructose 2,6-bisphospha...

6-phosphofructo-2-kinase activity,fructose-2,6-bis...

cytosol

63

46

63

_DMILNFAEQNSFK_.2|_DM[+16]ILNFAEQNSFK_.2|_HGESEFNL...

SEN / CTL

P04083

Annexin A1

ANXA1

0.52

1.48

0.0000149

0.0000734

DNA strand renaturation,neutrophil homeostasis,ada...

single-stranded DNA binding,single-stranded RNA bi...

cornified envelope,phagocytic cup,extracellular re...

69

38

69

_NALLSLAK_.2|_TPAQFDADELR_.2|_GLGTDEDTLIEILASR_.3|...

SEN / CTL

P61586

Transforming protein RhoA

RHOA

0.51

1.21

0.0116

0.018

transforming growth factor beta receptor signaling...

GTPase activity,protein binding,GTP binding,myosin...

endosome,endoplasmic reticulum membrane,cytosol,cy...

30

17

30

_HFC[+57]PNVPIILVGNKK_.4|_HFC[+57]PNVPIILVGNKK_.3|...

SEN / CTL

P08670

Vimentin

VIM

0.49

1.4

0.00000661

0.0000339

movement of cell or subcellular component,positive...

glycoprotein binding,double-stranded RNA binding,s...

cytoplasm,peroxisome,cytosol,cytoskeleton,intermed...

188

93

188

_EYQDLLNVK_.2|_ILLAELEQLK_.2|_ILLAELEQLKGQGK_.3|_I...

SEN / CTL

P61224

Ras-related protein Rap-1b

RAP1B

0.49

1.26

0.019

0.0254

Rap protein signal transduction,establishment of e...

GTPase activity,protein binding,GTP binding,GDP bi...

intracellular,lipid particle,cytosol,plasma membra...

32

18

32

_LVVLGSGGVGK_.2|_INVNEIFYDLVR_.2|_INVNEIFYDLVR_.3|...

SEN / CTL

P35579

Myosin-9

MYH9

0.43

1.86

0.0000104

0.0000522

meiotic spindle organization,cytokinesis,angiogene...

microfilament motor activity,motor activity,actin ...

stress fiber,ruffle,uropod,nucleus,cytoplasm,spind...

487

247

487

_VVFQEFR_.2|_ALELDSNLYR_.2|_QLLQANPILEAFGNAK_.2|_Q...

SEN / CTL

P68104

Q5VTE0

Elongation factor 1-alpha 1;Putative elongation factor 1-alpha-like 3

EEF1A1

EEF1A1P5

0.42

1.71

0.0184

0.0248

transcription, DNA-templated,regulation of transcr...

tRNA binding,translation elongation factor activit...

extracellular space,nucleus,nucleolus,cytoplasm,cy...

24

16

24

_IGGIGTVPVGR_.2|_QTVAVGVIK_.2|_EHALLAYTLGVK_.3|_EH...

SEN / CTL

P68032

Actin, alpha cardiac muscle 1

ACTC1

0.3

1.77

0.0206

0.0268

apoptotic process,positive regulation of gene expr...

ATP binding,ATPase activity,myosin binding

extracellular space,cytoplasm,cytosol,actin filame...

48

27

48

_SYELPDGQVITIGNER_.2|_SYELPDGQVITIGNER_.3|_AGFAGDD...

SEN / CTL

Q09666

Neuroblast differentiation-associated protein AHNAK

AHNAK

0.28

1.54

0.00154

0.00437

regulation of RNA splicing,protein oligomerization...

protein binding,S100 protein binding,poly(A) RNA b...

nucleus,cytoplasm,lysosomal membrane,cytosol,plasm...

666

433

666

_LPTGQISGPEIK_.2|_ISMPEVDLNLKGPK_.3|_LNVGAPDVTLR_....

SEN / CTL

P21333

Filamin-A

FLNA

0.22

1.55

0.00604

0.011

platelet degranulation,adenylate cyclase-inhibitin...

G-protein coupled receptor binding,glycoprotein bi...

extracellular region,nucleus,nucleolus,cytoplasm,c...

388

207

388

_AWGPGLEGGVVGK_.2|_VHGPGIQSGTTNKPNKFTVETR_.5|_VHGP...

SEN / CTL

P68371

Tubulin beta-4B chain

TUBB4B

-0.2

1.39

0.0464

0.0473

G2/M transition of mitotic cell cycle,movement of ...

double-stranded RNA binding,GTPase activity,struct...

nucleus,cytosol,cytoskeleton,microtubule,extracell...

123

42

123

_YLTVAAVFR_.2|_NSSYFVEWIPNNVK_.2|_NSSYFVEWIPNNVK_....

SEN / CTL

P11021

78 kDa glucose-regulated protein

HSPA5

-0.24

1.51

0.0401

0.0426

ER overload response,activation of signaling prote...

glycoprotein binding,calcium ion binding,protein b...

nucleus,mitochondrion,endoplasmic reticulum,endopl...

133

68

133

_LTPEEIER_.2|_ITPSYVAFTPEGER_.2|_ITPSYVAFTPEGER_.3...

SEN / CTL

P60709

P63261

Actin, cytoplasmic 1;Actin, cytoplasmic 2

ACTB

ACTG1

-0.26

1.5

0.0401

0.0426

retina homeostasis,movement of cell or subcellular...

structural constituent of cytoskeleton,protein bin...

nuclear chromatin,extracellular space,nucleoplasm,...

37

13

37

_GYSFTTTAER_.2|_VAPEEHPVLLTEAPLNPK_.3|_VAPEEHPVLLT...

SEN / CTL

P06744

Glucose-6-phosphate isomerase

GPI

-0.39

1.56

0.0344

0.0384

angiogenesis,in utero embryonic development,mesode...

glucose-6-phosphate isomerase activity,cytokine ac...

extracellular space,nucleoplasm,cytoplasm,cytosol,...

107

49

107

_TLAQLNPESSLFIIASK_.2|_TLAQLNPESSLFIIASK_.3|_ILLAN...

SEN / CTL

O00560

Syntenin-1

SDCBP

-0.4

1.44

0.0106

0.0173

negative regulation of receptor internalization,pr...

frizzled binding,interleukin-5 receptor binding,pr...

extracellular space,nucleus,cytoplasm,endoplasmic ...

25

13

25

_DSTGHVGFIFK_.3|_DSTGHVGFIFK_.2|_SLMDHTIPEV_.2|_AN...

SEN / CTL

P01892

HLA class I histocompatibility antigen, A-2 alpha chain

HLA-A

-0.49

1.6

0.0396

0.0422

37

22

37

_WAAVVVPSGQEQR_.2|_MYGC[+57]DVGSDWR_.2|_AYLEGTC[+5...

SEN / CTL

P07237

Protein disulfide-isomerase

P4HB

-0.52

1.91

0.00196

0.0052

response to reactive oxygen species,peptidyl-proli...

protein disulfide isomerase activity,integrin bind...

extracellular region,endoplasmic reticulum,endopla...

113

62

113

_EADDIVNWLK_.2|_ILEFFGLK_.2|_THILLFLPK_.2|_VDATEES...

SEN / CTL

P08648

Integrin alpha-5

ITGA5

-0.59

1.33

0.00312

0.00711

angiogenesis,cell-substrate junction assembly,cell...

virus receptor activity,epidermal growth factor re...

ruffle,endoplasmic reticulum,Golgi apparatus,plasm...

32

23

32

_VTAPPEAEYSGLVR_.2|_SLQWFGATVR_.2|_ILEYAPC[+57]R_....

SEN / CTL

P56199

Integrin alpha-1

ITGA1

-0.6

1.5

0.0358

0.0393

activation of MAPK activity,muscle contraction,cel...

receptor binding,protein binding,collagen binding,...

acrosomal vesicle,plasma membrane,focal adhesion,i...

15

13

15

_ASQIIIPR_.2|_FGTAIAAVK_.2|_VIQDC[+57]EDENIQR_.2|_...

SEN / CTL

P28070

Proteasome subunit beta type-4

PSMB4

-0.62

1.79

0.0482

0.0484

MAPK cascade,protein polyubiquitination,stimulator...

lipopolysaccharide binding,threonine-type endopept...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

21

10

21

_FQIATVTEK_.2|_EVLEKQPVLSQTEAR_.3|_EVLEKQPVLSQTEAR...

SEN / CTL

O43707

Alpha-actinin-4

ACTN4

-0.64

1.31

0.00000318

0.0000177

response to hypoxia,platelet degranulation,protein...

RNA polymerase II regulatory region sequence-speci...

stress fiber,extracellular region,extracellular sp...

147

75

147

_ETTDTDTADQVIASFK_.2|_ETTDTDTADQVIASFK_.3|_DGLAFNA...

SEN / CTL

P36955

Pigment epithelium-derived factor

SERPINF1

-0.67

1.08

0.00489

0.00953

kidney development,multicellular organism developm...

serine-type endopeptidase inhibitor activity,prote...

extracellular region,basement membrane,extracellul...

26

20

26

_DTDTGALLFIGK_.2|_LAAAVSNFGYDLYR_.2|_LAAAVSNFGYDLY...

SEN / CTL

Q00610

Clathrin heavy chain 1

CLTC

-0.68

1.59

6.78e-13

8.55e-12

osteoblast differentiation,intracellular protein t...

double-stranded RNA binding,structural molecule ac...

spindle,cytosol,plasma membrane,focal adhesion,mem...

302

154

302

_LLLPWLEAR_.2|_IAAYLFK_.2|_C[+57]NEPAVWSQLAK_.2|_N...

SEN / CTL

P12814

Alpha-actinin-1

ACTN1

-0.7

1.54

5.81e-12

6.68e-11

platelet degranulation,actin filament organization...

double-stranded RNA binding,integrin binding,calci...

stress fiber,ruffle,extracellular region,extracell...

202

94

202

_VGWEQLLTTIAR_.2|_VGWEQLLTTIAR_.3|_EGLLLWC[+57]QR_...

SEN / CTL

P30101

Protein disulfide-isomerase A3

PDIA3

-0.7

1.36

6.35e-9

5.66e-8

antigen processing and presentation of peptide ant...

protein disulfide isomerase activity,cysteine-type...

nucleus,endoplasmic reticulum,endoplasmic reticulu...

120

62

120

_LAPEYEAAATR_.2|_YGVSGYPTLK_.2|_ELSDFISYLQR_.2|_EL...

SEN / CTL

Q15063

Periostin

POSTN

-0.73

2.29

0.0388

0.0416

skeletal system development,response to hypoxia,ne...

protein binding,heparin binding,metal ion binding,...

proteinaceous extracellular matrix,extracellular s...

80

48

80

_GFEPGVTNILK_.2|_AAAITSDILEALGR_.2|_IIDGVPVEITEKET...

SEN / CTL

P04216

Thy-1 membrane glycoprotein

THY1

-0.75

1.44

0.00829

0.0141

angiogenesis,negative regulation of protein kinase...

GTPase activator activity,integrin binding,protein...

endoplasmic reticulum,cytosol,plasma membrane,inte...

7

4

7

_VTSLTAC[+57]LVDQSLR_.2|_VTSLTAC[+57]LVDQSLR_.3|_V...

SEN / CTL

Q6NUM9

All-trans-retinol 13,14-reductase

RETSAT

-0.76

0.39

0.0124

0.0188

retinol metabolic process,oxidation-reduction proc...

oxidoreductase activity,all-trans-retinol 13,14-re...

nuclear outer membrane,endoplasmic reticulum membr...

12

11

12

_ATVQSVLLDSAGK_.2|_RVLVLEQHTK_.3|_GAC[+57]YGADHDLG...

SEN / CTL

P21589

5'-nucleotidase

NT5E

-0.77

1.6

6.65e-7

0.00000436

purine nucleotide catabolic process,AMP catabolic ...

nucleotide binding,5'-nucleotidase activity,metal ...

cytoplasm,plasma membrane,cell surface,membrane,an...

42

28

42

_TIVYLDGSSQSC[+57]R_.2|_VLPVGDEVVGIVGYTSK_.3|_VLPV...

SEN / CTL

P05387

60S acidic ribosomal protein P2

RPLP2

-0.77

1.14

0.0206

0.0268

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,protein binding...

cytosol,focal adhesion,membrane,cytosolic large ri...

30

13

30

_YVASYLLAALGGNSSPSAK_.3|_YVASYLLAALGGNSSPSAK_.2|_Y...

SEN / CTL

Q3ZCM7

Tubulin beta-8 chain

TUBB8

-0.78

1.52

0.0335

0.0379

oocyte maturation,spindle assembly involved in fem...

molecular_function,GTPase activity,structural cons...

cytoplasm,microtubule,extracellular exosome,meioti...

13

4

13

_LPTPTYGDLNHLVSATMSGVTTC[+57]LR_.3|_EAESC[+57]DC[+...

SEN / CTL

Q16851

UTP--glucose-1-phosphate uridylyltransferase

UGP2

-0.8

1.93

0.0499

0.0499

glycogen metabolic process,glycogen biosynthetic p...

UTP:glucose-1-phosphate uridylyltransferase activi...

nucleus,cytoplasm,cytosol,extracellular exosome

59

37

59

_LVEIAQVPK_.2|_GLPDNISSVLNK_.2|_EFPTVPLVK_.2|_SFEN...

SEN / CTL

P15529

Membrane cofactor protein

CD46

-0.83

0.57

0.0316

0.0364

adaptive immune response,T cell mediated immunity,...

virus receptor activity,complement binding,endopep...

inner acrosomal membrane,Golgi apparatus,plasma me...

6

5

6

_GSVAIWSGKPPIC[+57]EK_.3|_GSVAIWSGKPPIC[+57]EK_.2|...

SEN / CTL

Q9UNM6

26S proteasome non-ATPase regulatory subunit 13

PSMD13

-0.84

0.65

0.0446

0.046

MAPK cascade,protein polyubiquitination,stimulator...

structural molecule activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

52

35

52

_VLDLQQIK_.2|_GSIDEVDK_.2|_LEELYTK_.2|_VKSSDEAVILC...

SEN / CTL

P04075

Fructose-bisphosphate aldolase A

ALDOA

-0.85

1.32

7.5e-13

9.24e-12

platelet degranulation,fructose metabolic process,...

actin binding,fructose-bisphosphate aldolase activ...

extracellular region,extracellular space,nucleus,c...

110

51

110

_ALANSLAC[+57]QGK_.2|_ADDGRPFPQVIK_.3|_ADDGRPFPQVI...

SEN / CTL

Q9Y230

RuvB-like 2

RUVBL2

-0.88

0.5

0.0169

0.0232

box C/D snoRNP assembly,DNA repair,DNA recombinati...

RNA polymerase II core promoter sequence-specific ...

Swr1 complex,intracellular,nucleus,nucleoplasm,nuc...

67

42

67

_IGLETSLR_.2|_RAAGVVLEMIR_.3|_RAAGVVLEMIR_.2|_MIES...

SEN / CTL

Q07954

Prolow-density lipoprotein receptor-related protein 1

LRP1

-0.89

1.59

1.65e-9

1.61e-8

retinoid metabolic process,receptor-mediated endoc...

protease binding,receptor activity,low-density lip...

nucleolus,cytoplasm,lysosomal membrane,endosome,pl...

72

65

72

_GVGGAPPTVTLLR_.2|_LDGLC[+57]IPLR_.2|_SERPPIFEIR_....

SEN / CTL

O14818

Proteasome subunit alpha type-7

PSMA7

-0.9

1.72

0.0000219

0.000103

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

28

16

28

_ALLEVVQSGGK_.2|_LTVEDPVTVEYITR_.2|_LTVEDPVTVEYITR...

SEN / CTL

P51884

Lumican

LUM

-0.91

2.02

0.00408

0.00839

visual perception,response to organic cyclic compo...

extracellular matrix structural constituent,protei...

extracellular region,proteinaceous extracellular m...

29

21

29

_SVPMVPPGIK_.2|_ILGPLSYSK_.2|_SLEYLDLSFNQIAR_.2|_S...

SEN / CTL

P04004

Vitronectin

VTN

-0.93

1.31

0.0159

0.0226

receptor-mediated endocytosis,immune response,cell...

scavenger receptor activity,integrin binding,prote...

extracellular region,basement membrane,extracellul...

33

22

33

_DVWGIEGPIDAAFTR_.2|_DVWGIEGPIDAAFTR_.3|_LIRDVWGIE...

SEN / CTL

P20618

Proteasome subunit beta type-1

PSMB1

-0.94

1.26

3.1e-8

2.63e-7

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

37

17

37

_LSEGFSIHTR_.2|_AGGSASAMLQPLLDNQVGFK_.2|_AGGSASAML...

SEN / CTL

P98160

Basement membrane-specific heparan sulfate proteoglycan core protein

HSPG2

-0.96

1.66

9.1e-19

1.68e-17

retinoid metabolic process,angiogenesis,glycosamin...

calcium ion binding,protein binding,protein C-term...

extracellular region,basement membrane,extracellul...

239

163

239

_AGLSSGFIGC[+57]VR_.2|_LEGDTLIIPR_.2|_LPAVEPTDQAQY...

SEN / CTL

Q14764

Major vault protein

MVP

-0.98

1.65

7.79e-15

1.06e-13

protein transport,negative regulation of signaling...

protein binding,protein kinase binding,protein pho...

nucleus,nuclear pore,cytoplasm,cytoskeleton,membra...

128

78

128

_VLFAPMR_.2|_LFSVPDFVGDAC[+57]K_.2|_ELELVYAR_.2|_G...

SEN / CTL

Q06210

Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1

GFPT1

-0.98

1.02

0.0142

0.0209

carbohydrate metabolic process,fructose 6-phosphat...

glutamine-fructose-6-phosphate transaminase (isome...

cytosol,extracellular exosome

75

44

75

_EILETLIK_.2|_VIFLEDDDVAAVVDGR_.2|_VIFLEDDDVAAVVDG...

SEN / CTL

P27797

Calreticulin

CALR

-0.99

1.95

0.000064

0.000276

negative regulation of transcription from RNA poly...

complement component C1q binding,glycoprotein bind...

acrosomal vesicle,extracellular region,proteinaceo...

95

52

95

_EQFLDGDGWTSR_.2|_IKDPDASKPEDWDER_.4|_IKDPDASKPEDW...

SEN / CTL

Q9P265

Disco-interacting protein 2 homolog B

DIP2B

-0.99

0.78

0.0461

0.047

biological_process,metabolic process

molecular_function,catalytic activity

nucleus,cytoplasm,membrane,extracellular exosome

56

45

56

_EGSVMGVTVSR_.2|_TPLGGIHISQTK_.3|_TC[+57]VVVAEERPR...

SEN / CTL

P24821

Tenascin

TNC

-1

1.3

3.49e-12

4.1e-11

osteoblast differentiation,cell adhesion,negative ...

syndecan binding

extracellular region,basement membrane,interstitia...

105

77

105

_VSIYGVIR_.2|_AVDIPGLK_.2|_FTTDLDSPR_.2|_GLEPGQEYN...

SEN / CTL

Q14697

Neutral alpha-glucosidase AB

GANAB

-1

1.61

0.00184

0.00505

carbohydrate metabolic process,protein folding

carbohydrate binding,glucan 1,3-alpha-glucosidase ...

endoplasmic reticulum lumen,Golgi apparatus,membra...

141

70

141

_VVIIGAGKPAAVVLQTK_.3|_VVIIGAGKPAAVVLQTK_.2|_LSFQH...

SEN / CTL

P25788

Proteasome subunit alpha type-3

PSMA3

-1.01

1.24

0.00000194

0.0000114

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

25

15

25

_AVENSSTAIGIR_.2|_LFNVDRHVGMAVAGLLADAR_.4|_SLADIAR...

SEN / CTL

P26006

Integrin alpha-3

ITGA3

-1.01

1.62

0.000775

0.00241

neuron migration,cell-matrix adhesion,integrin-med...

glycoprotein binding,fibronectin binding,protease ...

plasma membrane,focal adhesion,integrin complex,ex...

39

26

39

_YLLLAGAPR_.2|_SETVLTC[+57]ATGR_.2|_EAGNPGSLFGYSVA...

SEN / CTL

Q13443

Disintegrin and metalloproteinase domain-containing protein 9

ADAM9

-1.01

1.16

0.0225

0.0283

activation of MAPKK activity,membrane protein ecto...

metalloendopeptidase activity,protein kinase C bin...

extracellular space,focal adhesion,cell surface,in...

24

22

24

_FLPGGTLC[+57]R_.2|_LQC[+57]ENVQEIPVFGIVPAIIQTPSR_...

SEN / CTL

O14948

Transcription factor EC

TFEC

-1.02

0.81

0.0473

0.048

transcription, DNA-templated,regulation of transcr...

DNA binding,transcription factor activity, sequenc...

nucleoplasm,cytoplasm

1

1

1

_THGLPTLASLGTVDLGAHVTK_.3

SEN / CTL

P42892

Endothelin-converting enzyme 1

ECE1

-1.03

1.12

0.00312

0.00711

positive regulation of receptor recycling,regulati...

endopeptidase activity,metalloendopeptidase activi...

lysosomal membrane,endosome,external side of plasm...

34

21

34

_TPESSHEGLITDPHSPSR_.4|_TPESSHEGLITDPHSPSR_.3|_DNF...

SEN / CTL

P53396

ATP-citrate synthase

ACLY

-1.04

2.34

0.000263

0.000954

acetyl-CoA biosynthetic process,citrate metabolic ...

ATP citrate synthase activity,protein binding,ATP ...

nucleoplasm,cytoplasm,cytosol,plasma membrane,citr...

146

85

146

_EILIPVFK_.2|_TIAIIAEGIPEALTR_.2|_TIAIIAEGIPEALTR_...

SEN / CTL

Q99685

Monoglyceride lipase

MGLL

-1.04

0.81

0.0455

0.0466

lipid metabolic process,fatty acid biosynthetic pr...

lysophospholipase activity,protein homodimerizatio...

nucleoplasm,endoplasmic reticulum membrane,cytosol...

28

16

28

_MVVSDFHVFVR_.2|_MVVSDFHVFVR_.3|_M[+16]VVSDFHVFVR_...

SEN / CTL

P28074

Proteasome subunit beta type-5

PSMB5

-1.06

2.02

0.00014

0.000555

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,centrosome,...

28

17

28

_DAYSGGAVNLYHVR_.3|_DAYSGGAVNLYHVR_.2|_ATAGAYIASQT...

SEN / CTL

O43852

Calumenin

CALU

-1.06

1.64

0.000193

0.000727

biological_process

calcium ion binding,protein binding

extracellular region,endoplasmic reticulum,endopla...

62

34

62

_EQFVEFR_.2|_WIYEDVER_.2|_TFDQLTPEESKER_.3|_IDGDKD...

SEN / CTL

P35556

Fibrillin-2

FBN2

-1.06

0.58

0.0149

0.0217

extracellular matrix disassembly,extracellular mat...

extracellular matrix structural constituent,calciu...

microfibril,extracellular region,extracellular mat...

5

5

5

_C[+57]WGIGTIPEAC[+57]PVR_.2|_RPDGEGC[+57]VDENEC[+...

SEN / CTL

P20700

Lamin-B1

LMNB1

-1.06

1.21

0.0311

0.0362

structural molecule activity,protein binding,phosp...

nuclear envelope,nuclear inner membrane,lamin fila...

98

60

98

_LLEGEEERLK_.3|_LQIELGK_.2|_KESDLNGAQIK_.3|_KESDLN...

SEN / CTL

P49720

Proteasome subunit beta type-3

PSMB3

-1.07

1.78

0.00274

0.00662

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,m...

31

13

31

_FGPYYTEPVIAGLDPK_.3|_FGPYYTEPVIAGLDPK_.2|_LYIGLAG...

SEN / CTL

Q8IVF2

Protein AHNAK2

AHNAK2

-1.07

0.54

0.0115

0.018

plasma membrane repair

protein binding

nucleus,cytoplasm,plasma membrane,Z disc,T-tubule,...

76

70

76

_VEADVSLPSMQGDLK_.2|_SIEASVHVSAPK_.3|_LPEGHVPEGAGL...

SEN / CTL

P39060

Collagen alpha-1(XVIII) chain

COL18A1

-1.07

1.82

0.0167

0.023

angiogenesis,endothelial cell morphogenesis,cell a...

structural molecule activity,metal ion binding

extracellular region,collagen trimer,basement memb...

46

31

46

_IFSFDGKDVLR_.3|_LQDLYSIVR_.2|_TEAPSATGQASSLLGGR_....

SEN / CTL

P21810

Biglycan

BGN

-1.09

1.57

0.00595

0.0109

blood vessel remodeling,negative regulation of pro...

protein kinase inhibitor activity,extracellular ma...

extracellular region,proteinaceous extracellular m...

37

23

37

_VVQC[+57]SDLGLK_.2|_IQAIELEDLLR_.2|_LAIQFGNYK_.2|...

SEN / CTL

P41221

Protein Wnt-5a

WNT5A

-1.11

0.33

0.00168

0.00471

activation of MAPK activity,establishment of plana...

transcription factor activity, sequence-specific D...

extracellular region,proteinaceous extracellular m...

2

2

2

_TC[+57]WLQLADFR_.2|_EGELSTC[+57]GC[+57]SR_.2

SEN / CTL

Q99584

Protein S100-A13

S100A13

-1.11

0.55

0.0107

0.0173

positive regulation of cell proliferation,regulati...

copper ion binding,calcium ion binding,protein bin...

extracellular space,nucleus,cytoplasm,cytosol,mast...

13

9

13

_ELVTQQLPHLLK_.3|_ELVTQQLPHLLK_.2|_DVGSLDEK_.2|_KD...

SEN / CTL

P59998

Actin-related protein 2/3 complex subunit 4

ARPC4

-1.13

1.3

0.0222

0.0283

actin filament polymerization,Arp2/3 complex-media...

structural constituent of cytoskeleton,protein bin...

cytosol,Arp2/3 protein complex,cell projection,ext...

18

12

18

_IVAEEFLK_.2|_AENFFILR_.2|_ELLLQPVTISR_.3|_ELLLQPV...

SEN / CTL

Q96AY3

Peptidyl-prolyl cis-trans isomerase FKBP10

FKBP10

-1.15

1.42

0.00012

0.000479

protein peptidyl-prolyl isomerization,chaperone-me...

peptidyl-prolyl cis-trans isomerase activity,calci...

endoplasmic reticulum lumen,endoplasmic reticulum ...

53

34

53

_EVQMGDFVR_.2|_EVQM[+16]GDFVR_.2|_IIIPPFLAYGEK_.2|...

SEN / CTL

P01033

Metalloproteinase inhibitor 1

TIMP1

-1.15

1.92

0.00267

0.00651

cell activation,platelet degranulation,aging,posit...

protease binding,cytokine activity,protein binding...

extracellular region,proteinaceous extracellular m...

11

7

11

_EPGLC[+57]TWQSLR_.2|_GFQALGDAADIR_.2|_LQDGLLHITTC...

SEN / CTL

Q99436

Proteasome subunit beta type-7

PSMB7

-1.15

1.64

0.00529

0.0101

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

33

16

33

_ITPLEIEVLEETVQTMDTS_.3|_ITPLEIEVLEETVQTM[+16]DTS_...

SEN / CTL

P15151

Poliovirus receptor

PVR

-1.16

0.79

0.0307

0.0359

positive regulation of natural killer cell mediate...

virus receptor activity,receptor activity,receptor...

extracellular space,cytoplasm,plasma membrane,inte...

6

5

6

_VQLTGEPVPMAR_.2|_VLAKPQNTAEVQK_.3|_RLEFVAAR_.2|_H...

SEN / CTL

P11166

Solute carrier family 2, facilitated glucose transporter member 1

SLC2A1

-1.19

1.43

0.00606

0.011

lactose biosynthetic process,protein complex assem...

glucose transmembrane transporter activity,protein...

Golgi membrane,female pronucleus,cytosol,plasma me...

17

10

17

_TFDEIASGFR_.2|_VTILELFR_.2|_LRGTADVTHDLQEMKEESR_....

SEN / CTL

P17301

Integrin alpha-2

ITGA2

-1.2

1.42

1.7e-11

1.87e-10

response to hypoxia,positive regulation of leukocy...

virus receptor activity,integrin binding,protein b...

nucleus,plasma membrane,focal adhesion,integrin co...

31

27

31

_VVFNLNTYK_.2|_ILGSDGAFR_.2|_FGIAVLGYLNR_.2|_FVQGL...

SEN / CTL

P00734

Prothrombin

F2

-1.2

1.71

0.0000748

0.000315

positive regulation of protein phosphorylation,sig...

serine-type endopeptidase activity,receptor bindin...

extracellular region,extracellular space,endoplasm...

86

42

86

_SPQELLC[+57]GASLISDR_.2|_SPQELLC[+57]GASLISDR_.3|...

SEN / CTL

P07203

Glutathione peroxidase 1

GPX1

-1.2

0.45

0.00398

0.00831

response to reactive oxygen species,temperature ho...

glutathione peroxidase activity,SH3 domain binding

cytoplasm,mitochondrion,mitochondrial matrix,cytos...

27

17

27

_YVRPGGGFEPNFM[+16]LFEK_.3|_YVRPGGGFEPNFMLFEK_.3|_...

SEN / CTL

P21926

CD9 antigen

CD9

-1.2

1.37

0.00431

0.00874

platelet degranulation,movement of cell or subcell...

integrin binding,protein binding

extracellular space,plasma membrane,integral compo...

9

7

9

_KDVLETFTVK_.2|_AIHYALNC[+57]C[+57]GLAGGVEQFISDIC[...

SEN / CTL

P02462

Collagen alpha-1(IV) chain

COL4A1

-1.2

1.93

0.00482

0.00944

patterning of blood vessels,brain development,neur...

extracellular matrix structural constituent,protei...

extracellular region,collagen type IV trimer,basem...

11

7

11

_AHGQDLGTAGSC[+57]LR_.3|_AHGQDLGTAGSC[+57]LR_.2|_I...

SEN / CTL

Q7Z304

MAM domain-containing protein 2

MAMDC2

-1.2

0.8

0.0278

0.0332

proteinaceous extracellular matrix,endoplasmic ret...

1

1

1

_AGDHTTGLGYYLLANTK_.3

SEN / CTL

O14817

Tetraspanin-4

TSPAN4

-1.21

1.29

0.00268

0.00651

protein complex assembly,cell surface receptor sig...

antigen binding,integrin binding,protein binding

plasma membrane,integral component of plasma membr...

3

2

3

_GLHLYGTQGNVGLTNAWSIIQTDFR_.3|_GLHLYGTQGNVGLTNAWSI...

SEN / CTL

Q9Y696

Chloride intracellular channel protein 4

CLIC4

-1.21

1.61

0.0114

0.0179

angiogenesis,endothelial cell morphogenesis,chlori...

voltage-gated ion channel activity,chloride channe...

intracellular,cytoplasm,mitochondrion,centrosome,c...

43

24

43

_TDVNKIEEFLEEVLC[+57]PPK_.3|_TDVNKIEEFLEEVLC[+57]P...

SEN / CTL

Q96BY6

Dedicator of cytokinesis protein 10

DOCK10

-1.21

0.84

0.0328

0.0374

small GTPase mediated signal transduction,regulati...

molecular_function,guanyl-nucleotide exchange fact...

intracellular,membrane,extracellular exosome

71

55

71

_ASLASLDSNPSTNEK_.2|_ISADFHVDLNHAAVR_.4|_ISADFHVDL...

SEN / CTL

P23284

Peptidyl-prolyl cis-trans isomerase B

PPIB

-1.22

1.8

0.00000534

0.0000285

protein peptidyl-prolyl isomerization,positive reg...

peptidyl-prolyl cis-trans isomerase activity,prote...

nucleus,endoplasmic reticulum,endoplasmic reticulu...

56

28

56

_VLEGMEVVR_.2|_VLEGM[+16]EVVR_.2|_TVDNFVALATGEK_.2...

SEN / CTL

Q9UMS4

Pre-mRNA-processing factor 19

PRPF19

-1.22

0.8

0.0272

0.0326

protein polyubiquitination,spliceosomal tri-snRNP ...

protein binding,ligase activity,ubiquitin-ubiquiti...

Prp19 complex,nucleus,nucleoplasm,cytoplasm,lipid ...

48

24

48

_TVPEELVKPEELSK_.3|_TVPEELVKPEELSK_.2|_VAHPIRPKPPS...

SEN / CTL

P25787

Proteasome subunit alpha type-2

PSMA2

-1.24

1.93

0.00000565

0.0000296

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,cytoplasmic mRNA processing bod...

31

15

31

_RLTPTEVKDYLAAIA_.3|_LVQIEYALAAVAGGAPSVGIK_.3|_LVQ...

SEN / CTL

P25789

Proteasome subunit alpha type-4

PSMA4

-1.25

1.63

0.00000545

0.0000288

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,cytoplasmic mRNA processing bod...

30

18

30

_LLDEVFFSEK_.2|_TTIFSPEGR_.2|_LSAEKVEIATLTR_.3|_LS...

SEN / CTL

Q16853

Membrane primary amine oxidase

AOC3

-1.25

0.85

0.0301

0.0353

xenobiotic metabolic process,inflammatory response...

copper ion binding,calcium ion binding,protein bin...

cytoplasm,early endosome,endoplasmic reticulum,Gol...

22

18

22

_YQLAVTQR_.2|_AAALAHLDRGSPPPAR_.4|_AAALAHLDRGSPPPA...

SEN / CTL

Q9Y6C2

EMILIN-1

EMILIN1

-1.26

2

1.04e-7

7.39e-7

cell adhesion

protein binding,extracellular matrix constituent c...

extracellular region,proteinaceous extracellular m...

48

36

48

_LDTVAGGLQGLR_.2|_FRGLEEGQAQAGQC[+57]PSLEGR_.3|_VL...

SEN / CTL

Q6UVK1

Chondroitin sulfate proteoglycan 4

CSPG4

-1.27

1.21

7.99e-13

9.61e-12

activation of MAPK activity,angiogenesis,transmemb...

signal transducer activity,protein kinase binding

extracellular region,Golgi lumen,integral componen...

56

46

56

_TLSAFSWR_.2|_HGELELDIPGAQAR_.3|_ASSSAGTDPQLLLYR_....

SEN / CTL

Q92626

Peroxidasin homolog

PXDN

-1.27

1.77

6.92e-7

0.00000448

negative regulation of cytokine-mediated signaling...

peroxidase activity,interleukin-1 receptor antagon...

proteinaceous extracellular matrix,extracellular s...

36

30

36

_AFFSPFR_.2|_SPNDLLALFR_.2|_AEGNPKPEIIWLR_.3|_IVNE...

SEN / CTL

P60900

Proteasome subunit alpha type-6

PSMA6

-1.27

1.62

0.0000011

0.0000068

MAPK cascade,protein polyubiquitination,stimulator...

RNA binding,endopeptidase activity,threonine-type ...

proteasome complex,cytoplasmic mRNA processing bod...

30

20

30

_LYQVEYAFK_.2|_HITIFSPEGR_.2|_C[+57]DPAGYYC[+57]GF...

SEN / CTL

P25786

Proteasome subunit alpha type-1

PSMA1

-1.28

2.01

1.96e-7

0.00000137

MAPK cascade,protein polyubiquitination,stimulator...

RNA binding,threonine-type endopeptidase activity,...

proteasome complex,nucleus,nucleoplasm,centrosome,...

45

25

45

_FVFDRPLPVSR_.3|_NQYDNDVTVWSPQGR_.2|_NQYDNDVTVWSPQ...

SEN / CTL

Q14766

Latent-transforming growth factor beta-binding protein 1

LTBP1

-1.31

1.88

0.0019

0.00509

ventricular septum development,transmembrane recep...

transforming growth factor beta-activated receptor...

microfibril,extracellular region,proteinaceous ext...

44

35

44

_C[+57]VDIDEC[+57]TQVQHLC[+57]SQGR_.3|_KC[+57]VDID...

SEN / CTL

Q08431

Lactadherin

MFGE8

-1.33

1.34

5.03e-15

7.04e-14

angiogenesis,phagocytosis, recognition,phagocytosi...

phosphatidylserine binding,integrin binding,phosph...

extracellular region,extracellular space,external ...

19

15

19

_GDVFPSYTC[+57]TC[+57]LK_.2|_VTFLGLQHWVPELAR_.3|_V...

SEN / CTL

Q02809

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1

PLOD1

-1.37

1.61

1.38e-17

2.38e-16

response to hypoxia,cellular protein modification ...

iron ion binding,procollagen-lysine 5-dioxygenase ...

endoplasmic reticulum membrane,rough endoplasmic r...

56

37

56

_NVIAPLMTR_.2|_SEDYVDIVQGR_.2|_IFQNLDGALDEVVLK_.2|...

SEN / CTL

Q06330

Recombining binding protein suppressor of hairless

RBPJ

-1.38

0.77

0.0162

0.0228

negative regulation of transcription from RNA poly...

recombinase activity,RNA polymerase II core promot...

MAML1-RBP-Jkappa- ICN1 complex,nucleus,nucleoplasm...

12

11

12

_IIQFQATPC[+57]PK_.2|_ERGDQTVLILHAK_.3|_TLYISDSDK_...

SEN / CTL

P20908

Collagen alpha-1(V) chain

COL5A1

-1.4

1.2

6.07e-9

5.51e-8

blood vessel development,heart morphogenesis,cell ...

integrin binding,extracellular matrix structural c...

extracellular region,collagen type V trimer,baseme...

18

15

18

_TGPIGPQGAPGKPGPDGLR_.3|_SPVFLYEDHTGKPGPEDYPLFR_.4...

SEN / CTL

P69905

Hemoglobin subunit alpha

HBA1

-1.4

1.71

0.000109

0.000443

receptor-mediated endocytosis,positive regulation ...

oxygen transporter activity,iron ion binding,prote...

extracellular region,cytosol,hemoglobin complex,me...

78

23

78

_MFLSFPTTK_.2|_M[+16]FLSFPTTK_.2|_LRVDPVNFK_.2|_VG...

SEN / CTL

P62906

60S ribosomal protein L10a

RPL10A

-1.4

1.75

0.00772

0.0135

nuclear-transcribed mRNA catabolic process, nonsen...

RNA binding,structural constituent of ribosome,pro...

nucleus,nucleolus,cytoplasm,cytosol,focal adhesion...

35

19

35

_DTLYEAVR_.2|_FSVC[+57]VLGDQQHC[+57]DEAK_.3|_FSVC[...

SEN / CTL

P28066

Proteasome subunit alpha type-5

PSMA5

-1.41

1.59

0.00000185

0.000011

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

34

17

34

_SEYDRGVNTFSPEGR_.3|_LFQVEYAIEAIK_.2|_LFQVEYAIEAIK...

SEN / CTL

P19823

Inter-alpha-trypsin inhibitor heavy chain H2

ITIH2

-1.42

1.68

0.0000707

0.000303

negative regulation of endopeptidase activity,hyal...

endopeptidase inhibitor activity,serine-type endop...

extracellular region,extracellular exosome,blood m...

62

38

62

_FYNQVSTPLLR_.2|_IQPSGGTNINEALLR_.2|_VQFELHYQEVK_....

SEN / CTL

Q58FF8

Putative heat shock protein HSP 90-beta 2

HSP90AB2P

-1.43

1.59

0.0188

0.0253

protein folding,response to stress,biological_proc...

molecular_function,ATP binding,unfolded protein bi...

cytoplasm,extracellular exosome

6

2

6

_HSQFLGYPITLYLEKER_.4|_HSQFLGYPITLYLEKER_.3|_HSQFL...

SEN / CTL

P35052

Glypican-1

GPC1

-1.45

1.48

0.00000149

0.00000895

retinoid metabolic process,glycosaminoglycan biosy...

copper ion binding,fibroblast growth factor bindin...

proteinaceous extracellular matrix,extracellular s...

13

13

13

_SFVQGLGVASDVVR_.2|_GFSLSDVPQAEISGEHLR_.3|_VLQAMLA...

SEN / CTL

P41252

Isoleucine--tRNA ligase, cytoplasmic

IARS

-1.45

0.77

0.0136

0.0202

osteoblast differentiation,tRNA aminoacylation for...

tRNA binding,aminoacyl-tRNA editing activity,isole...

nucleoplasm,cytoplasm,cytosol,membrane,extracellul...

116

74

116

_LYLINSPVVR_.2|_ESVDHLTIPSR_.3|_ESVDHLTIPSR_.2|_LY...

SEN / CTL

P13726

Tissue factor

F3

-1.48

0.81

0.000267

0.00096

positive regulation of endothelial cell proliferat...

protease binding,cytokine receptor activity,protei...

extracellular space,plasma membrane,cell surface,i...

3

3

3

_DLIYTLYYWK_.2|_TILEWEPKPVNQVYTVQISTK_.3|_C[+57]FY...

SEN / CTL

Q86VP6

Cullin-associated NEDD8-dissociated protein 1

CAND1

-1.48

0.93

0.0235

0.0292

SCF complex assembly,protein ubiquitination,cell d...

protein binding,TBP-class protein binding

ubiquitin ligase complex,nucleus,nucleoplasm,cytop...

119

81

119

_NVVAEC[+57]LGK_.2|_HC[+57]EC[+57]AEEGTR_.3|_HC[+5...

SEN / CTL

P07996

Thrombospondin-1

THBS1

-1.49

2.02

4.83e-18

8.62e-17

activation of MAPK activity,response to hypoxia,ne...

phosphatidylserine binding,glycoprotein binding,fi...

extracellular region,fibrinogen complex,extracellu...

89

63

89

_TIVTTLQDSIR_.2|_FVFGTTPEDILR_.2|_FQMIPLDPK_.2|_NA...

SEN / CTL

Q16610

Extracellular matrix protein 1

ECM1

-1.5

1.51

3.78e-8

3.16e-7

ossification,angiogenesis,positive regulation of e...

protease binding,signal transducer activity,interl...

extracellular region,proteinaceous extracellular m...

28

22

28

_ELLALIQLER_.2|_FC[+57]EAEFSVK_.2|_LVWEEAMSR_.2|_Q...

SEN / CTL

Q17RC7

Exocyst complex component 3-like protein 4

EXOC3L4

-1.54

0.64

0.00574

0.0107

exocytosis,exocyst localization

SNARE binding

exocyst

2

2

2

_ALGLFVPR_.2|_AAAGAAGAEAPR_.2

SEN / CTL

Q9UQE7

Structural maintenance of chromosomes protein 3

SMC3

-1.56

1.11

0.0345

0.0384

regulation of DNA replication,DNA repair,mitotic s...

chromatin binding,microtubule motor activity,prote...

chromosome, centromeric region,chromatin,lateral e...

116

84

116

_SLDQAINDK_.2|_RVDALNDEIR_.3|_RVDALNDEIR_.2|_KYEAI...

SEN / CTL

Q99715

Collagen alpha-1(XII) chain

COL12A1

-1.57

1.91

2.22e-39

1.05e-37

skeletal system development,cell adhesion,collagen...

extracellular matrix structural constituent confer...

extracellular region,collagen type XII trimer,extr...

114

96

114

_ALALGALQNIR_.2|_VLVVVTDGR_.2|_VTWEPAPGEVK_.2|_IIY...

SEN / CTL

P43355

P43358

P43361

Melanoma-associated antigen 1;Melanoma-associated antigen 4;Melanoma-associated antigen 8

MAGEA1

MAGEA4

MAGEA8

-1.58

0.9

0.0393

0.0419

negative regulation of transcription from RNA poly...

protein binding,histone deacetylase binding;molecu...

nucleus,cytoplasm,plasma membrane;cellular_compone...

1

1

1

_ALAETSYVK_.2

SEN / CTL

O95822

Malonyl-CoA decarboxylase, mitochondrial

MLYCD

-1.58

1.24

0.0468

0.0476

response to ischemia,acetyl-CoA biosynthetic proce...

receptor binding,malonyl-CoA decarboxylase activit...

cytoplasm,mitochondrion,mitochondrial matrix,perox...

16

15

16

_LVEGPDVR_.2|_AMDELLR_.2|_GFGVDHGQVAEQSAGVLHLR_.4|...

SEN / CTL

P51531

Probable global transcription activator SNF2L2

SMARCA2

-1.59

0.69

0.00655

0.0117

negative regulation of transcription from RNA poly...

RNA polymerase II transcription coactivator activi...

nuclear chromatin,nucleus,nucleoplasm,SWI/SNF comp...

15

12

15

_VLFGPEAPK_.2|_AVATWHANTER_.3|_GIVEDIHC[+57]GSMK_....

SEN / CTL

P09871

Complement C1s subcomponent

C1S

-1.62

2.17

9.77e-9

8.56e-8

complement activation, lectin pathway,proteolysis,...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular exosome,blood m...

38

26

38

_LLEVPEGR_.2|_TNFDNDIALVR_.2|_MGPTVSPIC[+57]LPGTSS...

SEN / CTL

Q99798

Aconitate hydratase, mitochondrial

ACO2

-1.66

1.15

0.0322

0.0369

liver development,generation of precursor metaboli...

aconitate hydratase activity,iron ion binding,3 ir...

nucleus,mitochondrion,mitochondrial matrix,myelin ...

142

75

142

_NDANPETHAFVTSPEIVTALAIAGTLK_.3|_NDANPETHAFVTSPEIV...

SEN / CTL

P01023

Alpha-2-macroglobulin

A2M

-1.68

3.2

0.000146

0.000568

negative regulation of complement activation, lect...

protease binding,serine-type endopeptidase inhibit...

extracellular region,cytosol,platelet alpha granul...

144

89

144

_QTVSWAVTPK_.2|_LPPNVVEESAR_.2|_ATVLNYLPK_.2|_DLKP...

SEN / CTL

Q6P2Q9

Pre-mRNA-processing-splicing factor 8

PRPF8

-1.68

0.57

0.0028

0.00667

spliceosomal tri-snRNP complex assembly,RNA splici...

second spliceosomal transesterification activity,p...

nucleus,nucleoplasm,U5 snRNP,membrane,nuclear spec...

204

138

204

_QNPFWWTHQR_.3|_QNPFWWTHQR_.2|_FGDLILK_.2|_HDVNLGR...

SEN / CTL

O00391

Sulfhydryl oxidase 1

QSOX1

-1.69

1.46

3.54e-19

6.77e-18

platelet degranulation,negative regulation of macr...

protein disulfide isomerase activity,flavin-linked...

extracellular region,extracellular space,Golgi app...

29

23

29

_LAGAPSEDPQFPK_.2|_DFNIPGFPTVR_.2|_SFYTAYLQR_.2|_V...

SEN / CTL

P08572

Collagen alpha-2(IV) chain

COL4A2

-1.7

1.77

3.89e-7

0.00000265

angiogenesis,transcription, DNA-templated,negative...

extracellular matrix structural constituent,protei...

extracellular region,collagen type IV trimer,extra...

19

15

19

_IAVQPGTVGPQGR_.2|_SVSIGYLLVK_.2|_FSTMPFLYC[+57]NP...

SEN / CTL

P04180

Phosphatidylcholine-sterol acyltransferase

LCAT

-1.7

0.61

0.00333

0.00745

phospholipid metabolic process,phosphatidylcholine...

phosphatidylcholine-sterol O-acyltransferase activ...

extracellular region,extracellular space,high-dens...

6

5

6

_LDKPDVVNWM[+16]C[+57]YR_.3|_LDKPDVVNWMC[+57]YR_.3...

SEN / CTL

Q5VWQ8

Disabled homolog 2-interacting protein

DAB2IP

-1.7

2.22

0.0385

0.0414

negative regulation of transcription from RNA poly...

GTPase activator activity,death receptor binding,p...

cytoplasm,cytosol,plasma membrane,cell-cell adhere...

33

29

33

_SKDELSQAEKDLAVLQDK_.3|_VTQNLANFAK_.2|_AIEEYLK_.2|...

SEN / CTL

Q14112

Nidogen-2

NID2

-1.71

1.73

1.42e-21

3.06e-20

cell adhesion,cell-matrix adhesion,extracellular m...

calcium ion binding,protein binding,collagen bindi...

extracellular region,basement membrane,extracellul...

60

46

60

_AIAVDPIR_.2|_VLYREDTSPAVLGLAAR_.3|_SHLYGITAVYPYC[...

SEN / CTL

A8MXV4

Nucleoside diphosphate-linked moiety X motif 19, mitochondrial

NUDT19

-1.71

1.07

0.023

0.0289

biological_process,fatty acid beta-oxidation using...

receptor binding,metal ion binding,acyl-CoA hydrol...

cellular_component,mitochondrion,peroxisomal matri...

27

19

27

_SADWLGLFAPHHGPPR_.2|_SADWLGLFAPHHGPPR_.4|_SADWLGL...

SEN / CTL

Q9H270

Vacuolar protein sorting-associated protein 11 homolog

VPS11

-1.74

0.79

0.00805

0.0138

intracellular protein transport,vesicle docking in...

nucleotide binding,protein binding,zinc ion bindin...

lysosome,lysosomal membrane,endosome,late endosome...

31

25

31

_ILMHHIPEQTTQLLK_.3|_ILMHHIPEQTTQLLK_.4|_ILM[+16]H...

SEN / CTL

O00468

Agrin

AGRN

-1.75

1.98

3.39e-19

6.75e-18

retinoid metabolic process,glycosaminoglycan biosy...

dystroglycan binding,structural constituent of cyt...

extracellular region,basal lamina,cytoplasm,Golgi ...

64

54

64

_LELGIGPGAATR_.2|_SREPVTLGAWTR_.3|_FGALC[+57]EAETG...

SEN / CTL

P10909

Clusterin

CLU

-1.76

1.96

6.58e-8

5.01e-7

cell morphogenesis,microglial cell activation,rele...

protein binding,ubiquitin protein ligase binding,c...

extracellular region,extracellular space,nucleus,c...

42

25

42

_ASSIIDELFQDR_.2|_LFDSDPITVTVPVEVSR_.2|_LFDSDPITVT...

SEN / CTL

Q5VUM1

Succinate dehydrogenase assembly factor 4, mitochondrial

SDHAF4

-1.78

1.11

0.0233

0.0291

innate immune response

mitochondrial matrix

4

3

4

_FPDDVNPVTK_.2|_FDAPEDSHLEK_.3|_FDAPEDSHLEKEPLEKFP...

SEN / CTL

P26022

Pentraxin-related protein PTX3

PTX3

-1.79

1.25

2.26e-7

0.00000156

response to yeast,inflammatory response,opsonizati...

complement component C1q binding,(1->3)-beta-D-glu...

extracellular region,extracellular space

7

7

7

_ALAAVLEELR_.2|_LTSALDELLQATR_.2|_LAESLARPC[+57]AP...

SEN / CTL

Q58FF6

Putative heat shock protein HSP 90-beta 4

HSP90AB4P

-1.8

0.64

0.00326

0.00735

protein folding,response to stress

ATP binding,unfolded protein binding

cytoplasm

5

3

5

_MSLIINTFYSNK_.2|_SLIINTFYSNK_.3|_SLIINTFYSNK_.2|_...

SEN / CTL

Q96PE2

Rho guanine nucleotide exchange factor 17

ARHGEF17

-1.81

0.51

0.00135

0.00397

actin cytoskeleton organization,regulation of Rho ...

guanyl-nucleotide exchange factor activity,Rho gua...

cytosol

62

49

62

_AQRPADGLHSWHIFSQPQAGAR_.4|_C[+57]C[+57]SKPQVDMR_....

SEN / CTL

P02751

Fibronectin

FN1

-1.82

1.71

6.4e-112

1.66e-109

angiogenesis,regulation of protein phosphorylation...

protease binding,integrin binding,protein binding,...

extracellular region,fibrinogen complex,proteinace...

209

126

209

_STTPDITGYR_.2|_WLPSSSPVTGYR_.2|_FTNIGPDTMR_.2|_SY...

SEN / CTL

P07942

Laminin subunit beta-1

LAMB1

-1.87

1.75

2.25e-52

1.66e-50

cell adhesion,neuronal-glial interaction involved ...

structural molecule activity,extracellular matrix ...

extracellular region,basement membrane,laminin-1 c...

100

76

100

_LHTLGDNLLDSR_.3|_LHTLGDNLLDSR_.2|_YVVLPRPVC[+57]F...

SEN / CTL

P16035

Metalloproteinase inhibitor 2

TIMP2

-1.87

1.78

0.00000304

0.0000173

central nervous system development,aging,negative ...

protease binding,integrin binding,protein binding,...

extracellular region,proteinaceous extracellular m...

11

8

11

_GAAPPKQEFLDIEDP_.2|_AVSEKEVDSGNDIYGNPIKR_.4|_AVSE...

SEN / CTL

Q92688

Acidic leucine-rich nuclear phosphoprotein 32 family member B

ANP32B

-1.87

1.46

0.0452

0.0464

vasculature development,nucleosome assembly,activa...

protein binding,histone binding,RNA polymerase bin...

nucleus,cytoplasm,extracellular exosome,nucleolus

17

10

17

_ELVLDNC[+57]K_.2|_LKDISTLEPLK_.3|_LKDISTLEPLK_.2|...

SEN / CTL

P07585

Decorin

DCN

-1.89

1.89

2.58e-11

2.78e-10

kidney development,placenta development,negative r...

protein kinase inhibitor activity,protein binding,...

extracellular region,collagen type VI trimer,extra...

33

22

33

_VSPGAFTPLVK_.2|_NLHALILVNNK_.3|_NLHALILVNNK_.2|_A...

SEN / CTL

Q15293

Reticulocalbin-1

RCN1

-1.89

1.91

0.0000472

0.000209

in utero embryonic development,camera-type eye dev...

calcium ion binding,protein binding

endoplasmic reticulum,endoplasmic reticulum lumen

48

29

48

_YIFDNVAK_.2|_IVDRIDNDGDGFVTTEELK_.3|_IVDRIDNDGDGF...

SEN / CTL

P02461

Collagen alpha-1(III) chain

COL3A1

-1.91

2.53

2.45e-9

2.35e-8

skeletal system development,cell-matrix adhesion,t...

integrin binding,extracellular matrix structural c...

extracellular region,collagen type III trimer,extr...

27

25

27

_FTYTVLEDGC[+57]TK_.2|_GAAGEPGRDGVPGGPGMR_.3|_SGEY...

SEN / CTL

Q9BSJ8

Extended synaptotagmin-1

ESYT1

-1.92

0.74

0.00446

0.0089

lipid transport

protein binding,lipid binding,metal ion binding

plasma membrane,membrane,integral component of end...

75

52

75

_ALTLGALTLPLAR_.2|_ALTLGALTLPLAR_.3|_HLSPYATLTVGDS...

SEN / CTL

P23142

Fibulin-1

FBLN1

-1.93

1.67

2.24e-15

3.22e-14

negative regulation of protein phosphorylation,neg...

fibronectin binding,extracellular matrix structura...

extracellular region,proteinaceous extracellular m...

36

25

36

_DC[+57]SLPYATESK_.2|_TGYYFDGISR_.2|_MC[+57]VDVNEC...

SEN / CTL

P35555

Fibrillin-1

FBN1

-1.94

1.32

1.53e-16

2.33e-15

skeletal system development,metanephros developmen...

integrin binding,hormone activity,extracellular ma...

microfibril,extracellular region,proteinaceous ext...

32

32

32

_TLPGGNQC[+57]IVPIC[+57]R_.2|_C[+57]PVGYVLR_.2|_TG...

SEN / CTL

P09960

Leukotriene A-4 hydrolase

LTA4H

-1.95

1.38

0.034

0.0383

proteolysis,leukotriene metabolic process,leukotri...

aminopeptidase activity,epoxide hydrolase activity...

nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr...

79

45

79

_AILPC[+57]QDTPSVK_.2|_TLVWSEK_.2|_ASMHPVTAMLVGK_....

SEN / CTL

P54687

Branched-chain-amino-acid aminotransferase, cytosolic

BCAT1

-1.98

2.53

0.0351

0.0388

G1/S transition of mitotic cell cycle,aspartate bi...

branched-chain-amino-acid transaminase activity,py...

mitochondrion,cytosol

26

17

26

_GETIHIPTMENGPK_.2|_GETIHIPTMENGPK_.3|_ATLPVFDKEEL...

SEN / CTL

Q15582

Transforming growth factor-beta-induced protein ig-h3

TGFBI

-1.99

1.8

1.61e-36

5.94e-35

angiogenesis,chondrocyte differentiation,cell adhe...

integrin binding,protein binding,collagen binding,...

extracellular region,proteinaceous extracellular m...

60

38

60

_EGVYTVFAPTNEAFR_.2|_SPYQLVLQHSR_.3|_SPYQLVLQHSR_....

SEN / CTL

Q9UL54

Serine/threonine-protein kinase TAO2

TAOK2

-2.03

1.48

0.00186

0.00505

activation of MAPKK activity,regulation of cell gr...

protein serine/threonine kinase activity,receptor ...

nucleus,nucleolus,cytoplasm,cytoskeleton,integral ...

47

34

47

_LQHQTELGNQLEYNK_.3|_LQHQTELGNQLEYNK_.2|_LQHQTELGN...

SEN / CTL

P00736

Complement C1r subcomponent

C1R

-2.08

1.88

2.6e-16

3.85e-15

proteolysis,immune response,complement activation,...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular exosome,blood m...

35

25

35

_TLDEFTIIQNLQPQYQFR_.3|_DYFIATC[+57]K_.2|_FC[+57]G...

SEN / CTL

O95445

Apolipoprotein M

APOM

-2.08

1.14

0.0153

0.0221

retinoid metabolic process,response to glucose,cho...

lipid transporter activity,phospholipid binding,an...

extracellular region,integral component of plasma ...

4

4

4

_AFLLTPR_.2|_WIYHLTEGSTDLR_.3|_KWIYHLTEGSTDLR_.3|_...

SEN / CTL

P14543

Nidogen-1

NID1

-2.09

1.94

1.14e-22

2.69e-21

cell-matrix adhesion,positive regulation of cell-s...

calcium ion binding,collagen binding,laminin bindi...

extracellular region,basement membrane,basal lamin...

50

38

50

_VYYREDLSPSITQR_.3|_VLFETDLVNPR_.2|_YALSNSIGPVR_.2...

SEN / CTL

Q14008

Cytoskeleton-associated protein 5

CKAP5

-2.12

0.88

0.00575

0.0107

G2/M transition of mitotic cell cycle,spindle orga...

protein binding,microtubule plus-end binding,cadhe...

kinetochore,condensed chromosome kinetochore,spind...

132

100

132

_KEALESVEVLIKNPK_.3|_AVELMDR_.2|_GKPAAPGGAGNTGTK_....

SEN / CTL

Q14320

Protein FAM50A

FAM50A

-2.14

1.27

0.0197

0.026

spermatogenesis

poly(A) RNA binding

nucleus,nucleoplasm

22

14

22

_LLSDATVEKDESHAGK_.3|_LLSDATVEKDESHAGK_.4|_LLSDATV...

SEN / CTL

P46013

Antigen KI-67

MKI67

-2.26

1.79

0.0473

0.048

DNA metabolic process,regulation of mitotic nuclea...

DNA binding,protein binding,ATP binding,protein C-...

chromosome, centromeric region,nucleus,nucleolus,c...

86

77

86

_SGGSGHAVAEPASPEQELDQNKGK_.3|_VGVKEELLAVGK_.3|_VGV...

SEN / CTL

P05997

Collagen alpha-2(V) chain

COL5A2

-2.27

1.49

3.21e-9

3.02e-8

skeletal system development,ossification,extracell...

molecular_function,extracellular matrix structural...

extracellular region,collagen type V trimer,extrac...

15

14

15

_SPDNKPVWYGLDMNR_.3|_GSQFAYGDHQSPNTAITQMTFLR_.3|_Y...

SEN / CTL

Q16363

Laminin subunit alpha-4

LAMA4

-2.29

1.6

2.89e-45

1.87e-43

cell adhesion,regulation of cell adhesion,extracel...

receptor binding,extracellular matrix structural c...

extracellular region,basement membrane,basal lamin...

51

42

51

_VDRDVEVEDFQR_.3|_LAALSIEEGK_.2|_TLFPVVLEQLDDYNAK_...

SEN / CTL

P67809

Nuclease-sensitive element-binding protein 1

YBX1

-2.3

1.15

0.011

0.0177

negative regulation of transcription from RNA poly...

RNA polymerase II core promoter proximal region se...

nucleus,nucleoplasm,U12-type spliceosomal complex,...

58

29

58

_NYQQNYQNSESGEKNEGSESAPEGQAQQR_.4|_NYQQNYQNSESGEKN...

SEN / CTL

O60565

Q9H772

Gremlin-1;Gremlin-2

GREM1

GREM2

-2.3

0.93

0.0162

0.0228

cell morphogenesis,branching involved in ureteric ...

cytokine activity,protein binding,morphogen activi...

extracellular space,cell surface;extracellular reg...

1

1

1

_FC[+57]YGQC[+57]NSFYIPR_.2

SEN / CTL

Q16270

Insulin-like growth factor-binding protein 7

IGFBP7

-2.31

1.19

9.2e-10

9.33e-9

regulation of cell growth,cell adhesion,embryo imp...

protein binding,insulin-like growth factor binding

extracellular region,extracellular space,extracell...

15

12

15

_SRYPVC[+57]GSDGTTYPSGC[+57]QLR_.3|_GYC[+57]APGMEC...

SEN / CTL

P28072

Proteasome subunit beta type-6

PSMB6

-2.43

0.92

7.54e-8

5.65e-7

MAPK cascade,protein polyubiquitination,stimulator...

endopeptidase activity,threonine-type endopeptidas...

proteasome complex,nucleus,nucleoplasm,cytoplasm,G...

17

11

17

_LAAIAESGVER_.2|_QVLLGDQIPK_.2|_SGSAADTQAVADAVTYQL...

SEN / CTL

Q15113

Procollagen C-endopeptidase enhancer 1

PCOLCE

-2.43

1.55

0.0000297

0.000137

proteolysis,multicellular organism development,pos...

protein binding,collagen binding,heparin binding,p...

extracellular space,extracellular exosome,extracel...

10

9

10

_YDALEVFAGSGTSGQR_.2|_TGGLDLPSPPTGASLK_.2|_FDLEPDT...

SEN / CTL

P20742

Pregnancy zone protein

PZP

-2.44

3.26

0.0117

0.018

female pregnancy,negative regulation of endopeptid...

endopeptidase inhibitor activity,serine-type endop...

extracellular region,extracellular exosome,blood m...

26

23

26

_DLFHC[+57]VSFTLPR_.3|_DLFHC[+57]VSFTLPR_.2|_GSFAL...

SEN / CTL

P08123

Collagen alpha-2(I) chain

COL1A2

-2.45

1.83

9.23e-41

5.31e-39

skeletal system development,blood vessel developme...

extracellular matrix structural constituent,protei...

extracellular region,collagen type I trimer,extrac...

57

44

57

_VYC[+57]DFSTGETC[+57]IR_.2|_EMATQLAFMR_.2|_GIPGPV...

SEN / CTL

P12110

Collagen alpha-2(VI) chain

COL6A2

-2.47

2.1

3.8e-30

1.03e-28

cell adhesion,response to glucose,extracellular ma...

protein binding

extracellular region,proteinaceous extracellular m...

57

42

57

_NFVINVVNR_.2|_LFAVAPNQNLK_.2|_VFAVVITDGR_.2|_DIAS...

SEN / CTL

P13611

Versican core protein

VCAN

-2.49

1.98

3.6e-20

7.45e-19

skeletal system development,osteoblast differentia...

extracellular matrix structural constituent,calciu...

extracellular region,proteinaceous extracellular m...

23

17

23

_LLASDAGLYR_.2|_LATVGELQAAWR_.2|_VSVPTHPEAVGDASLTV...

SEN / CTL

Q92608

Dedicator of cytokinesis protein 2

DOCK2

-2.49

3.11

0.0318

0.0365

membrane raft polarization,establishment of T cell...

GTPase activator activity,protein binding,Rac guan...

cytosol,cytoskeleton,endomembrane system,membrane,...

62

51

62

_SSSSVGGLSVSSR_.2|_TYLDTSSR_.2|_DDMQHQVLER_.3|_DNN...

SEN / CTL

P12111

Collagen alpha-3(VI) chain

COL6A3

-2.5

1.93

3.82e-184

1.98e-181

cell adhesion,muscle organ development,negative re...

serine-type endopeptidase inhibitor activity

extracellular region,proteinaceous extracellular m...

233

165

233

_LLVLITGGK_.2|_YIAYLVR_.2|_ALILVGLER_.2|_VVESLDVGQ...

SEN / CTL

P29762

Cellular retinoic acid-binding protein 1

CRABP1

-2.5

1.41

0.0166

0.023

transport,signal transduction,multicellular organi...

retinoic acid binding,transporter activity,retinoi...

cytosol

10

8

10

_ALGVNAMLR_.2|_IHC[+57]TQTLLEGDGPK_.3|_IHC[+57]TQT...

SEN / CTL

P12109

Collagen alpha-1(VI) chain

COL6A1

-2.51

2.1

2.1e-40

1.09e-38

osteoblast differentiation,cell adhesion,extracell...

platelet-derived growth factor binding

extracellular region,collagen type VI trimer,extra...

69

49

69

_IALVITDGR_.2|_VPSYQALLR_.2|_VFSVAITPDHLEPR_.3|_VF...

SEN / CTL

Q00341

Vigilin

HDLBP

-2.51

1.25

0.011

0.0177

lipid transport,cholesterol metabolic process,cell...

protein binding,lipid binding,poly(A) RNA binding,...

nucleus,cytoplasm,plasma membrane,cell-cell adhere...

123

82

123

_IVGELEQM[+16]VSEDVPLDHR_.3|_IVGELEQMVSEDVPLDHR_.3...

SEN / CTL

Q9Y3B3

Transmembrane emp24 domain-containing protein 7

TMED7

-2.52

1.4

0.0157

0.0225

ER to Golgi vesicle-mediated transport,retrograde ...

Golgi membrane,endoplasmic reticulum,endoplasmic r...

11

9

11

_SVIDYQTHFR_.3|_SVIDYQTHFR_.2|_SRAEDLNTR_.2|_FC[+5...

SEN / CTL

A6NC98

Coiled-coil domain-containing protein 88B

CCDC88B

-2.59

0.79

0.00184

0.00505

positive regulation of cytokine production,cytoske...

microtubule binding,dynein light intermediate chai...

cytoplasm,endoplasmic reticulum,Golgi apparatus,ce...

27

24

27

_LAELLLEREPLC[+57]LRPEAPSR_.4|_RAELYREEAEALR_.4|_L...

SEN / CTL

P11047

Laminin subunit gamma-1

LAMC1

-2.66

1.84

8.37e-62

8.65e-60

protein complex assembly,cell adhesion,endoderm de...

extracellular matrix structural constituent

extracellular region,basement membrane,laminin-1 c...

97

77

97

_LSAEDLVLEGAGLR_.2|_LSAEDLVLEGAGLR_.3|_AFDITYVR_.2...

SEN / CTL

Q08380

Galectin-3-binding protein

LGALS3BP

-2.67

2.01

3.55e-27

8.74e-26

platelet degranulation,receptor-mediated endocytos...

scavenger receptor activity

extracellular region,proteinaceous extracellular m...

30

23

30

_ELSEALGQIFDSQR_.2|_ELSEALGQIFDSQR_.3|_SDLAVPSELAL...

SEN / CTL

Q05707

Collagen alpha-1(XIV) chain

COL14A1

-2.71

0.98

0.00346

0.00761

single organismal cell-cell adhesion,extracellular...

extracellular matrix structural constituent,collag...

extracellular region,proteinaceous extracellular m...

92

66

92

_IGILITDGK_.2|_HVFFVDDFDAFKK_.4|_HVFFVDDFDAFKK_.3|...

SEN / CTL

P02452

Collagen alpha-1(I) chain

COL1A1

-2.72

2.2

6.99e-38

2.78e-36

skeletal system development,blood vessel developme...

extracellular matrix structural constituent,protei...

extracellular region,collagen type I trimer,extrac...

55

47

55

_VLC[+57]DDVIC[+57]DETK_.2|_GVQGPPGPAGPR_.2|_SLSQQ...

SEN / CTL

Q9Y2Z0

Protein SGT1 homolog

SUGT1

-2.72

1.02

0.00399

0.00831

mitotic nuclear division,regulation of protein sta...

protein binding

ubiquitin ligase complex,kinetochore,nucleus,cytos...

43

29

43

_SFMESGGTVLSTNWSDVGK_.3|_SFMESGGTVLSTNWSDVGK_.2|_Q...

SEN / CTL

Q92900

Regulator of nonsense transcripts 1

UPF1

-2.72

1.82

0.0288

0.0341

nuclear-transcribed mRNA catabolic process, nonsen...

chromatin binding,RNA binding,ATP-dependent RNA he...

nuclear chromosome, telomeric region,chromatin,cyt...

84

59

84

_EAIIPGSVYDR_.2|_ANEHQGIGFLNDPRR_.4|_ANEHQGIGFLNDP...

SEN / CTL

Q86SZ2

Trafficking protein particle complex subunit 6B

TRAPPC6B

-2.99

1.92

0.0253

0.0308

ER to Golgi vesicle-mediated transport,COPII vesic...

protein binding

Golgi membrane,endoplasmic reticulum,cis-Golgi net...

7

6

7

_TNHQGIYVLQDNK_.3|_TNHQGIYVLQDNK_.2|_GGLSNLGIK_.2|...

SEN / CTL

Q15067

Peroxisomal acyl-coenzyme A oxidase 1

ACOX1

-3.04

0.82

0.00117

0.0035

very long-chain fatty acid metabolic process,gener...

fatty-acyl-CoA binding,acyl-CoA dehydrogenase acti...

nucleus,nucleoplasm,nucleolus,mitochondrion,peroxi...

48

32

48

_FGYDEIDNGYLK_.2|_AC[+57]TIAIR_.2|_YAQVKPDGTYVK_.3...

SEN / CTL

Q9NZP8

Complement C1r subcomponent-like protein

C1RL

-3.05

2.22

0.0373

0.0404

proteolysis,complement activation, classical pathw...

serine-type endopeptidase activity

extracellular space,extracellular exosome

11

9

11

_WILTAAHTIYPK_.3|_WILTAAHTIYPK_.2|_VVVHPDYR_.2|_EA...

SEN / CTL

Q9BVP2

Guanine nucleotide-binding protein-like 3

GNL3

-3.11

1.86

0.0203

0.0266

cell proliferation,positive regulation of telomere...

GTPase activity,protein binding,GTP binding,poly(A...

extracellular space,nucleus,nucleoplasm,nucleolus,...

45

34

45

_DIHEELPK_.2|_KDPGVPNSAPFK_.3|_KDPGVPNSAPFK_.2|_YT...

SEN / CTL

Q5T0Z8

Uncharacterized protein C6orf132

C6orf132

-3.16

1.45

0.00832

0.0141

5

4

5

_GGAAGPGEPVEVK_.2|_GSALGPNPEPHLTFPR_.3|_GSALGPNPEP...

SEN / CTL

Q9HA77

Probable cysteine--tRNA ligase, mitochondrial

CARS2

-3.18

1.65

0.0127

0.0191

cysteinyl-tRNA aminoacylation

cysteine-tRNA ligase activity,ATP binding,metal io...

cytoplasm,mitochondrial matrix

17

14

17

_VLPPTVYLR_.2|_VVDAILGLAHHGNGQLR_.4|_VVDAILGLAHHGN...

SEN / CTL

P21359

Neurofibromin

NF1

-3.25

1.83

0.0166

0.023

MAPK cascade,osteoblast differentiation,metanephro...

GTPase activator activity,protein binding,phosphat...

nucleus,nucleolus,cytoplasm,cytosol,membrane,axon,...

124

95

124

_LTSHQMLSSTEILK_.2|_AVQGC[+57]GAHPAIR_.3|_AVQGC[+5...

SEN / CTL

Q8N573

Oxidation resistance protein 1

OXR1

-3.27

1.32

0.00523

0.01

response to oxidative stress,adult walking behavio...

molecular_function,oxidoreductase activity

cellular_component,nucleolus,mitochondrion

44

34

44

_KIEESETIEDSSNQAAAR_.3|_KIEESETIEDSSNQAAAR_.2|_RID...

SEN / CTL

O75907

Diacylglycerol O-acyltransferase 1

DGAT1

-3.32

1.4

0.00604

0.011

triglyceride metabolic process,triglyceride biosyn...

2-acylglycerol O-acyltransferase activity,diacylgl...

endoplasmic reticulum membrane,integral component ...

4

3

4

_DAAAGPDVGAAGDAPAPAPNK_.2|_ASSAAAPHTVSYPDNLTYR_.3|...

SEN / CTL

P02671

Fibrinogen alpha chain

FGA

-3.36

0.78

0.000648

0.00206

adaptive immune response,platelet degranulation,pr...

structural molecule activity,protein binding,prote...

extracellular region,fibrinogen complex,extracellu...

97

54

97

_NPSSAGSWNSGSSGPGSTGNR_.3|_NPSSAGSWNSGSSGPGSTGNR_....

SEN / CTL

P01763

Ig heavy chain V-III region WEA

NaN

-3.41

1.5

0.00697

0.0123

proteolysis,receptor-mediated endocytosis,immune r...

antigen binding,serine-type endopeptidase activity

extracellular region,plasma membrane

2

2

2

_NSLYLQMSSLR_.2|_AEDTAVYYC[+57]AR_.2

SEN / CTL

P17050

Alpha-N-acetylgalactosaminidase

NAGA

-3.44

0.13

5.35e-7

0.00000355

carbohydrate catabolic process,glycoside catabolic...

alpha-galactosidase activity,alpha-N-acetylgalacto...

cytoplasm,lysosome,extracellular exosome

16

11

16

_LDGC[+57]FSTPEER_.2|_RFPHGIPFLADYVHSLGLK_.5|_RFPH...

SEN / CTL

Q15599

Na(+)/H(+) exchange regulatory cofactor NHE-RF2

SLC9A3R2

-3.46

2.74

0.0479

0.0482

protein complex assembly,cell-cell adhesion

receptor binding,protein binding,beta-catenin bind...

nucleus,plasma membrane,cell-cell adherens junctio...

23

18

23

_RVEPGSPAEAAALR_.2|_RVEPGSPAEAAALR_.3|_LLVVDPETDEH...

SEN / CTL

Q8IZD4

mRNA-decapping enzyme 1B

DCP1B

-3.51

0.47

0.0000731

0.00031

nuclear-transcribed mRNA catabolic process, nonsen...

mRNA binding,protein binding,enzyme activator acti...

cytoplasmic mRNA processing body,nucleus,cytoplasm...

15

13

15

_IVDVASQVALYTFGHR_.3|_IVDVASQVALYTFGHR_.2|_LQSTPGA...

SEN / CTL

Q13459

Unconventional myosin-IXb

MYO9B

-3.51

1.27

0.00343

0.00758

Rho protein signal transduction,actin filament-bas...

microfilament motor activity,actin binding,GTPase ...

cytoplasm,cytosol,actin filament,cell cortex,actin...

41

34

41

_ASVPIVLEK_.2|_LASAVELWR_.2|_LENFPIHAITGVLK_.3|_LE...

SEN / CTL

Q68CQ4

Digestive organ expansion factor homolog

DIEXF

-3.56

2.12

0.0198

0.0261

maturation of SSU-rRNA from tricistronic rRNA tran...

protein binding,rRNA binding,U3 snoRNA binding,pol...

nucleoplasm,nucleolus,small-subunit processome

28

21

28

_NVPMTGSISHVLVQLPHVFQR_.4|_NVPMTGSISHVLVQLPHVFQR_....

SEN / CTL

P16435

NADPH--cytochrome P450 reductase

POR

-3.57

0.86

0.000745

0.00233

regulation of growth plate cartilage chondrocyte p...

NADPH-hemoprotein reductase activity,cytochrome-b5...

mitochondrion,endoplasmic reticulum membrane,membr...

46

32

46

_TNVLYELAQYASEPSEQELLRK_.4|_TNVLYELAQYASEPSEQELLRK...

SEN / CTL

P16144

Integrin beta-4

ITGB4

-3.67

1.53

0.00587

0.0108

autophagy,cell adhesion,cell-matrix adhesion,integ...

G-protein coupled receptor binding,receptor activi...

nucleus,plasma membrane,integrin complex,cell surf...

55

46

55

_THQEVPSEPGR_.2|_THQEVPSEPGR_.3|_SEHSHSTTLPR_.3|_R...

SEN / CTL

P11388

DNA topoisomerase 2-alpha

TOP2A

-4.23

1.77

0.00591

0.0109

resolution of meiotic recombination intermediates,...

magnesium ion binding,DNA binding,chromatin bindin...

condensed chromosome,nucleus,nucleoplasm,nucleolus...

66

55

66

_IKNENTEGSPQEDGVELEGLK_.3|_EKQDEQVGLPGK_.3|_RDPALN...

SEN / CTL

O60828

Polyglutamine-binding protein 1

PQBP1

-4.43

1.53

0.00293

0.00685

alternative mRNA splicing, via spliceosome,transcr...

DNA binding,transcription coactivator activity,pro...

nucleus,nucleoplasm,cytoplasm,cytoplasmic stress g...

10

8

10

_TGADTTAAGPLFQQR_.2|_SSNADAEEKLDR_.3|_GTWSTGLPK_.2...

SEN / CTL

P50238

Cysteine-rich protein 1

CRIP1

-4.68

1.21

0.00099

0.00298

immune response,heart development,cell proliferati...

AT DNA binding,zinc ion binding,DNA binding, bendi...

cytoplasm

13

6

13

_C[+57]NKEVYFAER_.2|_C[+57]NKEVYFAER_.3|_TLTSGGHAE...

SEN / CTL

P31629

Transcription factor HIVEP2

HIVEP2

-4.99

1.41

0.00137

0.00398

regulation of transcription, DNA-templated,transcr...

DNA binding,transcription factor activity, sequenc...

nucleus,nucleoplasm

26

22

26

_DISC[+57]LSSLK_.2|_GKGDIHGDKDIGSK_.3|_SGFAMAGHENL...

SEN / CTL

Q969Y2

tRNA modification GTPase GTPBP3, mitochondrial

GTPBP3

-5.02

0.72

0.000101

0.000416

tRNA wobble uridine modification,tRNA methylation

GTPase activity,protein binding,GTP binding

mitochondrion

13

13

13

_EGVGPVEQEGVR_.2|_QLDGELGHLC[+57]R_.3|_SGVHVVVTGPP...

SEN / CTL

Q16774

Guanylate kinase

GUK1

-6.13

1.65

0.00114

0.00341

purine nucleotide metabolic process,dGDP biosynthe...

guanylate kinase activity,ATP binding

cytosol

23

15

23

_LAAAQADMESSK_.2|_LAAAQADM[+16]ESSK_.2|_NTETEESLVK...