Post-Atazanivir SASP in human fibroblasts (day 14)

Comparison

UniProtIds

Protein Description

Genes

Log2 Ratio

Std. Dev.

PValue

QValue

GO Biological Process

GO Molecular Process

GO Cellular Process

Ratios

Unique Peptides

Elution Groups

Elution Group

SEN / CTL

P09341

P19875

P19876

Growth-regulated alpha protein;C-X-C motif chemokine 2;C-X-C motif chemokine 3

CXCL1

CXCL2

CXCL3

4.6

1.28

0.0179

0.00467

chemotaxis,inflammatory response,immune response,s...

receptor binding,chemokine activity,enzyme activat...

extracellular region,extracellular space,intracell...

3

1

2

SPGPHC[CAM]AQTEVIATLK.3|SPGPHC[CAM]AQTEVIATLK.2

SEN / CTL

Q8NBJ7

Sulfatase-modifying factor 2

SUMF2

4.33

0.81

0.012

0.00329

post-translational protein modification

metal ion binding

endoplasmic reticulum,endoplasmic reticulum lumen

3

14

22

SVLWWLPVEK.2|LEHPVLHVSWNDAR.4|LEHPVLHVSWNDAR.3|LEH...

SEN / CTL

P01889

HLA class I histocompatibility antigen, B-7 alpha chain

HLA-B

4.13

1

0.0159

0.00418

3

4

4

AYLEGEC[CAM]VEWLR.2|RAYLEGEC[CAM]VEWLR.3|GHDQYAYDG...

SEN / CTL

Q9Y287

Integral membrane protein 2B

ITM2B

3.98

0.51

0.00584

0.00173

nervous system development,negative regulation of ...

beta-amyloid binding,protein binding,ATP binding

Golgi membrane,extracellular region,extracellular ...

3

6

6

NLLELLINIK.2|FAVETLIC[CAM]S.2|VTFNSALAQK.2|IENIDHL...

SEN / CTL

P26022

Pentraxin-related protein PTX3

PTX3

3.77

1.12

5.33e-9

4.71e-9

response to yeast,inflammatory response,opsonizati...

complement component C1q binding,(1->3)-beta-D-glu...

extracellular region,extracellular space

15

7

7

LTSALDELLQATR.2|ALAAVLEELR.2|SWLPAGC[CAM]ETAILFPMR...

SEN / CTL

P03956

Interstitial collagenase

MMP1

3.72

1.13

3.1e-8

2.43e-8

proteolysis,viral process,extracellular matrix dis...

endopeptidase activity,metalloendopeptidase activi...

extracellular region,proteinaceous extracellular m...

12

6

6

AFQLWSNVTPLTFTK.2|DGFFYFFHGTR.3|SQNPVQPIGPQTPK.2|T...

SEN / CTL

P17096

High mobility group protein HMG-I/HMG-Y

HMGA1

3.59

1.1

0.0235

0.00595

DNA unwinding involved in DNA replication,nucleoso...

transcriptional activator activity, RNA polymerase...

nucleus,nucleoplasm,transcription factor complex,c...

3

9

13

KQPPVSPGTALVGSQKEPSEVPTPK.4|KQPPVSPGTALVGSQKEPSEVP...

SEN / CTL

Q6UVY6

DBH-like monooxygenase protein 1

MOXD1

3.48

1.94

0.0697

0.0157

oxidation-reduction process

copper ion binding,protein binding,oxidoreductase ...

endoplasmic reticulum membrane,integral component ...

3

2

2

LVLSLPVNVR.2|ELHTC[CAM]DINDK.2

SEN / CTL

P02765

Alpha-2-HS-glycoprotein

AHSG

3.32

3.73

0.0383

0.0093

skeletal system development,ossification,platelet ...

endopeptidase inhibitor activity,cysteine-type end...

extracellular region,extracellular space,extracell...

9

15

28

C[CAM]NLLAEK.2|C[CAM]DSSPDSAEDVR.2|C[CAM]DSSPDSAED...

SEN / CTL

P78417

Glutathione S-transferase omega-1

GSTO1

3.25

1.38

0.0000576

0.0000281

glutathione metabolic process,regulation of releas...

glutathione transferase activity,oxidoreductase ac...

cytoplasm,cytosol,extracellular exosome

9

28

41

VPSLVGSFIR.2|MILELFSK.2|M[Oxi]ILELFSK.2|GIRHEVININ...

SEN / CTL

Q15904

V-type proton ATPase subunit S1

ATP6AP1

3.16

1.16

0.0299

0.00746

insulin receptor signaling pathway,ATP hydrolysis ...

transporter activity,ATP binding,Rab GTPase bindin...

endosome membrane,integral component of membrane,p...

3

9

11

LGASPLHVDLATLR.3|LGASPLHVDLATLR.2|DVAVVAGGLGR.2|LF...

SEN / CTL

Q99988

Growth/differentiation factor 15

GDF15

3.08

0.59

0.00953

0.00266

signal transduction,transforming growth factor bet...

cytokine activity,transforming growth factor beta ...

extracellular region,extracellular space,nucleus,c...

3

7

7

ASLEDLGWADWVLSPR.2|ASFPGPSELHSEDSR.3|RYEDLLTR.2|AA...

SEN / CTL

P04156

Major prion protein

PRNP

2.97

1.37

0.0423

0.0101

negative regulation of protein phosphorylation,cel...

copper ion binding,lamin binding,microtubule bindi...

nucleus,cytoplasm,endoplasmic reticulum,Golgi appa...

3

4

5

VVEQMC[CAM]ITQYER.2|VVEQM[Oxi]C[CAM]ITQYER.2|PIIHF...

SEN / CTL

P20962

Parathymosin

PTMS

2.94

1.39

0.0535

0.0126

immune system process,DNA replication

zinc ion binding

nucleus,cytosol

3

5

8

SVEAAAELSAK.2|AAEEEDEADPKR.3|AAEEEDEADPKR.2|RAAEEE...

SEN / CTL

Q06323

Proteasome activator complex subunit 1

PSME1

2.94

1.76

0.0589

0.0136

MAPK cascade,protein polyubiquitination,stimulator...

endopeptidase activator activity

proteasome complex,nucleoplasm,cytoplasm,cytosol,p...

3

26

39

NAYAVLYDIILK.2|NAYAVLYDIILK.3|IVVLLQR.2|VFELMTSLHT...

SEN / CTL

P30048

Thioredoxin-dependent peroxide reductase, mitochondrial

PRDX3

2.92

1.48

0.0593

0.0136

response to reactive oxygen species,maternal place...

protein binding,protein C-terminus binding,thiored...

cytoplasm,mitochondrion,mitochondrial matrix,early...

3

19

41

GLFIIDPNGVIK.2|HLSVNDLPVGR.3|HLSVNDLPVGR.2|SVEETLR...

SEN / CTL

P07585

Decorin

DCN

2.9

1.29

1.14e-19

3.93e-19

kidney development,placenta development,negative r...

protein kinase inhibitor activity,protein binding,...

extracellular region,collagen type VI trimer,extra...

45

22

33

VSPGAFTPLVKLER.3|ASYSGVSLFSNPVQYWEIQPSTFR.3|KVTFNG...

SEN / CTL

P04632

Calpain small subunit 1

CAPNS1

2.71

0.33

0.00589

0.00173

proteolysis,positive regulation of cell proliferat...

calcium-dependent cysteine-type endopeptidase acti...

cytosol,plasma membrane,membrane,extracellular exo...

3

18

39

THYSNIEANESEEVR.3|THYSNIEANESEEVR.2|LGFEEFK.2|VVTR...

SEN / CTL

Q9UHL4

Dipeptidyl peptidase 2

DPP7

2.71

2.36

0.234

0.0476

proteolysis

serine-type carboxypeptidase activity,serine-type ...

lysosome,Golgi apparatus,cytosol,cytoplasmic, memb...

3

18

27

GHTELLTVEQALADFAELLR.3|KLEATIIGEWVK.3|KLEATIIGEWVK...

SEN / CTL

Q9UNW1

Multiple inositol polyphosphate phosphatase 1

MINPP1

2.63

0.66

0.0000716

0.000034

ossification,polyphosphate metabolic process,depho...

acid phosphatase activity,phosphohistidine phospha...

endoplasmic reticulum,endoplasmic reticulum lumen,...

6

12

13

LASLFPALFSR.2|SGLIVPYASNLIFVLYHC[CAM]ENAK.3|DKEPLT...

SEN / CTL

P01033

Metalloproteinase inhibitor 1

TIMP1

2.62

1.29

5e-15

9.5e-15

cell activation,platelet degranulation,aging,posit...

protease binding,cytokine activity,protein binding...

extracellular region,proteinaceous extracellular m...

33

7

11

TYTVGC[CAM]EEC[CAM]TVFPC[CAM]LSIPC[CAM]K.3|LQDGLLH...

SEN / CTL

Q08629

Testican-1

SPOCK1

2.62

0.17

0.00147

0.000501

regulation of cell growth,neuron migration,cell ad...

serine-type endopeptidase inhibitor activity,cyste...

proteinaceous extracellular matrix,extracellular s...

3

2

2

SLLGAFIPR.2|ATQC[CAM]HGSTGQC[CAM]WC[CAM]VDK.3

SEN / CTL

Q9Y646

Carboxypeptidase Q

CPQ

2.54

0.82

0.000366

0.000148

proteolysis,thyroid hormone generation,tissue rege...

carboxypeptidase activity,protein homodimerization...

extracellular space,cytoplasm,lysosome,endoplasmic...

6

10

10

LALLVDTVGPR.2|AIINLAVYGK.2|VHLEPVRIPHWER.4|VGALASL...

SEN / CTL

P39059

Collagen alpha-1(XV) chain

COL15A1

2.52

1.37

7.05e-8

5.1e-8

angiogenesis,cell adhesion,signal transduction,cel...

extracellular matrix structural constituent

extracellular region,collagen type XV trimer,extra...

18

14

24

NLVTAFSNMDDMLQK.2|AFLSSHLQDLSTIVR.3|AFLSSHLQDLSTIV...

SEN / CTL

P23284

Peptidyl-prolyl cis-trans isomerase B

PPIB

2.5

1.54

0.00000254

0.00000148

protein peptidyl-prolyl isomerization,positive reg...

peptidyl-prolyl cis-trans isomerase activity,prote...

nucleus,endoplasmic reticulum,endoplasmic reticulu...

15

28

56

TVDNFVALATGEK.2|TVDNFVALATGEK.3|VLEGMEVVR.2|VLEGM[...

SEN / CTL

P52823

Stanniocalcin-1

STC1

2.49

0.27

0.00386

0.00118

ossification,endothelial cell morphogenesis,growth...

hormone activity

extracellular space,nucleus,cytoplasm,apical plasm...

3

2

3

RNPEAITEVVQLPNHFSNR.3|IGPNMASLFHILQTDHC[CAM]AQTHPR...

SEN / CTL

P07858

Cathepsin B

CTSB

2.47

1.67

5.55e-13

8.79e-13

toll-like receptor signaling pathway,proteolysis,c...

cysteine-type endopeptidase activity,serine-type e...

extracellular region,extracellular space,intracell...

51

22

46

VMFTEDLKLPASFDAR.3|EQWPQC[CAM]PTIK.2|GQDHC[CAM]GIE...

SEN / CTL

P24821

Tenascin

TNC

2.46

1.4

1.5e-22

7.62e-22

osteoblast differentiation,cell adhesion,negative ...

syndecan binding

extracellular region,basement membrane,interstitia...

63

77

105

TAHISGLPPSTDFIVYLSGLAPSIR.3|TAHISGLPPSTDFIVYLSGLAP...

SEN / CTL

P09429

High mobility group protein B1

HMGB1

2.46

0.87

0.0333

0.00821

negative regulation of transcription from RNA poly...

four-way junction DNA binding,bubble DNA binding,l...

condensed chromosome,extracellular region,extracel...

3

26

57

RPPSAFFLFC[CAM]SEYRPK.3|RPPSAFFLFC[CAM]SEYRPK.4|RP...

SEN / CTL

Q14766

Latent-transforming growth factor beta-binding protein 1

LTBP1

2.43

1.51

9.2e-7

5.55e-7

ventricular septum development,transmembrane recep...

transforming growth factor beta-activated receptor...

microfibril,extracellular region,proteinaceous ext...

18

35

44

VQEGYTC[CAM]DC[CAM]FDGYHLDTAK.3|MTC[CAM]VDVNEC[CAM...

SEN / CTL

P10619

Lysosomal protective protein

CTSA

2.41

1.89

0.0109

0.003

proteolysis,glycosphingolipid metabolic process,in...

carboxypeptidase activity,serine-type carboxypepti...

nucleoplasm,lysosome,endoplasmic reticulum,membran...

6

15

29

C[CAM]NFYDNKDLEC[CAM]VTNLQEVAR.3|GAGHMVPTDKPLAAFTM...

SEN / CTL

P07339

Cathepsin D

CTSD

2.39

1.33

1.42e-9

1.34e-9

proteolysis,autophagy,antigen processing and prese...

aspartic-type endopeptidase activity,cysteine-type...

extracellular region,extracellular space,lysosome,...

24

30

62

FDGILGMAYPR.2|FDGILGM[Oxi]AYPR.2|QVFGEATKQPGITFIAA...

SEN / CTL

P40261

Nicotinamide N-methyltransferase

NNMT

2.37

0.9

0.000598

0.000229

response to organonitrogen compound,animal organ r...

nicotinamide N-methyltransferase activity,pyridine...

cytosol

6

13

20

NLGSLLKPGGFLVIMDALK.3|NLGSLLKPGGFLVIM[Oxi]DALK.3|N...

SEN / CTL

Q15149

Plectin

PLEC

2.35

1.93

5.4e-22

2.41e-21

hemidesmosome assembly,cell-cell adhesion

actin binding,protein binding,structural constitue...

cytoplasm,cytosol,plasma membrane,brush border,cel...

117

489

728

VLADPSDDTKGFFDPNTHENLTYR.4|IISLETYNLLR.2|SQVEEELFS...

SEN / CTL

Q7Z304

MAM domain-containing protein 2

MAMDC2

2.33

0.37

0.00776

0.00219

proteinaceous extracellular matrix,endoplasmic ret...

3

1

1

AGDHTTGLGYYLLANTK.3

SEN / CTL

Q13443

Disintegrin and metalloproteinase domain-containing protein 9

ADAM9

2.33

1.23

0.0603

0.0138

activation of MAPKK activity,membrane protein ecto...

metalloendopeptidase activity,protein kinase C bin...

extracellular space,focal adhesion,cell surface,in...

3

22

24

QVSYVIQAEGK.2|EGTLITDHPNIQNHC[CAM]HYR.5|EGTLITDHPN...

SEN / CTL

P53621

Coatomer subunit alpha

COPA

2.3

0.67

0.00000113

6.78e-7

intracellular protein transport,ER to Golgi vesicl...

hormone activity,structural molecule activity

Golgi membrane,extracellular space,cytoplasm,endop...

9

92

167

VTTVTEIGKDVIGLR.3|VTTVTEIGKDVIGLR.2|TLDLPIYVTR.2|L...

SEN / CTL

O60814

P06899

P23527

P33778

P57053

P58876

P62807

Q16778

Q5QNW6

Q8N257

Q93079

Q99877

Q99879

Q99880

Histone H2B type 1-K;Histone H2B type 1-J;Histone H2B type 1-O;Histone H2B type 1-B;Histone H2B type F-S;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 2-E;Histone H2B type 2-F;Histone H2B type 3-B;Histone H2B type 1-H;Histone H2B type 1-N;Histone H2B type 1-M;Histone H2B type 1-L

HIST1H2BK

HIST1H2BJ

HIST1H2BO

HIST1H2BB

H2BFS

HIST1H2BD

HIST1H2BC

HIST2H2BE

HIST2H2BF

HIST3H2BB

HIST1H2BH

HIST1H2BN

HIST1H2BM

HIST1H2BL

2.3

0.56

0.0153

0.00405

innate immune response in mucosa,nucleosome assemb...

molecular_function,DNA binding,protein heterodimer...

nuclear nucleosome,extracellular space,nucleus,nuc...

3

1

8

AMGIMNSFVNDIFER.2|AM[Oxi]GIMNSFVNDIFER.3|AMGIM[Oxi...

SEN / CTL

Q96AY3

Peptidyl-prolyl cis-trans isomerase FKBP10

FKBP10

2.28

1.06

0.00000836

0.00000454

protein peptidyl-prolyl isomerization,chaperone-me...

peptidyl-prolyl cis-trans isomerase activity,calci...

endoplasmic reticulum lumen,endoplasmic reticulum ...

12

34

53

IIIPPFLAYGEK.2|GMDQGLLGMC[CAM]PGER.2|GM[Oxi]DQGLLG...

SEN / CTL

P22392

Nucleoside diphosphate kinase B

NME2

2.28

0.67

0.000179

0.0000792

negative regulation of myeloid leukocyte different...

DNA binding,transcription factor activity, sequenc...

ruffle,nucleus,cytoplasm,cytosol,intermediate fila...

6

19

36

SAEKEISLWFKPEELVDYK.4|SAEKEISLWFKPEELVDYK.3|SAEKEI...

SEN / CTL

Q15113

Procollagen C-endopeptidase enhancer 1

PCOLCE

2.26

1.64

0.000396

0.000158

proteolysis,multicellular organism development,pos...

protein binding,collagen binding,heparin binding,p...

extracellular space,extracellular exosome,extracel...

9

9

10

YDALEVFAGSGTSGQR.2|TGGLDLPSPPTGASLK.2|FDLEPDTYC[CA...

SEN / CTL

O60506

Heterogeneous nuclear ribonucleoprotein Q

SYNCRIP

2.24

0.51

0.0136

0.00367

mRNA splicing, via spliceosome,osteoblast differen...

nucleotide binding,RNA binding,poly(A) binding,pol...

nucleus,nucleoplasm,endoplasmic reticulum,membrane...

3

48

77

LMMDPLTGLNR.2|LM[Oxi]MDPLTGLNR.2|LMM[Oxi]DPLTGLNR....

SEN / CTL

Q7Z7M9

Polypeptide N-acetylgalactosaminyltransferase 5

GALNT5

2.24

1.52

0.0585

0.0135

glycosaminoglycan biosynthetic process,O-glycan pr...

polypeptide N-acetylgalactosaminyltransferase acti...

Golgi membrane,cellular_component,integral compone...

3

4

4

C[CAM]PVMAGGLFSIDK.2|VEVDLDQTQR.2|EILLVDDFSTK.2|EG...

SEN / CTL

O00391

Sulfhydryl oxidase 1

QSOX1

2.23

1.07

4.34e-24

2.75e-23

platelet degranulation,negative regulation of macr...

protein disulfide isomerase activity,flavin-linked...

extracellular region,extracellular space,Golgi app...

60

23

29

KFGVTDFPSC[CAM]YLLFR.3|SFYTAYLQR.2|SALYSPSDPLTLLQA...

SEN / CTL

P62310

U6 snRNA-associated Sm-like protein LSm3

LSM3

2.23

1.76

0.105

0.0229

mRNA splicing, via spliceosome,mRNA processing,cyt...

RNA binding,protein binding,poly(A) RNA binding

cytoplasmic mRNA processing body,nucleus,nucleopla...

3

4

4

GDGVVLVAPPLRVG.2|NIPMLFVR.2|RNIPMLFVR.2|GDGVVLVAPP...

SEN / CTL

P49721

Proteasome subunit beta type-2

PSMB2

2.22

0.49

0.0111

0.00305

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

3

21

33

FILNLPTFSVR.2|AVELLRK.2|VAASNIVQMKDDHDK.4|VAASNIVQ...

SEN / CTL

P17405

Sphingomyelin phosphodiesterase

SMPD1

2.22

0.74

0.0225

0.00572

sphingomyelin metabolic process,sphingomyelin cata...

sphingomyelin phosphodiesterase activity,zinc ion ...

extracellular space,lysosome,endosome,plasma membr...

3

8

10

IGGFYALSPYPGLR.2|GHPPSEPC[CAM]GTPC[CAM]R.3|GHPPSEP...

SEN / CTL

P17931

Galectin-3

LGALS3

2.2

0.84

0.00284

0.000897

monocyte chemotaxis,mRNA processing,RNA splicing,n...

protein binding,IgE binding,carbohydrate binding,c...

immunological synapse,extracellular space,nucleus,...

6

12

19

MLITILGTVKPNANR.3|M[Oxi]LITILGTVKPNANR.3|GNDVAFHFN...

SEN / CTL

Q16363

Laminin subunit alpha-4

LAMA4

2.19

1.46

8.71e-21

3.48e-20

cell adhesion,regulation of cell adhesion,extracel...

receptor binding,extracellular matrix structural c...

extracellular region,basement membrane,basal lamin...

63

42

51

SLLSDVEELVEKENQASR.3|C[CAM]LDGYIGDSIR.2|ELVDEEADEA...

SEN / CTL

O43399

Tumor protein D54

TPD52L2

2.18

0.53

0.0147

0.00391

poly(A) RNA binding

3

18

28

TPAVEGLTEAEEEELRAELTKVEEEIVTLR.4|TPAVEGLTEAEEEELRA...

SEN / CTL

Q13822

Ectonucleotide pyrophosphatase/phosphodiesterase family member 2

ENPP2

2.17

0.96

0.0000784

0.0000368

phosphate-containing compound metabolic process,re...

nucleic acid binding,phosphodiesterase I activity,...

extracellular space,plasma membrane,integral compo...

9

5

5

WWGGQPLWITATK.2|AGTFFWSVVIPHER.3|TYLHTYESEI.2|YGPF...

SEN / CTL

Q15582

Transforming growth factor-beta-induced protein ig-h3

TGFBI

2.13

1.99

3.05e-27

2.58e-26

angiogenesis,chondrocyte differentiation,cell adhe...

integrin binding,protein binding,collagen binding,...

extracellular region,proteinaceous extracellular m...

105

38

60

EGVYTVFAPTNEAFR.2|GC[CAM]PAALPLSNLYETLGVVGSTTTQLYT...

SEN / CTL

P61769

Beta-2-microglobulin

B2M

2.12

1.07

0.0000714

0.000034

retina homeostasis,positive regulation of T cell m...

glycoprotein binding,protein binding,identical pro...

Golgi membrane,extracellular region,extracellular ...

12

7

9

SNFLNC[CAM]YVSGFHPSDIEVDLLK.3|SNFLNC[CAM]YVSGFHPSD...

SEN / CTL

P15121

Aldose reductase

AKR1B1

2.11

0.83

0.00142

0.000491

tissue homeostasis,carbohydrate metabolic process,...

alditol:NADP+ 1-oxidoreductase activity,aldo-keto ...

extracellular space,nucleoplasm,cytoplasm,cytosol,...

6

26

42

VAIDVGYR.2|MPILGLGTWK.2|M[Oxi]PILGLGTWK.2|LLLNNGAK...

SEN / CTL

P00736

Complement C1r subcomponent

C1R

2.1

1.41

5.1e-13

8.24e-13

proteolysis,immune response,complement activation,...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular exosome,blood m...

48

25

35

TLDEFTIIQNLQPQYQFR.3|LVFQQFDLEPSEGC[CAM]FYDYVK.3|Q...

SEN / CTL

P22692

Insulin-like growth factor-binding protein 4

IGFBP4

2.1

0.92

1.55e-7

1.04e-7

skeletal system development,regulation of cell gro...

receptor binding,insulin-like growth factor I bind...

extracellular region,extracellular space

15

3

5

THEDLYIIPIPNC[CAM]DR.3|THEDLYIIPIPNC[CAM]DR.2|GELD...

SEN / CTL

P80723

Brain acid soluble protein 1

BASP1

2.1

0.58

0.0202

0.00516

thorax and anterior abdomen determination,gonad de...

transcription corepressor activity,protein binding...

nucleus,cytoplasm,cytoskeleton,plasma membrane,nuc...

3

28

41

AQGPAASAEEPKPVEAPAANSDQTVTVKE.3|AQGPAASAEEPKPVEAPA...

SEN / CTL

P07237

Protein disulfide-isomerase

P4HB

2.09

1.13

2.47e-17

5.88e-17

response to reactive oxygen species,peptidyl-proli...

protein disulfide isomerase activity,integrin bind...

extracellular region,endoplasmic reticulum,endopla...

54

62

113

EADDIVNWLK.2|ILEFFGLK.2|LITLEEEMTK.2|LITLEEEM[Oxi]...

SEN / CTL

P05155

Plasma protease C1 inhibitor

SERPING1

2.09

1.29

5.86e-11

6.95e-11

negative regulation of complement activation, lect...

serine-type endopeptidase inhibitor activity,prote...

extracellular region,extracellular space,platelet ...

33

19

34

FQPTLLTLPR.2|LVLLNAIYLSAK.2|IKVTTSQDMLSIMEK.3|LLDS...

SEN / CTL

P07093

Glia-derived nexin

SERPINE2

2.09

1.6

2.12e-10

2.27e-10

blood coagulation,negative regulation of cell prol...

serine-type endopeptidase inhibitor activity,recep...

extracellular region,extracellular space,cytosol,e...

27

11

14

ASAATTAILIAR.2|SYQVPMLAQLSVFR.2|DMIDNLLSPDLIDGVLTR...

SEN / CTL

Q12907

Vesicular integral-membrane protein VIP36

LMAN2

2.09

2.22

0.147

0.0311

ER to Golgi vesicle-mediated transport,retrograde ...

glycoprotein binding,mannose binding,carbohydrate ...

Golgi membrane,extracellular space,endoplasmic ret...

3

21

31

NLHGDGIALWYTR.3|NLHGDGIALWYTR.2|DRLVPGPVFGSK.3|DRL...

SEN / CTL

P80303

Nucleobindin-2

NUCB2

2.08

1.3

7.85e-8

5.63e-8

DNA binding,calcium ion binding

extracellular space,nuclear envelope,endoplasmic r...

21

26

37

LVTLEEFLK.2|LHDVNSDGFLDEQELEALFTK.3|VYDPKNEEDDMVEM...

SEN / CTL

O75828

P16152

Carbonyl reductase [NADPH] 3;Carbonyl reductase [NADPH] 1

CBR3

CBR1

2.08

0.12

0.00123

0.000432

phylloquinone catabolic process,cognition,oxidatio...

3-keto sterol reductase activity,carbonyl reductas...

extracellular space,nucleoplasm,cytoplasm,cytosol;...

3

1

2

FHQLDIDDLQSIR.3|FHQLDIDDLQSIR.2

SEN / CTL

P61604

10 kDa heat shock protein, mitochondrial

HSPE1

2.07

1.21

0.00218

0.000706

osteoblast differentiation,protein folding,activat...

protein binding,ATP binding,poly(A) RNA binding,me...

mitochondrion,mitochondrial matrix,membrane,extrac...

6

19

27

FLPLFDR.2|VLQATVVAVGSGSK.2|VLQATVVAVGSGSK.3|GKGGEI...

SEN / CTL

P12111

Collagen alpha-3(VI) chain

COL6A3

2.06

1.38

7.15e-86

5.43e-84

cell adhesion,muscle organ development,negative re...

serine-type endopeptidase inhibitor activity

extracellular region,proteinaceous extracellular m...

342

165

233

ALILVGLER.2|LSDAGITPLFLTR.2|LLPSFVSSENAFYLSPDIR.3|...

SEN / CTL

P09871

Complement C1s subcomponent

C1S

2.06

1.32

7.03e-14

1.24e-13

proteolysis,complement activation,complement activ...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular exosome,blood m...

48

26

38

TNFDNDIALVR.2|MGPTVSPIC[CAM]LPGTSSDYNLMDGDLGLISGWG...

SEN / CTL

Q15084

Protein disulfide-isomerase A6

PDIA6

2.06

1.35

5.06e-11

6.31e-11

protein folding,response to endoplasmic reticulum ...

protein disulfide isomerase activity,protein bindi...

endoplasmic reticulum,endoplasmic reticulum lumen,...

27

32

56

TGEAIVDAALSALR.2|TGEAIVDAALSALR.3|ALDLFSDNAPPPELLE...

SEN / CTL

Q9Y2E5

Epididymis-specific alpha-mannosidase

MAN2B2

2.06

1.36

0.000916

0.000336

mannose metabolic process,protein deglycosylation,...

alpha-mannosidase activity,zinc ion binding,mannan...

lysosomal lumen,extracellular exosome

9

15

22

FIAVEQEFFR.2|GHLDPTWALQQLQQLR.3|GHLDPTWALQQLQQLR.2...

SEN / CTL

P15586

N-acetylglucosamine-6-sulfatase

GNS

2.06

0.12

0.00109

0.000387

glycosaminoglycan catabolic process,keratan sulfat...

N-acetylglucosamine-6-sulfatase activity,sulfuric ...

lysosomal lumen,extracellular exosome

3

18

33

IQEPNTFPAILR.2|RQLYEFDIK.3|RQLYEFDIK.2|TIDPELLGK.2...

SEN / CTL

P00558

Phosphoglycerate kinase 1

PGK1

2.05

1.11

4.83e-23

2.62e-22

gluconeogenesis,phosphorylation,epithelial cell di...

phosphoglycerate kinase activity,ATP binding

cytosol,membrane,membrane raft,extracellular exoso...

66

59

126

AC[CAM]ANPAAGSVILLENLR.2|AC[CAM]ANPAAGSVILLENLR.3|...

SEN / CTL

P14550

Alcohol dehydrogenase [NADP(+)]

AKR1A1

2.05

0.9

0.00193

0.000633

glucose metabolic process,cellular aldehyde metabo...

alditol:NADP+ 1-oxidoreductase activity,aldo-keto ...

extracellular space,cytosol,apical plasma membrane...

6

26

45

MPLIGLGTWK.2|M[Oxi]PLIGLGTWK.2|GLEVTAYSPLGSSDR.2|G...

SEN / CTL

Q16610

Extracellular matrix protein 1

ECM1

2.04

0.99

1.04e-16

2.32e-16

ossification,angiogenesis,positive regulation of e...

protease binding,signal transducer activity,interl...

extracellular region,proteinaceous extracellular m...

42

22

28

ELLALIQLER.2|RAPYPNYDRDILTIDIGR.4|LVWEEAMSR.2|AC[C...

SEN / CTL

P30044

Peroxiredoxin-5, mitochondrial

PRDX5

2.04

0.72

0.000685

0.000259

response to reactive oxygen species,apoptotic proc...

RNA polymerase III regulatory region DNA binding,p...

extracellular space,nucleus,cytoplasm,mitochondrio...

6

19

35

FSMVVQDGIVK.2|FSM[Oxi]VVQDGIVK.2|THLPGFVEQAEALK.3|...

SEN / CTL

P06576

ATP synthase subunit beta, mitochondrial

ATP5B

2.03

1.3

9.19e-8

6.52e-8

angiogenesis,osteoblast differentiation,generation...

transporter activity,protein binding,ATP binding,t...

nucleus,mitochondrion,mitochondrial proton-transpo...

21

47

115

AHGGYSVFAGVGER.3|AHGGYSVFAGVGER.2|IGLFGGAGVGK.2|FT...

SEN / CTL

P12109

Collagen alpha-1(VI) chain

COL6A1

2.01

1.35

1.27e-16

2.77e-16

osteoblast differentiation,cell adhesion,extracell...

platelet-derived growth factor binding

extracellular region,collagen type VI trimer,lysos...

63

49

69

LLLFSDGNSQGATPAAIEK.2|LLLFSDGNSQGATPAAIEK.3|IALVIT...

SEN / CTL

P68104

Elongation factor 1-alpha 1

EEF1A1

2

1.49

9.16e-11

1.02e-10

transcription, DNA-templated,regulation of transcr...

tRNA binding,translation elongation factor activit...

extracellular space,nucleus,nucleolus,cytoplasm,cy...

42

52

144

EHALLAYTLGVK.3|EHALLAYTLGVK.2|IGGIGTVPVGR.2|YYVTII...

SEN / CTL

P55058

Phospholipid transfer protein

PLTP

2

2.42

0.00251

0.0008

lipid metabolic process,lipid transport,vitamin E ...

lipid binding

extracellular region,extracellular space

12

6

7

FLEQELETITIPDLR.2|FLEQELETITIPDLR.3|GVQIPLPEGINFVH...

SEN / CTL

P11047

Laminin subunit gamma-1

LAMC1

1.99

0.9

1.51e-35

1.86e-34

protein complex assembly,cell adhesion,endoderm de...

extracellular matrix structural constituent

extracellular region,basement membrane,laminin-1 c...

81

77

97

SQEC[CAM]YFDPELYR.2|TREDGPWIPYQYYSGSC[CAM]ENTYSK.3...

SEN / CTL

P51884

Lumican

LUM

1.99

1.42

1.4e-23

8.21e-23

visual perception,response to organic cyclic compo...

extracellular matrix structural constituent,collag...

extracellular region,proteinaceous extracellular m...

69

21

29

SLEYLDLSFNQIAR.2|SLEYLDLSFNQIAR.3|FNALQYLR.2|LPSGL...

SEN / CTL

P01034

Cystatin-C

CST3

1.99

0.6

1.13e-10

1.24e-10

eye development,response to hypoxia,cell activatio...

beta-amyloid binding,protease binding,endopeptidas...

extracellular region,basement membrane,extracellul...

18

7

11

ALDFAVGEYNK.2|KQIVAGVNYFLDVELGR.3|AFC[CAM]SFQIYAVP...

SEN / CTL

Q9NR99

Matrix-remodeling-associated protein 5

MXRA5

1.99

1

0.0468

0.0111

biological_process

molecular_function

extracellular exosome

3

3

3

C[CAM]VASNAAGADSLAIR.2|HSEKEPETNVAEGR.3|VLVQSPSTQP...

SEN / CTL

O00151

PDZ and LIM domain protein 1

PDLIM1

1.97

1.39

0.0000155

0.00000789

response to hypoxia,regulation of transcription, D...

transcription coactivator activity,zinc ion bindin...

transcription factor complex,cytoplasm,cytoskeleto...

15

27

50

GHFFVEDQIYC[CAM]EK.3|GHFFVEDQIYC[CAM]EK.2|IKGC[CAM...

SEN / CTL

P51888

Prolargin

PRELP

1.97

1.49

0.000313

0.000128

skeletal system development,cell aging,keratan sul...

extracellular matrix structural constituent,hepari...

extracellular region,proteinaceous extracellular m...

9

19

26

VLEKLPGLVFLYMEK.3|LDGNYLKPPIPLDLMMC[CAM]FR.3|LENLL...

SEN / CTL

P49588

Alanine--tRNA ligase, cytoplasmic

AARS

1.97

0.52

0.0205

0.00522

hair follicle development,tRNA modification,tRNA a...

tRNA binding,aminoacyl-tRNA editing activity,alani...

cytoplasm,cytosol,membrane,extracellular exosome,m...

3

62

112

NVGC[CAM]LQEALQLATSFAQLR.3|NVGC[CAM]LQEALQLATSFAQL...

SEN / CTL

Q9NWM8

Peptidyl-prolyl cis-trans isomerase FKBP14

FKBP14

1.97

0.92

0.0438

0.0104

protein peptidyl-prolyl isomerization,IRE1-mediate...

peptidyl-prolyl cis-trans isomerase activity,calci...

endoplasmic reticulum lumen,endoplasmic reticulum ...

3

8

10

GKIPPESTLIFNIDLLEIR.3|HNNGQPIWFTLGILEALK.4|HNNGQPI...

SEN / CTL

Q9Y6C2

EMILIN-1

EMILIN1

1.96

1.22

8.1e-11

9.47e-11

cell adhesion

protein binding,extracellular matrix constituent c...

extracellular region,proteinaceous extracellular m...

27

36

48

VLLNDGGYYDPETGVFTAPLAGR.3|FRGLEEGQAQAGQC[CAM]PSLEG...

SEN / CTL

P55268

Laminin subunit beta-2

LAMB2

1.96

1.08

3.63e-10

3.72e-10

cell adhesion,axon guidance,neuromuscular junction...

integrin binding,structural molecule activity

extracellular region,basement membrane,basal lamin...

24

53

60

SLADVDAILAR.2|GAVADTRDTEQTLYQVQER.3|TGGSAQPETPYSGP...

SEN / CTL

Q01995

Transgelin

TAGLN

1.96

1.46

2.07e-8

1.71e-8

muscle organ development,epithelial cell different...

actin binding

cytoplasm

33

24

41

LGFQVWLK.2|QMEQVAQFLK.2|QM[Oxi]EQVAQFLK.2|TDMFQTVD...

SEN / CTL

Q9NZN4

EH domain-containing protein 2

EHD2

1.96

0.86

0.0548

0.0128

endocytosis,blood coagulation,cortical actin cytos...

nucleic acid binding,calcium ion binding,protein b...

nucleus,cytosol,plasma membrane,caveola,endosome m...

3

30

46

SKYDEIFYNLAPADGK.3|SKYDEIFYNLAPADGK.2|DIQGLPR.2|VH...

SEN / CTL

Q02818

Nucleobindin-1

NUCB1

1.95

1.24

8.51e-22

3.59e-21

response to cisplatin,regulation of protein target...

G-protein alpha-subunit binding,DNA binding,calciu...

extracellular space,nucleus,early endosome,rough e...

66

33

46

DLELLIQTATR.2|ELQQAVLHMEQR.3|ELQQAVLHMEQR.2|LLERLP...

SEN / CTL

P98095

Fibulin-2

FBLN2

1.94

0.6

8.08e-10

7.87e-10

positive regulation of cell-substrate adhesion

extracellular matrix structural constituent,calciu...

extracellular region,proteinaceous extracellular m...

15

7

8

ITHYQLNFQTGLLVPAHIFR.4|RLNAYTGVVYLQR.3|IGPAPAFTGDT...

SEN / CTL

P37837

Transaldolase

TALDO1

1.94

0.43

0.0135

0.00367

carbohydrate metabolic process,xylulose biosynthet...

sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosp...

nucleus,cytoplasm,cytosol,extracellular exosome

3

31

43

ALAGC[CAM]DFLTISPK.2|ALAGC[CAM]DFLTISPK.3|KLGGSQED...

SEN / CTL

O75882

Attractin

ATRN

1.94

0.9

0.05

0.0118

inflammatory response,response to oxidative stress...

receptor activity,carbohydrate binding

extracellular space,cytoplasm,plasma membrane,inte...

3

29

41

LTLTPWVGLR.2|EQYAVVGHSAHIVTLK.4|EQYAVVGHSAHIVTLK.3...

SEN / CTL

P17900

Ganglioside GM2 activator

GM2A

1.93

1.85

0.00192

0.000632

glycosphingolipid metabolic process,ganglioside ca...

lipid transporter activity,phospholipase activator...

mitochondrion,hydrogen:potassium-exchanging ATPase...

9

10

12

SEFVVPDLELPSWLTTGNYR.3|SEFVVPDLELPSWLTTGNYR.2|IPC[...

SEN / CTL

P08253

72 kDa type IV collagenase

MMP2

1.93

0.5

0.0194

0.00497

angiogenesis,response to hypoxia,blood vessel matu...

metalloendopeptidase activity,serine-type endopept...

extracellular region,proteinaceous extracellular m...

3

2

2

IIGYTPDLDPETVDDAFAR.2|IDAVYEAPQEEK.2

SEN / CTL

P16070

CD44 antigen

CD44

1.92

0.48

0.00000262

0.00000151

cell-matrix adhesion,single organismal cell-cell a...

collagen binding,hyaluronic acid binding,cytokine ...

cytoplasm,Golgi apparatus,plasma membrane,integral...

9

12

18

YGFIEGHVVIPR.3|YGFIEGHVVIPR.2|ALSIGFETC[CAM]R.2|SQ...

SEN / CTL

P04406

Glyceraldehyde-3-phosphate dehydrogenase

GAPDH

1.91

1.18

6.91e-20

2.5e-19

microtubule cytoskeleton organization,gluconeogene...

glyceraldehyde-3-phosphate dehydrogenase (NAD+) (p...

nucleus,cytoplasm,lipid particle,cytosol,plasma me...

72

51

166

VPTANVSVVDLTC[CAM]R.2|VPTANVSVVDLTC[CAM]R.3|IISNAS...

SEN / CTL

P09382

Galectin-1

LGALS1

1.91

1.51

3.75e-13

6.33e-13

plasma cell differentiation,apoptotic process,sign...

glycoprotein binding,signal transducer activity,pr...

proteinaceous extracellular matrix,extracellular s...

48

17

33

SFVLNLGKDSNNLC[CAM]LHFNPR.4|SFVLNLGKDSNNLC[CAM]LHF...

SEN / CTL

P23142

Fibulin-1

FBLN1

1.9

1.48

1.65e-17

4.18e-17

negative regulation of protein phosphorylation,neg...

fibronectin binding,extracellular matrix structura...

extracellular region,proteinaceous extracellular m...

66

25

36

EFTRPEEIIFLR.3|EFTRPEEIIFLR.2|RGYQLSDVDGVTC[CAM]ED...

SEN / CTL

P31946

14-3-3 protein beta/alpha

YWHAB

1.9

1.22

0.00000998

0.0000053

MAPK cascade,protein targeting,viral process,negat...

transcription corepressor activity,protein binding...

nucleus,cytoplasm,mitochondrion,cytosol,cell-cell ...

15

37

87

NLLSVAYK.2|NLLSVAYK.1|LAEQAERYDDMAAAMK.3|LAEQAERYD...

SEN / CTL

O75347

Tubulin-specific chaperone A

TBCA

1.9

1.33

0.0000482

0.0000238

protein folding,tubulin complex assembly,post-chap...

poly(A) RNA binding,beta-tubulin binding,chaperone...

nucleolus,cytoplasm,microtubule,microtubule cytosk...

12

14

23

ILENEKDLEEAEEYKEAR.4|ILENEKDLEEAEEYKEAR.3|RLEAAYLD...

SEN / CTL

P14174

Macrophage migration inhibitory factor

MIF

1.89

0.6

1.56e-11

2.08e-11

prostaglandin biosynthetic process,negative regula...

dopachrome isomerase activity,receptor binding,cyt...

extracellular region,extracellular space,nucleopla...

21

10

22

LLC[CAM]GLLAER.2|ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPD...

SEN / CTL

P14314

Glucosidase 2 subunit beta

PRKCSH

1.89

0.54

7.82e-7

4.79e-7

protein folding,N-glycan processing,intracellular ...

protein kinase C binding,calcium ion binding,ion c...

intracellular,endoplasmic reticulum,endoplasmic re...

9

34

64

SLEDQVEMLR.2|SLEDQVEM[Oxi]LR.2|ESLQQMAEVTR.2|ESLQQ...

SEN / CTL

Q02809

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1

PLOD1

1.88

1.03

3.06e-32

2.91e-31

response to hypoxia,cellular protein modification ...

iron ion binding,procollagen-lysine 5-dioxygenase ...

endoplasmic reticulum membrane,rough endoplasmic r...

99

37

56

SEDYVDIVQGR.2|FWTFETGC[CAM]TVC[CAM]DEGLR.2|FLLEYIA...

SEN / CTL

P24592

Insulin-like growth factor-binding protein 6

IGFBP6

1.88

0.34

1.05e-7

7.37e-8

regulation of cell growth,signal transduction,nega...

receptor binding,insulin-like growth factor I bind...

extracellular region,extracellular space,Golgi app...

9

4

4

HLDSVLQQLQTEVYR.3|EGQEC[CAM]GVYTPNC[CAM]APGLQC[CAM...

SEN / CTL

P31949

Protein S100-A11

S100A11

1.88

1.18

0.000301

0.000124

signal transduction,negative regulation of DNA rep...

calcium ion binding,protein homodimerization activ...

ruffle,extracellular space,nucleus,cytoplasm,cell-...

12

8

13

TEFLSFMNTELAAFTK.2|TEFLSFMNTELAAFTK.3|TEFLSFM[Oxi]...

SEN / CTL

Q969H8

Myeloid-derived growth factor

MYDGF

1.88

2.3

0.179

0.0375

angiogenesis,positive regulation of protein phosph...

protein binding

extracellular space,endoplasmic reticulum lumen,en...

3

8

13

SYLYFTQFK.2|PGGVVHSFSHNVGPGDK.4|PGGVVHSFSHNVGPGDK....

SEN / CTL

Q9UBX5

Fibulin-5

FBLN5

1.87

0.92

2.25e-7

1.48e-7

regulation of cell growth,cell-matrix adhesion,ext...

integrin binding,calcium ion binding,protein bindi...

extracellular region,proteinaceous extracellular m...

15

9

10

YPGAYYIFQIK.2|SVPADIFQMQATTR.2|DQPFTILYR.2|IYVSQYP...

SEN / CTL

P26447

Protein S100-A4

S100A4

1.87

1.06

0.00638

0.00185

epithelial to mesenchymal transition,positive regu...

actin binding,calcium ion binding,protein binding,...

extracellular space,nucleus,neuron projection,peri...

6

6

10

ALDVMVSTFHK.3|ALDVMVSTFHK.2|ALDVM[Oxi]VSTFHK.3|ALD...

SEN / CTL

Q08431

Lactadherin

MFGE8

1.86

1.3

1.53e-8

1.29e-8

angiogenesis,phagocytosis, recognition,phagocytosi...

phosphatidylserine binding,integrin binding,phosph...

extracellular region,extracellular space,external ...

27

15

19

VTFLGLQHWVPELAR.3|VTFLGLQHWVPELAR.2|TWGLHLFSWNPSYA...

SEN / CTL

P34096

Ribonuclease 4

RNASE4

1.86

0.24

0.00534

0.00159

mRNA cleavage,RNA phosphodiester bond hydrolysis, ...

nucleic acid binding,endonuclease activity,ribonuc...

extracellular region,extracellular exosome

3

5

6

RVVIAC[CAM]EGNPQVPVHFDG.3|RFNTFIHEDIWNIR.4|RFNTFIH...

SEN / CTL

P35579

Myosin-9

MYH9

1.85

1.2

1.89e-50

2.87e-49

meiotic spindle organization,cytokinesis,angiogene...

microfilament motor activity,motor activity,actin ...

stress fiber,ruffle,uropod,nucleus,cytoplasm,spind...

186

243

483

ALELDSNLYR.2|TRLQQELDDLLVDLDHQR.4|TRLQQELDDLLVDLDH...

SEN / CTL

P07910

Heterogeneous nuclear ribonucleoproteins C1/C2

HNRNPC

1.84

1.24

0.00319

0.000993

mRNA splicing, via spliceosome,osteoblast differen...

nucleotide binding,RNA polymerase II core promoter...

nuclear chromatin,nucleus,nucleoplasm,spliceosomal...

6

30

47

GFAFVQYVNER.2|GFAFVQYVNER.3|VFIGNLNTLVVK.2|VFIGNLN...

SEN / CTL

P16949

Stathmin

STMN1

1.84

1.45

0.112

0.0242

mitotic cytokinesis,microtubule depolymerization,m...

signal transducer activity,tubulin binding

intracellular,cytoplasm,cytosol,microtubule,membra...

3

18

24

ASGQAFELILSPR.2|ASGQAFELILSPR.3|DLSLEEIQKK.3|DLSLE...

SEN / CTL

Q99439

Calponin-2

CNN2

1.83

0.52

1.03e-9

9.91e-10

cytoskeleton organization,actomyosin structure org...

actin binding,calmodulin binding,cadherin binding ...

stress fiber,cytoskeleton,cell-cell junction,cell-...

15

17

33

TWIEGLTGLSIGPDFQK.2|TWIEGLTGLSIGPDFQK.3|GLKDGTILC[...

SEN / CTL

Q9Y2B0

Protein canopy homolog 2

CNPY2

1.82

0.62

0.00013

0.000059

enzyme linked receptor protein signaling pathway,t...

protein binding

endoplasmic reticulum,integral component of plasma...

6

15

27

SEAHLTELLEEIC[CAM]DR.3|SEAHLTELLEEIC[CAM]DR.2|INPD...

SEN / CTL

P15291

Beta-1,4-galactosyltransferase 1

B4GALT1

1.82

1.06

0.00026

0.00011

epithelial cell development,acute inflammatory res...

beta-N-acetylglucosaminylglycopeptide beta-1,4-gal...

Golgi trans cisterna,Golgi membrane,extracellular ...

9

7

9

QQLDYGIYVINQAGDTIFNR.3|VAIIIPFR.2|ETMLSDGLNSLTYQVL...

SEN / CTL

P28066

Proteasome subunit alpha type-5

PSMA5

1.82

0.42

0.0178

0.00465

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

3

17

34

LFQVEYAIEAIK.2|LFQVEYAIEAIK.3|PFGVALLFGGVDEK.3|PFG...

SEN / CTL

Q8IUX7

Adipocyte enhancer-binding protein 1

AEBP1

1.8

1.03

1.34e-8

1.15e-8

negative regulation of transcription from RNA poly...

RNA polymerase II regulatory region sequence-speci...

extracellular space,nucleus,cytoplasm,extracellula...

18

9

11

YLSPDATVSTEVR.2|YTAGIHGNEVLGR.3|YTAGIHGNEVLGR.2|NP...

SEN / CTL

Q08380

Galectin-3-binding protein

LGALS3BP

1.79

0.85

2.39e-17

5.86e-17

platelet degranulation,receptor-mediated endocytos...

scavenger receptor activity

extracellular region,proteinaceous extracellular m...

42

23

30

SDLAVPSELALLK.2|IYTSPTWSAFVTDSSWSAR.3|IYTSPTWSAFVT...

SEN / CTL

P30101

Protein disulfide-isomerase A3

PDIA3

1.79

1.19

6.1e-12

8.75e-12

antigen processing and presentation of peptide ant...

protein disulfide isomerase activity,cysteine-type...

nucleus,endoplasmic reticulum,endoplasmic reticulu...

33

62

120

ELSDFISYLQR.2|ELSDFISYLQR.3|FISDKDASIVGFFDDSFSEAHS...

SEN / CTL

O15145

Actin-related protein 2/3 complex subunit 3

ARPC3

1.79

0.14

0.00192

0.000632

movement of cell or subcellular component,Arp2/3 c...

structural constituent of cytoskeleton,protein bin...

cytosol,Arp2/3 protein complex,focal adhesion,acti...

3

16

27

LIGNMALLPIR.2|LIGNMALLPIR.3|LIGNM[Oxi]ALLPIR.2|NYE...

SEN / CTL

P11021

78 kDa glucose-regulated protein

HSPA5

1.78

1.21

2.13e-18

5.79e-18

ER overload response,activation of signaling prote...

glycoprotein binding,calcium ion binding,protein b...

nucleus,mitochondrion,endoplasmic reticulum,endopl...

54

68

133

IINEPTAAAIAYGLDKR.3|IINEPTAAAIAYGLDKR.2|TKPYIQVDIG...

SEN / CTL

P06748

Nucleophosmin

NPM1

1.77

0.78

1.12e-7

7.79e-8

DNA repair,nucleosome assembly,intracellular prote...

DNA binding,transcription coactivator activity,RNA...

nucleus,nucleoplasm,nucleolus,cytoplasm,centrosome...

15

26

61

MSVQPTVSLGGFEITPPVVLR.3|MSVQPTVSLGGFEITPPVVLR.2|M[...

SEN / CTL

Q14393

Growth arrest-specific protein 6

GAS6

1.75

0.76

1.86e-8

1.56e-8

neuron migration,positive regulation of protein ph...

phosphatidylserine binding,receptor binding,voltag...

extracellular region,extracellular space,cytoplasm...

15

11

13

SPVLTFAGGLPDVPVTSAPVTAFYR.3|TC[CAM]QDIDEC[CAM]ADSE...

SEN / CTL

P46940

Ras GTPase-activating-like protein IQGAP1

IQGAP1

1.75

0.96

0.000161

0.0000717

regulation of cytokine production,signal transduct...

GTPase inhibitor activity,GTPase activator activit...

ruffle,nucleus,cytoplasm,cytosol,microtubule,actin...

9

128

200

EQLWLANEGLITR.2|EQLWLANEGLITR.3|NKYQELINDIAR.3|NKY...

SEN / CTL

P61916

Epididymal secretory protein E1

NPC2

1.75

1.04

0.000554

0.000214

cholesterol metabolic process,response to virus,ph...

protein binding,cholesterol binding,enzyme binding

lysosome,endoplasmic reticulum,extracellular exoso...

9

12

19

DC[CAM]GSVDGVIKEVNVSPC[CAM]PTQPC[CAM]QLSK.3|AVVHGI...

SEN / CTL

Q15262

Receptor-type tyrosine-protein phosphatase kappa

PTPRK

1.73

0.07

2.84e-8

2.26e-8

protein dephosphorylation,cell adhesion,signal tra...

protein tyrosine phosphatase activity,transmembran...

photoreceptor outer segment,integral component of ...

6

12

13

VLLTRPGEGGTGLPGPPLITR.3|GLNPGTLNILVR.2|YENHSATAESS...

SEN / CTL

P60842

Eukaryotic initiation factor 4A-I

EIF4A1

1.73

1.26

0.0000108

0.00000562

nuclear-transcribed mRNA poly(A) tail shortening,t...

RNA cap binding,double-stranded RNA binding,mRNA b...

cytoplasm,cytosol,membrane,eukaryotic translation ...

15

39

86

VLITTDLLAR.2|AEVQKLQMEAPHIIVGTPGR.4|LQMEAPHIIVGTPG...

SEN / CTL

P07602

Prosaposin

PSAP

1.73

2.11

0.0000124

0.00000639

platelet degranulation,glycosphingolipid metabolic...

G-protein coupled receptor binding,protein binding...

extracellular region,extracellular space,cytoplasm...

21

30

59

EIVDSYLPVILDIIK.2|EIVDSYLPVILDIIK.3|GEMSRPGEVC[CAM...

SEN / CTL

P55083

Microfibril-associated glycoprotein 4

MFAP4

1.72

0.86

0.00026

0.00011

cell adhesion,UV protection,regulation of collagen...

molecular_function,protein binding

microfibril,extracellular region,extracellular mat...

9

4

9

ADGEYWLGLQNMHLLTLK.3|ADGEYWLGLQNMHLLTLK.2|ADGEYWLG...

SEN / CTL

P21333

Filamin-A

FLNA

1.7

1.02

8.42e-77

2.13e-75

platelet degranulation,adenylate cyclase-inhibitin...

G-protein coupled receptor binding,glycoprotein bi...

extracellular region,nucleus,nucleolus,cytoplasm,c...

234

207

388

LYSVSYLLK.2|YGGDEIPFSPYR.2|AEAGVPAEFSIWTR.2|AEAGVP...

SEN / CTL

P40926

Malate dehydrogenase, mitochondrial

MDH2

1.69

1.83

3.18e-8

2.47e-8

gluconeogenesis,tricarboxylic acid cycle,oxaloacet...

L-malate dehydrogenase activity,protein self-assoc...

nucleus,nucleoplasm,mitochondrion,mitochondrial in...

27

31

62

ANTFVAELK.2|IFGVTTLDIVR.2|IFGVTTLDIVR.3|GYLGPEQLPD...

SEN / CTL

Q12931

Heat shock protein 75 kDa, mitochondrial

TRAP1

1.69

0.1

0.00121

0.000424

response to stress,translational attenuation,chape...

tumor necrosis factor receptor binding,protein bin...

nucleoplasm,mitochondrion,mitochondrial inner memb...

3

53

85

GVVDSEDIPLNLSR.2|GVVDSEDIPLNLSR.3|LNELLVK.2|HLAEHS...

SEN / CTL

P22626

Heterogeneous nuclear ribonucleoproteins A2/B1

HNRNPA2B1

1.69

0.94

0.00287

0.000902

negative regulation of transcription from RNA poly...

nucleotide binding,RNA binding,mRNA 3'-UTR binding...

nucleus,nucleoplasm,spliceosomal complex,cytoplasm...

6

47

96

GFGFVTFDDHDPVDKIVLQK.4|GFGFVTFDDHDPVDKIVLQK.3|GFGF...

SEN / CTL

P49747

Cartilage oligomeric matrix protein

COMP

1.69

0.17

0.00337

0.00105

skeletal system development,growth plate cartilage...

protease binding,extracellular matrix structural c...

extracellular region,proteinaceous extracellular m...

3

10

11

C[CAM]EAC[CAM]PPGYSGPTHQGVGLAFAK.3|AVAEPGIQLK.2|FC...

SEN / CTL

Q9BTY2

Plasma alpha-L-fucosidase

FUCA2

1.69

1.79

0.00653

0.00189

fucose metabolic process,response to bacterium,gly...

alpha-L-fucosidase activity

extracellular space,extracellular exosome

9

12

14

FDPTWESLDAR.2|LVYAIFLK.2|FFNANQWADIFQASGAK.3|FFNAN...

SEN / CTL

P21810

Biglycan

BGN

1.68

1.59

1.26e-15

2.52e-15

blood vessel remodeling,negative regulation of pro...

protein kinase inhibitor activity,extracellular ma...

extracellular region,proteinaceous extracellular m...

69

23

37

IQAIELEDLLR.2|DLPETLNELHLDHNKIQAIELEDLLR.5|DLPETLN...

SEN / CTL

P06865

Beta-hexosaminidase subunit alpha

HEXA

1.68

1.26

4.71e-11

5.97e-11

carbohydrate metabolic process,glycosaminoglycan b...

beta-N-acetylhexosaminidase activity,acetylglucosa...

membrane,azurophil granule,lysosomal lumen,extrace...

30

21

32

ALLSAPWYLNR.2|GLETFSQLVWK.2|YRDLLFGSGSWPRPYLTGK.4|...

SEN / CTL

P53634

Dipeptidyl peptidase 1

CTSC

1.68

0.49

0.000215

0.0000929

T cell mediated cytotoxicity,proteolysis,ER to Gol...

cysteine-type endopeptidase activity,serine-type e...

Golgi membrane,extracellular space,lysosome,endopl...

6

16

31

ILHLPTSWDWR.3|ILHLPTSWDWR.2|NSWGTGWGENGYFR.2|VVVYL...

SEN / CTL

Q9NZP8

Complement C1r subcomponent-like protein

C1RL

1.68

2.79

0.233

0.0474

proteolysis,complement activation, classical pathw...

serine-type endopeptidase activity

extracellular space,extracellular exosome

3

9

11

WILTAAHTIYPK.3|WILTAAHTIYPK.2|VVVHPDYR.2|EAC[CAM]N...

SEN / CTL

P35556

Fibrillin-2

FBN2

1.66

1.12

0.00655

0.00189

extracellular matrix disassembly,extracellular mat...

extracellular matrix structural constituent,calciu...

microfibril,extracellular region,extracellular mat...

6

5

5

C[CAM]WGIGTIPEAC[CAM]PVR.2|LSSTGLIC[CAM]IDSLK.2|RP...

SEN / CTL

P08238

Heat shock protein HSP 90-beta

HSP90AB1

1.65

1.13

1.05e-9

9.97e-10

placenta development,protein folding,response to u...

glycoprotein binding,UTP binding,CTP binding,doubl...

nucleoplasm,cytoplasm,mitochondrion,lysosomal memb...

33

84

175

ELISNASDALDKIR.3|ELISNASDALDKIR.2|GVVDSEDLPLNISR.2...

SEN / CTL

P08865

40S ribosomal protein SA

RPSA

1.65

0.17

0.00409

0.00125

ribosomal small subunit assembly,nuclear-transcrib...

virus receptor activity,structural constituent of ...

nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr...

3

21

46

AIVAIENPADVSVISSR.2|AIVAIENPADVSVISSR.3|FAAATGATPI...

SEN / CTL

Q99536

Synaptic vesicle membrane protein VAT-1 homolog

VAT1

1.65

0.89

0.00426

0.0013

negative regulation of mitochondrial fusion,oxidat...

zinc ion binding,oxidoreductase activity

mitochondrial outer membrane,integral component of...

6

28

53

AC[CAM]GLNFADLMAR.2|AC[CAM]GLNFADLM[Oxi]AR.2|GVDIV...

SEN / CTL

P48740

Mannan-binding lectin serine protease 1

MASP1

1.64

1.17

0.0000436

0.0000217

complement activation, lectin pathway,proteolysis,...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,extracellular space

15

18

21

TGVITSPDFPNPYPK.2|APGELEHGLITFSTR.3|APGELEHGLITFST...

SEN / CTL

P13693

Translationally-controlled tumor protein

TPT1

1.64

0.55

0.000454

0.000179

calcium ion transport,cellular calcium ion homeost...

calcium ion binding,protein binding,microtubule bi...

extracellular space,nucleus,cytoplasm,multivesicul...

6

14

26

DLISHDEMFSDIYK.3|DLISHDEM[Oxi]FSDIYK.3|DLISHDEM[Ox...

SEN / CTL

O14950

P19105

Myosin regulatory light chain 12B;Myosin regulatory light chain 12A

MYL12B

MYL12A

1.63

0.44

0.000193

0.0000836

muscle contraction,regulation of cell shape;muscle...

calcium ion binding,myosin heavy chain binding;cal...

stress fiber,cytosol,brush border,myosin II comple...

6

18

38

GNFNYIEFTR.2|ELLTTMGDRFTDEEVDELYR.3|ELLTTM[Oxi]GDR...

SEN / CTL

Q92743

Serine protease HTRA1

HTRA1

1.63

0.62

0.00104

0.000371

regulation of cell growth,placenta development,pro...

serine-type endopeptidase activity,insulin-like gr...

extracellular region,extracellular space,cytosol,p...

6

2

2

IAPAVVHIELFR.3|SSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQR.3

SEN / CTL

Q9BS26

Endoplasmic reticulum resident protein 44

ERP44

1.63

1.82

0.00464

0.0014

protein folding,response to unfolded protein,glyco...

protein disulfide isomerase activity

endoplasmic reticulum lumen,endoplasmic reticulum ...

9

22

40

TPADC[CAM]PVIAIDSFR.2|TPADC[CAM]PVIAIDSFR.3|VANILH...

SEN / CTL

O75369

Filamin-B

FLNB

1.62

1.07

8.26e-11

9.51e-11

keratinocyte development,epithelial cell morphogen...

actin binding,protein binding,poly(A) RNA binding,...

stress fiber,cytoplasm,cytosol,plasma membrane,bru...

27

208

346

VLFASQEIPASPFR.2|VLFASQEIPASPFR.3|SPFTVGVAAPLDLSK....

SEN / CTL

P06744

Glucose-6-phosphate isomerase

GPI

1.62

2

0.0017

0.000565

angiogenesis,in utero embryonic development,mesode...

glucose-6-phosphate isomerase activity,cytokine ac...

extracellular space,nucleoplasm,cytoplasm,cytosol,...

12

49

107

ILLANFLAQTEALMR.2|ILLANFLAQTEALMR.3|ILLANFLAQTEALM...

SEN / CTL

P06733

Alpha-enolase

ENO1

1.61

1.13

2.03e-18

5.73e-18

gluconeogenesis,transcription, DNA-templated,respo...

magnesium ion binding,DNA binding,phosphopyruvate ...

phosphopyruvate hydratase complex,extracellular sp...

66

54

117

SFIKDYPVVSIEDPFDQDDWGAWQK.3|SFIKDYPVVSIEDPFDQDDWGA...

SEN / CTL

Q9UBG0

C-type mannose receptor 2

MRC2

1.6

0.87

0.000335

0.000136

osteoblast differentiation,endocytosis,signal tran...

transmembrane signaling receptor activity,protein ...

integral component of plasma membrane,focal adhesi...

9

30

39

TLGDQLSLLLGAR.2|DC[CAM]SIALPYVC[CAM]K.2|WSDGVGFSYH...

SEN / CTL

O75368

SH3 domain-binding glutamic acid-rich-like protein

SH3BGRL

1.6

1.28

0.000758

0.000284

positive regulation of signal transduction

SH3/SH2 adaptor activity,SH3 domain binding

extracellular space,nucleus,cytoplasm,extracellula...

9

12

17

VYIASSSGSTAIK.2|ENNAVYAFLGLTAPPGSK.3|ENNAVYAFLGLTA...

SEN / CTL

P24593

Insulin-like growth factor-binding protein 5

IGFBP5

1.6

1.46

0.0304

0.00755

regulation of cell growth,osteoblast differentiati...

fibronectin binding,protein binding,insulin-like g...

extracellular region,intracellular,insulin-like gr...

6

3

3

ALSMC[CAM]PPSPLGC[CAM]ELVK.2|HMEASLQELK.2|FVGGAENT...

SEN / CTL

Q9UJJ9

N-acetylglucosamine-1-phosphotransferase subunit gamma

GNPTG

1.59

0.59

0.000536

0.000208

N-glycan processing to lysosome,carbohydrate phosp...

UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylg...

Golgi membrane,Golgi apparatus,extracellular exoso...

6

6

9

LAHVSEPSTC[CAM]VYALTFETPLVC[CAM]HPHALLVYPTLPEALQR....

SEN / CTL

Q15121

Astrocytic phosphoprotein PEA-15

PEA15

1.59

0.81

0.0776

0.0173

DNA damage checkpoint,MAPK cascade,activation of M...

protein binding

cytosol,microtubule associated complex

3

11

16

RPDLLTMVVDYR.3|RPDLLTMVVDYR.2|SAC[CAM]KEDIPSEK.3|S...

SEN / CTL

P04216

Thy-1 membrane glycoprotein

THY1

1.59

1.96

0.189

0.0393

angiogenesis,negative regulation of protein kinase...

GTPase activator activity,integrin binding,protein...

endoplasmic reticulum,cytosol,plasma membrane,inte...

3

4

7

KHVLFGTVGVPEHTYR.4|HVLFGTVGVPEHTYR.4|HVLFGTVGVPEHT...

SEN / CTL

P62937

Peptidyl-prolyl cis-trans isomerase A

PPIA

1.58

0.65

7.25e-19

2.4e-18

protein peptidyl-prolyl isomerization,RNA-dependen...

peptidyl-prolyl cis-trans isomerase activity,prote...

extracellular region,extracellular space,nucleus,c...

42

24

52

VSFELFADKVPK.3|VSFELFADKVPK.2|VNPTVFFDIAVDGEPLGR.3...

SEN / CTL

P60174

Triosephosphate isomerase

TPI1

1.58

1.46

1.1e-18

3.35e-18

gluconeogenesis,glycolytic process,pentose-phospha...

triose-phosphate isomerase activity,ubiquitin prot...

extracellular space,nucleus,cytosol,extracellular ...

78

37

70

VVLAYEPVWAIGTGK.2|VVLAYEPVWAIGTGK.3|KQSLGELIGTLNAA...

SEN / CTL

Q13308

Inactive tyrosine-protein kinase 7

PTK7

1.58

1.3

1.35e-7

9.27e-8

establishment of planar polarity,ventricular septu...

protein kinase activity,protein binding,ATP bindin...

integral component of plasma membrane,cell-cell ju...

21

30

35

ADGSSLPEWVTDNAGTLHFAR.3|VVLAPQDVVVAR.2|WIEAGPVVLKH...

SEN / CTL

P60660

Myosin light polypeptide 6

MYL6

1.58

0.72

1.63e-7

1.09e-7

muscle contraction,skeletal muscle tissue developm...

motor activity,calcium ion binding,structural cons...

cytosol,brush border,membrane,myosin complex,uncon...

15

13

27

NKDQGTYEDYVEGLR.3|NKDQGTYEDYVEGLR.2|NKDQGTYEDYVEGL...

SEN / CTL

P50990

T-complex protein 1 subunit theta

CCT8

1.58

1.11

0.000779

0.00029

protein folding,binding of sperm to zona pellucida...

protein binding,ATP binding,ATPase activity, coupl...

zona pellucida receptor complex,nucleoplasm,cytopl...

9

59

110

LFVTNDAATILR.2|LFVTNDAATILR.3|NLRDIDEVSSLLR.3|NLRD...

SEN / CTL

P05067

Amyloid beta A4 protein

APP

1.57

0.96

1.72e-7

1.14e-7

response to yeast,suckling behavior,platelet degra...

DNA binding,serine-type endopeptidase inhibitor ac...

extracellular region,extracellular space,nuclear e...

18

21

26

WYFDVTEGK.2|ISYGNDALMPSLTETK.2|AVIQHFQEKVESLEQEAAN...

SEN / CTL

P07942

Laminin subunit beta-1

LAMB1

1.55

1.35

3.47e-22

1.65e-21

cell adhesion,neuronal-glial interaction involved ...

structural molecule activity,extracellular matrix ...

extracellular region,basement membrane,laminin-1 c...

93

76

100

ISGVIGPYRETVDSVER.3|IPSWTGAGFVR.2|SC[CAM]YQDPVTLQL...

SEN / CTL

P07355

Annexin A2

ANXA2

1.55

1.06

2.43e-18

6.38e-18

angiogenesis,membrane raft assembly,positive regul...

protease binding,calcium ion binding,protein bindi...

ruffle,basement membrane,extracellular space,nucle...

66

49

99

GLGTDEDSLIEIIC[CAM]SR.2|GLGTDEDSLIEIIC[CAM]SR.3|GV...

SEN / CTL

P18669

Phosphoglycerate mutase 1

PGAM1

1.55

0.68

1.33e-13

2.3e-13

gluconeogenesis,glycolytic process,regulation of g...

bisphosphoglycerate mutase activity,phosphoglycera...

cytoplasm,cytosol,membrane,extracellular exosome

30

38

83

ALPFWNEEIVPQIK.2|ALPFWNEEIVPQIK.3|YADLTEDQLPSC[CAM...

SEN / CTL

P0CG47

P0CG48

P62979

P62987

Polyubiquitin-B;Polyubiquitin-C;Ubiquitin-40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40

UBB

UBC

RPS27A

UBA52

1.55

1.04

0.00304

0.000951

G2/M transition of mitotic cell cycle,negative reg...

protein binding;protease binding,protein binding,p...

extracellular space,nucleus,nucleoplasm,mitochondr...

6

1

2

TITLEVEPSDTIENVK.2|TITLEVEPSDTIENVK.3

SEN / CTL

P54802

Alpha-N-acetylglucosaminidase

NAGLU

1.54

1.24

0.00000848

0.00000457

glycosaminoglycan catabolic process,lysosome organ...

alpha-N-acetylglucosaminidase activity

lysosome,lysosomal lumen,extracellular exosome

15

21

31

FLLGSWLEQAR.2|YDLLDLTR.2|AGGVLAYELLPALDEVLASDSR.3|...

SEN / CTL

P40925

Malate dehydrogenase, cytoplasmic

MDH1

1.54

0.48

0.000418

0.000165

gluconeogenesis,tricarboxylic acid cycle,oxaloacet...

malic enzyme activity,L-malate dehydrogenase activ...

extracellular space,cytoplasm,mitochondrion,centro...

6

23

39

FVEGLPINDFSR.2|NVIIWGNHSSTQYPDVNHAK.4|NVIIWGNHSSTQ...

SEN / CTL

P62942

Peptidyl-prolyl cis-trans isomerase FKBP1A

FKBP1A

1.54

0.59

0.00098

0.000356

protein peptidyl-prolyl isomerization,heart morpho...

peptidyl-prolyl cis-trans isomerase activity,signa...

cytoplasm,endoplasmic reticulum membrane,cytosol,t...

6

8

23

GWEEGVAQMSVGQR.2|GWEEGVAQMSVGQR.3|GWEEGVAQM[Oxi]SV...

SEN / CTL

P26641

Elongation factor 1-gamma

EEF1G

1.53

0.41

0.0236

0.00595

translational elongation,glutathione metabolic pro...

translation elongation factor activity,glutathione...

nucleus,cytoplasm,cytosol,cell-cell adherens junct...

3

36

59

ALIAAQYSGAQVR.2|ALIAAQYSGAQVR.3|FAETQPK.2|STFVLDEF...

SEN / CTL

P30041

Peroxiredoxin-6

PRDX6

1.52

1.3

1.74e-12

2.59e-12

response to reactive oxygen species,lipid cataboli...

glutathione peroxidase activity,protein binding,hy...

extracellular space,cytoplasm,lysosome,cytosol,cel...

45

31

62

FHDFLGDSWGILFSHPR.4|FHDFLGDSWGILFSHPR.3|FHDFLGDSWG...

SEN / CTL

O14786

Neuropilin-1

NRP1

1.52

0.8

6.85e-8

5e-8

angiogenesis,patterning of blood vessels,neuron mi...

vascular endothelial growth factor-activated recep...

semaphorin receptor complex,extracellular space,ea...

18

12

14

EGNKPVLFQGNTNPTDVVVAVFPKPLITR.4|FVTAVGTQGAISK.2|YD...

SEN / CTL

P05387

60S acidic ribosomal protein P2

RPLP2

1.52

1.47

0.0000838

0.0000388

nuclear-transcribed mRNA catabolic process, nonsen...

structural constituent of ribosome,large ribosomal...

cytosol,focal adhesion,membrane,cytosolic large ri...

15

13

30

NIEDVIAQGIGK.2|NIEDVIAQGIGK.3|YVASYLLAALGGNSSPSAK....

SEN / CTL

P09211

Glutathione S-transferase P

GSTP1

1.51

0.57

2.29e-11

3e-11

response to reactive oxygen species,negative regul...

glutathione transferase activity,glutathione perox...

extracellular space,intracellular,nucleus,cytoplas...

21

20

44

PPYTVVYFPVR.2|PPYTVVYFPVR.3|FQDGDLTLYQSNTILR.2|FQD...

SEN / CTL

P14618

Pyruvate kinase PKM

PKM

1.5

1.17

7.05e-25

5.36e-24

programmed cell death,canonical glycolysis,cell-ce...

magnesium ion binding,pyruvate kinase activity,pro...

nucleus,cytoplasm,mitochondrion,cytosol,plasma mem...

102

71

161

GDLGIEIPAEK.2|IYVDDGLISLQVK.2|IYVDDGLISLQVK.3|KGVN...

SEN / CTL

Q9UBR2

Cathepsin Z

CTSZ

1.5

1.25

0.000367

0.000148

angiotensin maturation,proteolysis,ER to Golgi ves...

cysteine-type endopeptidase activity,protein bindi...

Golgi membrane,extracellular space,lysosome,endopl...

12

16

25

STYPRPHEYLSPADLPK.4|STYPRPHEYLSPADLPK.3|VGDYGSLSGR...

SEN / CTL

Q16881

Thioredoxin reductase 1, cytoplasmic

TXNRD1

1.5

1.03

0.000904

0.000334

response to reactive oxygen species,mesoderm forma...

thioredoxin-disulfide reductase activity,electron ...

nucleus,mitochondrion,cytosol,extracellular exosom...

9

36

59

QFVPIKVEQIEAGTPGR.3|VVGFHVLGPNAGEVTQGFAAALK.3|VVGF...

SEN / CTL

P39060

Collagen alpha-1(XVIII) chain

COL18A1

1.49

0.69

0.00000403

0.00000227

angiogenesis,endothelial cell morphogenesis,cell a...

structural molecule activity,metal ion binding

extracellular region,collagen trimer,basement memb...

12

31

46

IFSFDGKDVLR.3|AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR.4|...

SEN / CTL

P07737

Profilin-1

PFN1

1.48

1.25

1.05e-11

1.48e-11

neural tube closure,positive regulation of epithel...

adenyl-nucleotide exchange factor activity,actin b...

nucleus,cytoplasm,cytosol,cytoskeleton,cell-cell a...

36

19

37

TFVNITPAEVGVLVGKDR.3|TFVNITPAEVGVLVGKDR.2|STGGAPTF...

SEN / CTL

Q16555

Dihydropyrimidinase-related protein 2

DPYSL2

1.48

1.7

0.000621

0.000237

response to amphetamine,nucleobase-containing comp...

dihydropyrimidinase activity,protein binding,micro...

mitochondrion,cytosol,dendrite,growth cone,neurona...

12

35

74

AITIANQTNC[CAM]PLYITK.2|AITIANQTNC[CAM]PLYITK.3|GS...

SEN / CTL

P58546

Myotrophin

MTPN

1.47

1.04

0.0000354

0.0000177

regulation of translation,catecholamine metabolic ...

sequence-specific DNA binding

nucleus,cytosol,F-actin capping protein complex,ax...

12

13

27

TLEGGRKPLHYAADC[CAM]GQLEILEFLLLK.5|TLEGGRKPLHYAADC...

SEN / CTL

P11142

Heat shock cognate 71 kDa protein

HSPA8

1.46

1.17

3.38e-8

2.59e-8

mRNA splicing, via spliceosome,transcription, DNA-...

G-protein coupled receptor binding,phosphatidylser...

Prp19 complex,extracellular space,intracellular,nu...

45

50

118

ARFEELNADLFR.3|ARFEELNADLFR.2|DAGTIAGLNVLR.2|DAGTI...

SEN / CTL

O60888

Protein CutA

CUTA

1.46

0.88

4.12e-8

3.13e-8

protein localization,response to metal ion

copper ion binding,enzyme binding

membrane,extracellular exosome

18

7

14

TQSSLVPALTDFVR.2|TQSSLVPALTDFVR.3|SVHPYEVAEVIALPVE...

SEN / CTL

P07686

Beta-hexosaminidase subunit beta

HEXB

1.46

1.87

0.000109

0.00005

skeletal system development,glycosphingolipid meta...

beta-N-acetylhexosaminidase activity,acetylglucosa...

acrosomal vesicle,extracellular space,membrane,azu...

21

27

38

VLDIIATINK.2|EISEVFPDQFIHLGGDEVEFK.3|LAPGTIVEVWKDS...

SEN / CTL

Q96TA1

Niban-like protein 1

FAM129B

1.46

0.53

0.000702

0.000264

negative regulation of apoptotic process,cell-cell...

cadherin binding involved in cell-cell adhesion

nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pl...

6

38

58

FQELIFEDFAR.2|ILTSVDQYLELIGNSLPGTTAK.3|ILTSVDQYLEL...

SEN / CTL

P11413

Glucose-6-phosphate 1-dehydrogenase

G6PD

1.46

0.16

0.00496

0.00149

glucose metabolic process,pentose-phosphate shunt,...

glucose-6-phosphate dehydrogenase activity,glucose...

nucleus,cytoplasm,centrosome,microtubule organizin...

3

50

86

LFYLALPPTVYEAVTK.2|LFYLALPPTVYEAVTK.3|NVKLPDAYER.3...

SEN / CTL

Q96CN7

Isochorismatase domain-containing protein 1

ISOC1

1.46

1.1

0.11

0.0239

biological_process,metabolic process

molecular_function,catalytic activity

cytoplasm,peroxisome,extracellular exosome

3

16

25

FSM[Oxi]VLPEVEAALAEIPGVR.3|FSMVLPEVEAALAEIPGVR.3|F...

SEN / CTL

O14818

Q8TAA3

Proteasome subunit alpha type-7;Proteasome subunit alpha type-7-like

PSMA7

PSMA8

1.46

1.34

0.156

0.0329

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytosol,pro...

3

1

2

LTVEDPVTVEYITR.2|LTVEDPVTVEYITR.3

SEN / CTL

Q12805

EGF-containing fibulin-like extracellular matrix protein 1

EFEMP1

1.45

1.25

1.48e-11

2.01e-11

regulation of transcription, DNA-templated,epiderm...

epidermal growth factor-activated receptor activit...

extracellular region,proteinaceous extracellular m...

33

16

18

SVPSDIFQIQATTIYANTINTFR.3|RGEQC[CAM]VDIDEC[CAM]TIP...

SEN / CTL

P0DMV8

P0DMV9

Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B

HSPA1A

HSPA1B

1.45

1.55

0.000309

0.000127

positive regulation of gene expression,regulation ...

virus receptor activity,G-protein coupled receptor...

nucleoplasm,cytoplasm,mitochondrion,centriole,cyto...

21

60

132

ARFEELC[CAM]SDLFR.3|ARFEELC[CAM]SDLFR.2|TTPSYVAFTD...

SEN / CTL

P47756

F-actin-capping protein subunit beta

CAPZB

1.45

0.52

0.00133

0.000462

movement of cell or subcellular component,cytoskel...

actin binding,actin filament binding,cadherin bind...

cytosol,cytoskeleton,actin filament,cell-cell adhe...

6

22

40

SGSGTMNLGGSLTR.2|SGSGTM[Oxi]NLGGSLTR.2|SPWSNKYDPPL...

SEN / CTL

O43707

Alpha-actinin-4

ACTN4

1.44

1.48

2.77e-14

5.02e-14

response to hypoxia,platelet degranulation,protein...

RNA polymerase II regulatory region sequence-speci...

stress fiber,extracellular region,extracellular sp...

108

85

169

VGWEQLLTTIAR.2|VGWEQLLTTIAR.3|ETTDTDTADQVIASFK.2|E...

SEN / CTL

P16035

Metalloproteinase inhibitor 2

TIMP2

1.43

0.92

2.26e-8

1.85e-8

central nervous system development,aging,negative ...

protease binding,integrin binding,metalloendopepti...

extracellular region,proteinaceous extracellular m...

27

8

11

MHITLC[CAM]DFIVPWDTLSTTQKK.4|MHITLC[CAM]DFIVPWDTLS...

SEN / CTL

P13929

Beta-enolase

ENO3

1.43

0.36

0.00000244

0.00000143

gluconeogenesis,aging,response to drug,skeletal mu...

magnesium ion binding,phosphopyruvate hydratase ac...

phosphopyruvate hydratase complex,extracellular sp...

9

16

23

YGKDATNVGDEGGFAPNILENNEALELLK.4|VNQIGSVTESIQAC[CAM...

SEN / CTL

P10253

Lysosomal alpha-glucosidase

GAA

1.43

1.56

0.00148

0.000501

maltose metabolic process,regulation of the force ...

alpha-1,4-glucosidase activity,oligo-1,6-glucosida...

lysosome,lysosomal membrane,membrane,lysosomal lum...

12

34

49

GAYTQVIFLAR.2|WTQLGAFYPFMR.2|WTQLGAFYPFM[Oxi]R.2|A...

SEN / CTL

P27348

14-3-3 protein theta

YWHAQ

1.43

1.72

0.00886

0.00249

protein targeting,small GTPase mediated signal tra...

protein binding,protein C-terminus binding,protein...

cytoplasm,mitochondrion,cytosol,focal adhesion,mem...

9

23

46

SIC[CAM]TTVLELLDKYLIANATNPESK.3|SIC[CAM]TTVLELLDKY...

SEN / CTL

Q06481

Amyloid-like protein 2

APLP2

1.43

0.76

0.0639

0.0145

platelet degranulation,G-protein coupled receptor ...

DNA binding,serine-type endopeptidase inhibitor ac...

nucleus,plasma membrane,membrane,integral componen...

3

16

20

VPYVAQEIQEEIDELLQEQR.3|HYQHVLAVDPEK.3|HYQHVLAVDPEK...

SEN / CTL

P28072

Proteasome subunit beta type-6

PSMB6

1.43

1.25

0.206

0.0426

MAPK cascade,protein polyubiquitination,stimulator...

endopeptidase activity,threonine-type endopeptidas...

proteasome complex,nucleus,nucleoplasm,cytoplasm,G...

3

11

17

LAAIAESGVER.2|DGSSGGVIR.2|VTDKLTPIHDR.3|VTDKLTPIHD...

SEN / CTL

Q09666

Neuroblast differentiation-associated protein AHNAK

AHNAK

1.41

1.42

7.35e-15

1.36e-14

regulation of RNA splicing,protein oligomerization...

protein binding,S100 protein binding,poly(A) RNA b...

nucleus,cytoplasm,lysosomal membrane,cytosol,plasm...

78

433

666

ISMPEVDLNLKGPK.3|ISIPDVDLDLKGPK.3|ISMPDLDLNLKGPK.3...

SEN / CTL

Q6EMK4

Vasorin

VASN

1.41

1.32

0.0000188

0.00000954

negative regulation of epithelial to mesenchymal t...

transforming growth factor beta binding,cadherin b...

extracellular space,mitochondrion,lysosomal membra...

15

8

8

SLTLGIEPVSPTSLR.2|LAGLGLQQLDEGLFSR.2|LLLLDLSHNSLLA...

SEN / CTL

Q12841

Follistatin-related protein 1

FSTL1

1.4

0.89

0.00000415

0.00000232

BMP signaling pathway,response to starvation

calcium ion binding,protein binding,heparin bindin...

extracellular region,extracellular space,extracell...

15

12

12

LSFQEFLK.2|IIQWLEAEIIPDGWFSK.3|IC[CAM]ANVFC[CAM]GA...

SEN / CTL

P00441

Superoxide dismutase [Cu-Zn]

SOD1

1.39

0.62

2.48e-10

2.59e-10

activation of MAPK activity,response to reactive o...

superoxide dismutase activity,copper ion binding,p...

extracellular region,extracellular space,nucleus,n...

21

20

39

GLTEGLHGFHVHEFGDNTAGC[CAM]TSAGPHFNPLSR.5|GLTEGLHGF...

SEN / CTL

P02461

Collagen alpha-1(III) chain

COL3A1

1.39

1.38

6.07e-8

4.53e-8

skeletal system development,cell-matrix adhesion,t...

integrin binding,extracellular matrix structural c...

extracellular region,collagen type III trimer,extr...

30

25

27

SVNGQIESLISPDGSR.2|VFC[CAM]NMETGETC[CAM]ISANPLNVPR...

SEN / CTL

P62258

14-3-3 protein epsilon

YWHAE

1.39

2.21

0.00947

0.00266

G2/M transition of mitotic cell cycle,neuron migra...

protein binding,potassium channel regulator activi...

mitochondrion,cytosol,kinesin complex,cell-cell ad...

18

36

102

LIC[CAM]C[CAM]DILDVLDKHLIPAANTGESK.4|LIC[CAM]C[CAM...

SEN / CTL

Q13442

28 kDa heat- and acid-stable phosphoprotein

PDAP1

1.39

1.55

0.127

0.0271

signal transduction,cell proliferation

poly(A) RNA binding

3

15

23

KVTQLDLDGPK.2|KVTQLDLDGPK.3|KVTQLDLDGPKELSR.4|KVTQ...

SEN / CTL

Q9BYZ2

L-lactate dehydrogenase A-like 6B

LDHAL6B

1.38

0.41

0.000385

0.000154

carbohydrate metabolic process,pyruvate metabolic ...

L-lactate dehydrogenase activity

nucleus,mitochondrial matrix

6

1

2

LIIVSNPVDILTYVAWK.3|LIIVSNPVDILTYVAWK.2

SEN / CTL

P12814

Alpha-actinin-1

ACTN1

1.37

1.42

6.06e-17

1.4e-16

platelet degranulation,actin filament organization...

double-stranded RNA binding,integrin binding,calci...

stress fiber,ruffle,extracellular region,extracell...

81

84

180

DGLGFC[CAM]ALIHR.2|DGLGFC[CAM]ALIHR.3|LLETIDQLYLEY...

SEN / CTL

Q9Y240

C-type lectin domain family 11 member A

CLEC11A

1.37

1.15

0.00000323

0.00000183

positive regulation of cell proliferation

growth factor activity,carbohydrate binding

extracellular region,extracellular space,cytoplasm

24

12

16

DFEAQAAAQAR.2|VVELTQGLR.2|LAGLDAGLHQLHVR.3|LAGLDAG...

SEN / CTL

P52565

Rho GDP-dissociation inhibitor 1

ARHGDIA

1.37

1.05

0.000183

0.0000804

movement of cell or subcellular component,negative...

Rho GDP-dissociation inhibitor activity,GTPase act...

cytosol,cytoskeleton,extracellular exosome

15

15

29

AEEYEFLTPVEEAPK.2|AEEYEFLTPVEEAPK.3|SIQEIQELDKDDES...

SEN / CTL

P08670

Vimentin

VIM

1.36

1.35

3.75e-24

2.59e-23

movement of cell or subcellular component,positive...

glycoprotein binding,double-stranded RNA binding,s...

cytoplasm,peroxisome,cytosol,cytoskeleton,intermed...

138

93

188

ILLAELEQLKGQGK.3|ILLAELEQLKGQGK.2|KVESLQEEIAFLK.3|...

SEN / CTL

Q6YHK3

CD109 antigen

CD109

1.36

1.2

3.47e-9

3.11e-9

negative regulation of protein phosphorylation,hai...

serine-type endopeptidase inhibitor activity,trans...

extracellular space,plasma membrane,cell surface,a...

30

27

34

ISVTQPDSIVGIVAVDK.2|TLTLPSLPLNSADEIYELR.3|TLTLPSLP...

SEN / CTL

Q9P2E9

Ribosome-binding protein 1

RRBP1

1.36

0.71

0.00247

0.000793

osteoblast differentiation,translation,protein tra...

receptor activity,poly(A) RNA binding

endoplasmic reticulum,ribosome,membrane,integral c...

6

99

145

SIEALLEAGQAR.2|SIEALLEAGQAR.3|LREAEETQSTLQAEC[CAM]...

SEN / CTL

O00410

Importin-5

IPO5

1.36

0.92

0.00587

0.00173

protein import into nucleus, docking,protein impor...

GTPase inhibitor activity,protein binding,nuclear ...

nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla...

6

60

117

AIGTEPDSDVLSEIMHSFAK.3|AIGTEPDSDVLSEIMHSFAK.2|ITFL...

SEN / CTL

Q9UHB6

LIM domain and actin-binding protein 1

LIMA1

1.36

0.89

0.0951

0.0209

negative regulation of actin filament depolymeriza...

actin monomer binding,zinc ion binding,actin filam...

stress fiber,cytoplasm,plasma membrane,brush borde...

3

53

80

LLANQQVFHISC[CAM]FR.3|LLANQQVFHISC[CAM]FR.2|ADHPPA...

SEN / CTL

P29401

Transketolase

TKT

1.35

1.13

6.44e-7

4.01e-7

xylulose biosynthetic process,pentose-phosphate sh...

transketolase activity,protein homodimerization ac...

nucleus,nucleoplasm,peroxisome,cytosol,vesicle,mye...

18

53

103

ILATPPQEDAPSVDIANIR.3|ILATPPQEDAPSVDIANIR.2|ILATPP...

SEN / CTL

P10909

Clusterin

CLU

1.34

1.48

0.000011

0.00000569

cell morphogenesis,microglial cell activation,rele...

protein binding,ubiquitin protein ligase binding,c...

extracellular region,extracellular space,nucleus,c...

21

25

42

LFDSDPITVTVPVEVSR.2|LFDSDPITVTVPVEVSR.3|ELDESLQVAE...

SEN / CTL

P07900

Heat shock protein HSP 90-alpha

HSP90AA1

1.34

1.12

0.000136

0.0000612

G2/M transition of mitotic cell cycle,neuron migra...

nucleotide binding,glycoprotein binding,UTP bindin...

extracellular region,nucleus,nucleoplasm,cytoplasm...

15

69

151

LVTSPC[CAM]C[CAM]IVTSTYGWTANMER.3|LVTSPC[CAM]C[CAM...

SEN / CTL

P27797

Calreticulin

CALR

1.32

0.83

0.00000233

0.00000137

negative regulation of transcription from RNA poly...

complement component C1q binding,glycoprotein bind...

acrosomal vesicle,extracellular region,proteinaceo...

15

52

95

EQFLDGDGWTSR.2|FYALSASFEPFSNK.2|FYALSASFEPFSNK.3|S...

SEN / CTL

P42785

Lysosomal Pro-X carboxypeptidase

PRCP

1.32

1.32

0.001

0.000363

regulation of thyroid hormone mediated signaling p...

serine-type carboxypeptidase activity,dipeptidyl-p...

lysosome,plasma membrane,basal part of cell,extrac...

12

11

19

NALDPMSVLLAR.2|NALDPMSVLLAR.3|NALDPM[Oxi]SVLLAR.2|...

SEN / CTL

Q8NBS9

Thioredoxin domain-containing protein 5

TXNDC5

1.32

1.59

0.00252

0.0008

protein folding,response to endoplasmic reticulum ...

protein disulfide isomerase activity

endoplasmic reticulum,endoplasmic reticulum lumen,...

15

30

49

GYPTLLLFR.2|GYPTLLWFR.2|DLESLREYVESQLQR.3|DLESLREY...

SEN / CTL

P35052

Glypican-1

GPC1

1.31

1.21

2.86e-8

2.26e-8

retinoid metabolic process,glycosaminoglycan biosy...

copper ion binding,fibroblast growth factor bindin...

proteinaceous extracellular matrix,extracellular s...

24

13

13

VLQAMLATQLR.2|GFSLSDVPQAEISGEHLR.3|SFVQGLGVASDVVR....

SEN / CTL

P12259

Coagulation factor V

F5

1.3

2.19

0.036

0.00882

platelet degranulation,proteolysis,ER to Golgi ves...

serine-type endopeptidase activity,copper ion bind...

Golgi membrane,extracellular region,extracellular ...

6

40

46

AEVDDVIQVR.2|DIHSGLIGPLLIC[CAM]QK.3|FC[CAM]ENPDEVK...

SEN / CTL

Q16851

UTP--glucose-1-phosphate uridylyltransferase

UGP2

1.3

1.1

0.118

0.0254

glycogen biosynthetic process,UDP-glucose metaboli...

UTP:glucose-1-phosphate uridylyltransferase activi...

nucleus,cytosol,extracellular exosome

3

37

59

SFENSLGINVPR.2|SFENSLGINVPR.3|ILTTASSHEFEHTK.4|ILT...

SEN / CTL

P00338

L-lactate dehydrogenase A chain

LDHA

1.29

1.86

5.53e-11

6.67e-11

response to hypoxia,lactate metabolic process,pyru...

L-lactate dehydrogenase activity,protein binding,k...

nucleus,cytosol,cell-cell adherens junction,membra...

60

38

92

LVIITAGAR.2|VTLTSEEEAR.2|SADTLWGIQKELQF.2|LLIVSNPV...

SEN / CTL

P07951

Tropomyosin beta chain

TPM2

1.29

1.1

1.87e-9

1.73e-9

muscle contraction,muscle filament sliding,regulat...

actin binding,structural constituent of muscle

cytosol,muscle thin filament tropomyosin

42

34

56

IQLVEEELDR.2|IQLVEEELDRAQER.3|IQLVEEELDRAQER.2|RIQ...

SEN / CTL

A5A3E0

POTE ankyrin domain family member F

POTEF

1.29

1.17

0.0015

0.000504

retina homeostasis

extracellular space,cell cortex,extracellular exos...

9

3

4

VAPEEHPVLLTEATLNPK.3|LC[CAM]YVALDFEQEMATVASSSSLEK....

SEN / CTL

Q14118

Dystroglycan

DAG1

1.29

0.51

0.0411

0.00987

morphogenesis of an epithelial sheet,protein O-lin...

virus receptor activity,dystroglycan binding,actin...

extracellular region,basement membrane,extracellul...

3

17

21

VTIPTDLIASSGDIIK.2|GGLSAVDAFEIHVHR.4|GGLSAVDAFEIHV...

SEN / CTL

Q99715

Collagen alpha-1(XII) chain

COL12A1

1.28

1.12

1.72e-35

1.86e-34

skeletal system development,cell adhesion,collagen...

extracellular matrix structural constituent confer...

extracellular region,collagen type XII trimer,extr...

153

96

114

IVEVFDIGPK.2|LLPETPSDPFAIWQITDRDYKPQVGVIADPSSK.4|N...

SEN / CTL

P62158

Calmodulin

CALM1

1.28

1.1

0.00000281

0.0000016

G2/M transition of mitotic cell cycle,MAPK cascade...

Ras guanyl-nucleotide exchange factor activity,cal...

spindle pole,extracellular region,nucleus,nucleopl...

21

13

30

VFDKDGNGYISAAELR.3|VFDKDGNGYISAAELR.2|EAFSLFDKDGDG...

SEN / CTL

P07195

L-lactate dehydrogenase B chain

LDHB

1.27

2.19

0.00026

0.00011

carbohydrate metabolic process,lactate metabolic p...

L-lactate dehydrogenase activity,protein binding,k...

cytoplasm,mitochondrion,cytosol,membrane,myelin sh...

24

35

73

IVVVTAGVR.2|MVVESAYEVIK.2|MVVESAYEVIK.3|M[Oxi]VVES...

SEN / CTL

P00742

Coagulation factor X

F10

1.27

0.72

0.00569

0.00169

signal peptide processing,ER to Golgi vesicle-medi...

serine-type endopeptidase activity,calcium ion bin...

extracellular region,endoplasmic reticulum lumen,G...

6

13

15

ETYDFDIAVLR.2|MLEVPYVDR.2|TGIVSGFGR.2|NTEQEEGGEAVH...

SEN / CTL

P08603

Complement factor H

CFH

1.26

1.09

1.6e-12

2.43e-12

complement activation,complement activation, alter...

protein binding,heparin binding,heparan sulfate pr...

extracellular region,extracellular space,extracell...

42

65

114

C[CAM]FEGFGIDGPAIAK.2|EIMENYNIALR.2|EIMENYNIALR.3|...

SEN / CTL

P55290

Cadherin-13

CDH13

1.26

0.92

0.00458

0.00139

mitotic cell cycle,positive regulation of endothel...

calcium ion binding,low-density lipoprotein partic...

extracellular space,cytoplasm,plasma membrane,cave...

9

7

9

SIVVSPILIPENQR.2|DIQGSLQDIFK.2|TLEGPVPLEVIVIDQNDNR...

SEN / CTL

P63104

14-3-3 protein zeta/delta

YWHAZ

1.25

1.21

3.06e-7

1.94e-7

protein targeting,signal transduction,platelet act...

protein binding,transcription factor binding,prote...

extracellular space,nucleus,nucleoplasm,cytoplasm,...

24

22

53

IETELRDIC[CAM]NDVLSLLEK.3|IETELRDIC[CAM]NDVLSLLEK....

SEN / CTL

O60568

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3

PLOD3

1.25

1.51

0.00664

0.0019

in utero embryonic development,endothelial cell mo...

iron ion binding,protein binding,procollagen-lysin...

endoplasmic reticulum membrane,rough endoplasmic r...

24

41

68

VFLAVFVEQPTPFLPR.3|VFLAVFVEQPTPFLPR.2|QVGYEDQWLQLL...

SEN / CTL

Q99497

Protein deglycase DJ-1

PARK7

1.24

0.96

0.000476

0.000187

negative regulation of protein phosphorylation,neg...

transcription coactivator activity,mRNA binding,re...

chromatin,nucleus,cytoplasm,mitochondrion,mitochon...

12

27

55

GAEEMETVIPVDVMR.2|GAEEMETVIPVDVMR.3|GAEEMETVIPVDVM...

SEN / CTL

P07711

Cathepsin L1

CTSL

1.23

0.78

0.0184

0.00474

toll-like receptor signaling pathway,adaptive immu...

fibronectin binding,cysteine-type endopeptidase ac...

extracellular region,extracellular space,nucleus,l...

6

9

13

VFQEPLFYEAPR.2|VFQEPLFYEAPR.3|NSWGEEWGMGGYVK.2|NSW...

SEN / CTL

P55072

Transitional endoplasmic reticulum ATPase

VCP

1.22

1.68

1.2e-10

1.31e-10

DNA repair,double-strand break repair,NADH metabol...

protein binding,ATP binding,lipid binding,ATPase a...

proteasome complex,nucleus,nucleoplasm,cytoplasm,e...

42

94

187

LGDVISIQPC[CAM]PDVK.2|LGDVISIQPC[CAM]PDVK.3|LIVDEA...

SEN / CTL

P14543

Nidogen-1

NID1

1.22

1.68

2.56e-8

2.07e-8

cell-matrix adhesion,positive regulation of cell-s...

calcium ion binding,collagen binding,laminin bindi...

extracellular region,basement membrane,basal lamin...

51

38

50

VYYREDLSPSITQR.3|VLFETDLVNPR.2|ALEGLQYPFAVTSYGK.2|...

SEN / CTL

P98160

Basement membrane-specific heparan sulfate proteoglycan core protein

HSPG2

1.21

1.1

4.48e-66

8.5e-65

retinoid metabolic process,angiogenesis,glycosamin...

calcium ion binding,protein binding,protein C-term...

extracellular region,basement membrane,extracellul...

291

163

239

AGLSSGFIGC[CAM]VR.2|FSSGITGC[CAM]VK.2|C[CAM]LIHDGA...

SEN / CTL

P21291

Cysteine and glycine-rich protein 1

CSRP1

1.21

0.92

0.000624

0.000237

platelet aggregation

zinc ion binding,poly(A) RNA binding

nucleus,focal adhesion,extracellular exosome

9

16

31

GLESTTLADKDGEIYC[CAM]K.3|GLESTTLADKDGEIYC[CAM]K.2|...

SEN / CTL

Q16769

Glutaminyl-peptide cyclotransferase

QPCT

1.2

0.36

0.0368

0.00895

cellular protein modification process,peptidyl-pyr...

zinc ion binding,glutaminyl-peptide cyclotransfera...

extracellular exosome

3

7

8

VFVGATDSAVPC[CAM]AMMLELAR.3|VFVGATDSAVPC[CAM]AMMLE...

SEN / CTL

O75083

WD repeat-containing protein 1

WDR1

1.19

0.83

6.47e-8

4.77e-8

platelet degranulation,sensory perception of sound...

actin filament binding

podosome,extracellular region,cytoplasm,cytosol,ac...

21

47

76

LYSILGTTLKDEGK.3|LYSILGTTLKDEGK.2|YAPSGFYIASGDVSGK...

SEN / CTL

P18206

Vinculin

VCL

1.17

1.35

8.46e-11

9.59e-11

morphogenesis of an epithelium,platelet degranulat...

dystroglycan binding,actin binding,structural mole...

extracellular region,cytosol,cytoskeleton,plasma m...

72

102

192

AIPDLTAPVAAVQAAVSNLVR.3|AIPDLTAPVAAVQAAVSNLVR.2|WI...

SEN / CTL

Q32P28

Prolyl 3-hydroxylase 1

LEPRE1

1.17

0.08

0.00151

0.000504

protein folding,negative regulation of cell prolif...

molecular_function,iron ion binding,procollagen-pr...

proteinaceous extracellular matrix,endoplasmic ret...

3

29

36

GDWPGVVLSMER.2|TAIEEVQAERK.3|LTNVAATSGDGYR.3|LTNVA...

SEN / CTL

Q96CG8

Collagen triple helix repeat-containing protein 1

CTHRC1

1.16

2.63

0.056

0.013

cell migration,positive regulation of protein bind...

frizzled binding,Wnt-protein binding

proteinaceous extracellular matrix,collagen trimer...

6

3

3

IIIEELPK.2|QC[CAM]SWSSLNYGIDLGK.2|GDASTGWNSVSR.2

SEN / CTL

Q07954

Prolow-density lipoprotein receptor-related protein 1

LRP1

1.14

1.7

0.000283

0.000118

retinoid metabolic process,receptor-mediated endoc...

protease binding,receptor activity,low-density lip...

nucleolus,cytoplasm,lysosomal membrane,endosome,pl...

18

65

72

AALSGANVLTLIEKDIR.3|LDGLC[CAM]IPLR.2|VFFTDYGQIPK.2...

SEN / CTL

P08123

Collagen alpha-2(I) chain

COL1A2

1.13

1.28

1.57e-20

5.97e-20

skeletal system development,blood vessel developme...

extracellular matrix structural constituent,protei...

extracellular region,collagen type I trimer,extrac...

96

44

57

SLNNQIETLLTPEGSR.2|SLNNQIETLLTPEGSR.3|DYEVDATLK.2|...

SEN / CTL

P68363

Tubulin alpha-1B chain

TUBA1B

1.13

1.02

3.18e-12

4.64e-12

microtubule cytoskeleton organization,microtubule-...

double-stranded RNA binding,GTPase activity,struct...

microtubule,cytoplasmic microtubule,myelin sheath,...

48

11

28

AVFVDLEPTVIDEVR.2|AVFVDLEPTVIDEVR.3|LISQIVSSITASLR...

SEN / CTL

P13639

Elongation factor 2

EEF2

1.13

1.27

3.78e-10

3.83e-10

hematopoietic progenitor cell differentiation,resp...

p53 binding,translation elongation factor activity...

nucleus,cytoplasm,cytosol,plasma membrane,cell-cel...

48

83

182

VFSGLVSTGLK.2|LMEPIYLVEIQC[CAM]PEQVVGGIYGVLNR.3|LM...

SEN / CTL

Q16270

Insulin-like growth factor-binding protein 7

IGFBP7

1.11

1.27

7.7e-7

4.76e-7

regulation of cell growth,cell adhesion,embryo imp...

protein binding,insulin-like growth factor binding

extracellular region,extracellular space,extracell...

33

12

15

TELLPGDRDNLAIQTR.3|TELLPGDRDNLAIQTR.2|SRYPVC[CAM]G...

SEN / CTL

P04083

Annexin A1

ANXA1

1.11

1.49

8.66e-7

5.26e-7

DNA strand renaturation,neutrophil homeostasis,ada...

single-stranded DNA binding,single-stranded RNA bi...

cornified envelope,phagocytic cup,extracellular re...

42

38

69

GLGTDEDTLIEILASR.2|GLGTDEDTLIEILASR.3|DLAKDITSDTSG...

SEN / CTL

Q13361

Microfibrillar-associated protein 5

MFAP5

1.11

1.87

0.218

0.045

extracellular matrix organization,extracellular fi...

extracellular matrix structural constituent

microfibril,extracellular region

3

2

2

QC[CAM]IHQLC[CAM]FTSLR.3|EHEAMKDELC[CAM]R.3

SEN / CTL

P02751

Fibronectin

FN1

1.1

1.31

8.76e-83

3.33e-81

angiogenesis,regulation of protein phosphorylation...

protease binding,integrin binding,protein binding,...

extracellular region,fibrinogen complex,basal lami...

402

126

209

FLATTPNSLLVSWQPPR.3|FLATTPNSLLVSWQPPR.2|VTWAPPPSID...

SEN / CTL

Q15063

Periostin

POSTN

1.1

1.37

1.15e-15

2.36e-15

skeletal system development,response to hypoxia,ne...

protein binding,heparin binding,metal ion binding,...

proteinaceous extracellular matrix,extracellular s...

81

48

80

GC[CAM]PAVLPIDHVYGTLGIVGATTTQR.3|GC[CAM]PAVLPIDHVY...

SEN / CTL

O00468

Agrin

AGRN

1.1

1.65

0.0000797

0.0000372

retinoid metabolic process,glycosaminoglycan biosy...

dystroglycan binding,structural constituent of cyt...

extracellular region,basal lamina,cytoplasm,Golgi ...

36

54

64

SIESTLDDLFR.2|SFLAFPTLR.2|GKDFLALALLDGR.3|TEATQGLV...

SEN / CTL

P30086

Phosphatidylethanolamine-binding protein 1

PEBP1

1.1

1

0.000494

0.000193

MAPK cascade,negative regulation of endopeptidase ...

serine-type endopeptidase inhibitor activity,prote...

nucleus,cytosol,extracellular exosome

15

25

48

WSGPLSLQEVDEQPQHPLHVTYAGAAVDELGK.4|WSGPLSLQEVDEQPQ...

SEN / CTL

P23528

Cofilin-1

CFL1

1.09

1.01

5.36e-11

6.57e-11

cytoskeleton organization,Rho protein signal trans...

protein binding,actin filament binding

extracellular space,nucleus,cytoplasm,focal adhesi...

42

24

46

ESKKEDLVFIFWAPESAPLK.4|ESKKEDLVFIFWAPESAPLK.3|ESKK...

SEN / CTL

O00584

Ribonuclease T2

RNASET2

1.09

0.7

0.0008

0.000296

RNA catabolic process,RNA phosphodiester bond hydr...

RNA binding,ribonuclease activity,ribonuclease T2 ...

extracellular region,extracellular space,lysosome,...

9

17

29

ELDLNSVLLK.2|SWPFNLEEIKDLLPEMR.3|LGIKPSINYYQVADFKD...

SEN / CTL

P50395

Rab GDP dissociation inhibitor beta

GDI2

1.07

1.36

3.01e-7

1.92e-7

signal transduction,small GTPase mediated signal t...

Rab GDP-dissociation inhibitor activity,GTPase act...

cytoplasm,Golgi apparatus,cytosol,focal adhesion,m...

36

56

113

KFDLGQDVIDFTGHALALYR.3|KFDLGQDVIDFTGHALALYR.4|KFDL...

SEN / CTL

O00299

Chloride intracellular channel protein 1

CLIC1

1.07

1.63

0.0000602

0.0000289

chloride transport,signal transduction,regulation ...

voltage-gated ion channel activity,chloride channe...

extracellular space,nucleus,nuclear envelope,cytop...

24

24

42

LAALNPESNTAGLDIFAK.2|LAALNPESNTAGLDIFAK.3|GFTIPEAF...

SEN / CTL

P60709

P63261

Actin, cytoplasmic 1;Actin, cytoplasmic 2

ACTB

ACTG1

1.05

1.52

6.46e-16

1.36e-15

retina homeostasis,movement of cell or subcellular...

structural constituent of cytoskeleton,protein bin...

nuclear chromatin,extracellular space,nucleoplasm,...

174

28

111

SYELPDGQVITIGNER.2|SYELPDGQVITIGNER.3|GYSFTTTAEREI...

SEN / CTL

P68032

Actin, alpha cardiac muscle 1

ACTC1

1.05

1.12

0.0000104

0.0000055

apoptotic process,positive regulation of gene expr...

ATP binding,ATPase activity,myosin binding

extracellular space,cytoplasm,cytosol,actin filame...

48

8

32

EKLC[CAM]YVALDFENEM[Oxi]ATAASSSSLEK.3|VAPEEHPTLLTE...

SEN / CTL

Q05682

Caldesmon

CALD1

1.04

1.82

0.00258

0.000819

movement of cell or subcellular component,muscle c...

actin binding,calmodulin binding,tropomyosin bindi...

cytosol,cytoskeleton,plasma membrane,cell-cell adh...

15

61

87

QKEFDPTITDASLSLPSRR.4|YEIEETETVTK.2|QERYEIEETETVTK...

SEN / CTL

Q9H173

Nucleotide exchange factor SIL1

SIL1

1.03

1.39

0.0151

0.00401

protein folding,intracellular protein transport

unfolded protein binding

extracellular space,endoplasmic reticulum,endoplas...

9

9

11

VVTLLYDLVTEK.2|VLQTLGVLLTTC[CAM]R.2|VLQTLGVLLTTC[C...

SEN / CTL

P04350

Tubulin beta-4A chain

TUBB4A

1.02

0.83

0.00191

0.000632

G2/M transition of mitotic cell cycle,cytoskeleton...

GTPase activity,structural constituent of cytoskel...

nucleus,cytosol,microtubule,cilium,internode regio...

12

7

19

MREIVHLQAGQC[CAM]GNQIGAK.4|MREIVHLQAGQC[CAM]GNQIGA...

SEN / CTL

Q9ULV4

Coronin-1C

CORO1C

1.01

0.53

0.00692

0.00197

neural crest cell migration,regulation of protein ...

protein binding,Rac GTPase binding,actin filament ...

cytoplasm,focal adhesion,actin cytoskeleton,latera...

6

36

54

VTWDSSFC[CAM]AVNPR.2|AIFLADGNVFTTGFSR.2|AIFLADGNVF...

SEN / CTL

Q10588

ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2

BST1

1

0.37

0.0015

0.000504

humoral immune response,multicellular organism dev...

NAD+ nucleosidase activity,transferase activity,ph...

plasma membrane,extrinsic component of membrane,an...

6

11

13

VADFLSWC[CAM]R.2|FMPLSDVLYGR.2|ALLSPEQR.2|GEGTSAHL...

SEN / CTL

P00352

Retinal dehydrogenase 1

ALDH1A1

1

1.18

0.00225

0.000725

ethanol oxidation,cellular aldehyde metabolic proc...

retinal dehydrogenase activity,aldehyde dehydrogen...

cytoplasm,cytosol,extracellular exosome

12

44

78

LYSNAYLNDLAGC[CAM]IK.2|LYSNAYLNDLAGC[CAM]IK.3|TIPI...

SEN / CTL

Q92626

Peroxidasin homolog

PXDN

0.99

1.05

0.0000106

0.00000557

negative regulation of cytokine-mediated signaling...

peroxidase activity,interleukin-1 receptor antagon...

proteinaceous extracellular matrix,extracellular s...

24

30

36

SPNDLLALFR.2|LYGSTLNIDLFPALVVEDLVPGSR.3|ISGVALHDQG...

SEN / CTL

Q14697

Neutral alpha-glucosidase AB

GANAB

0.99

1.71

0.000277

0.000116

carbohydrate metabolic process,protein folding

carbohydrate binding,glucan 1,3-alpha-glucosidase ...

endoplasmic reticulum lumen,Golgi apparatus,membra...

27

70

141

YFTWDPSRFPQPR.3|SLLLSVNAR.2|LSFQHDPETSVLVLR.3|LSFQ...

SEN / CTL

Q9H299

SH3 domain-binding glutamic acid-rich-like protein 3

SH3BGRL3

0.99

0.89

0.0393

0.00952

regulation of actin filament depolymerization,regu...

GTPase activator activity,electron carrier activit...

nucleus,cytoplasm,lamellipodium,extracellular exos...

6

7

15

IQYQLVDISQDNALRDEMR.3|IQYQLVDISQDNALRDEMR.4|IQYQLV...

SEN / CTL

Q562R1

Beta-actin-like protein 2

ACTBL2

0.98

0.37

4.41e-10

4.41e-10

biological_process

molecular_function,ATP binding

extracellular space,cytoplasm,cytoskeleton,extrace...

18

9

17

KDLYANTVLSGGSTM[Oxi]YPGIADR.3|VAPDEHPILLTEAPLNPK.3...

SEN / CTL

P13611

Versican core protein

VCAN

0.98

1.3

0.0327

0.00808

skeletal system development,osteoblast differentia...

extracellular matrix structural constituent,calciu...

extracellular region,proteinaceous extracellular m...

6

17

23

YTLNFEAAQK.2|LATVGELQAAWR.2|YEINSLIR.2|VGHDYQWIGLN...

SEN / CTL

P05090

Apolipoprotein D

APOD

0.98

2.96

0.0557

0.013

response to reactive oxygen species,angiogenesis,g...

lipid transporter activity,protein binding,cholest...

extracellular region,extracellular space,endoplasm...

6

11

13

C[CAM]PNPPVQENFDVNKYLGR.3|WYEIEKIPTTFENGR.3|VLNQEL...

SEN / CTL

P02452

Collagen alpha-1(I) chain

COL1A1

0.96

1.35

2.32e-10

2.44e-10

skeletal system development,blood vessel developme...

extracellular matrix structural constituent,protei...

extracellular region,collagen type I trimer,extrac...

66

47

55

DRDLEVDTTLK.3|DRDLEVDTTLK.2|SGEYWIDPNQGC[CAM]NLDAI...

SEN / CTL

Q9Y696

Chloride intracellular channel protein 4

CLIC4

0.95

1.12

0.000295

0.000122

angiogenesis,endothelial cell morphogenesis,chlori...

voltage-gated ion channel activity,chloride channe...

intracellular,cytoplasm,mitochondrion,centrosome,c...

15

25

45

YLTNAYSRDEFTNTC[CAM]PSDKEVEIAYSDVAK.4|TDVNKIEEFLEE...

SEN / CTL

Q3ZCM7

Tubulin beta-8 chain

TUBB8

0.95

0.87

0.183

0.0383

oocyte maturation,spindle assembly involved in fem...

molecular_function,GTPase activity,structural cons...

cytoplasm,microtubule,extracellular exosome,meioti...

3

4

13

LPTPTYGDLNHLVSATMSGVTTC[CAM]LR.3|ALTVAELTQQM[Oxi]F...

SEN / CTL

Q92734

Protein TFG

TFG

0.95

1

0.223

0.0458

signal transduction,positive regulation of I-kappa...

signal transducer activity,protein binding,identic...

Golgi membrane,cytoplasm,cytosol,extracellular exo...

3

17

33

RIPIHNEDITYDELVLMMQR.4|RIPIHNEDITYDELVLM[Oxi]MQR.4...

SEN / CTL

P37802

Transgelin-2

TAGLN2

0.93

1.62

2.41e-7

1.56e-7

epithelial cell differentiation,cell-cell adhesion

cadherin binding involved in cell-cell adhesion

cell-cell adherens junction,vesicle,extracellular ...

39

26

53

QMEQISQFLQAAER.2|QMEQISQFLQAAER.3|QM[Oxi]EQISQFLQA...

SEN / CTL

P60981

Destrin

DSTN

0.93

0.74

0.0169

0.00445

actin polymerization or depolymerization,actin fil...

protein binding,actin filament binding

actin cytoskeleton,cortical actin cytoskeleton,ext...

6

22

34

YALYDASFETK.2|KEELMFFLWAPELAPLK.3|KEELM[Oxi]FFLWAP...

SEN / CTL

Q71U36

Tubulin alpha-1A chain

TUBA1A

0.93

1.23

0.0183

0.00474

G2/M transition of mitotic cell cycle,cytoskeleton...

GTPase activity,structural molecule activity,struc...

nucleus,cytosol,microtubule,cytoplasmic microtubul...

6

36

88

TIQFVDWC[CAM]PTGFK.2|TIQFVDWC[CAM]PTGFK.3|RTIQFVDW...

SEN / CTL

P50454

Serpin H1

SERPINH1

0.92

0.78

4.84e-15

9.43e-15

chondrocyte development involved in endochondral b...

serine-type endopeptidase inhibitor activity,colla...

endoplasmic reticulum,endoplasmic reticulum lumen,...

48

33

71

LYGPSSVSFADDFVR.2|LYGPSSVSFADDFVR.3|AVLSAEQLRDEEVH...

SEN / CTL

Q9Y490

Talin-1

TLN1

0.91

0.87

1.34e-18

3.93e-18

platelet degranulation,movement of cell or subcell...

integrin binding,structural constituent of cytoske...

ruffle,extracellular region,cytoplasm,microtubule ...

69

186

355

GLAGAVSELLR.2|AVASAAAALVLK.2|TLAESALQLLYTAK.2|TLAE...

SEN / CTL

P26038

Moesin

MSN

0.91

1.32

5.07e-8

3.81e-8

movement of cell or subcellular component,cytoskel...

double-stranded RNA binding,actin binding,receptor...

uropod,extracellular space,nucleus,cytoplasm,cytos...

39

60

110

IGFPWSEIR.2|ERQEAEEAKEALLQASR.3|ERQEAEEAKEALLQASR....

SEN / CTL

Q14847

LIM and SH3 domain protein 1

LASP1

0.91

1.06

0.00212

0.000692

ion transport,positive regulation of signal transd...

SH3/SH2 adaptor activity,protein binding,zinc ion ...

cytoplasm,cell-cell adherens junction,focal adhesi...

12

20

35

QSFTMVADTPENLR.2|QSFTMVADTPENLR.3|QSFTM[Oxi]VADTPE...

SEN / CTL

P81605

Dermcidin

DCD

0.89

1.16

0.173

0.0363

proteolysis,killing of cells of other organism,def...

peptidase activity,poly(A) RNA binding

extracellular region,extracellular matrix,extracel...

3

4

6

LGKDAVEDLESVGK.3|LGKDAVEDLESVGK.2|GAVHDVKDVLDSVL.3...

SEN / CTL

P04075

Fructose-bisphosphate aldolase A

ALDOA

0.88

1.21

7.71e-19

2.44e-18

platelet degranulation,fructose metabolic process,...

actin binding,fructose-bisphosphate aldolase activ...

extracellular region,extracellular space,nucleus,c...

87

51

110

VDKGVVPLAGTNGETTTQGLDGLSER.3|VDKGVVPLAGTNGETTTQGLD...

SEN / CTL

P25788

Proteasome subunit alpha type-3

PSMA3

0.88

0.97

0.0362

0.00885

MAPK cascade,protein polyubiquitination,stimulator...

threonine-type endopeptidase activity,protein bind...

proteasome complex,nucleus,nucleoplasm,cytoplasm,c...

6

15

25

AVENSSTAIGIR.2|VFQVEYAMK.2|VFQVEYAM[Oxi]K.2|C[CAM]...

SEN / CTL

P52907

F-actin-capping protein subunit alpha-1

CAPZA1

0.86

1.15

0.0254

0.00636

protein complex assembly,movement of cell or subce...

actin binding,cadherin binding involved in cell-ce...

extracellular region,cytosol,cytoskeleton,cell-cel...

9

20

42

FTITPPTAQVVGVLK.2|FTITPPTAQVVGVLK.3|LLLNNDNLLR.2|L...

SEN / CTL

Q96D15

Reticulocalbin-3

RCN3

0.85

1.41

0.000255

0.000109

calcium ion binding

endoplasmic reticulum lumen

15

13

20

AGDGDGWVSLAELR.2|EVAKEFDQLTPEESQAR.3|EVAKEFDQLTPEE...

SEN / CTL

Q6UVK1

Chondroitin sulfate proteoglycan 4

CSPG4

0.85

0.75

0.00339

0.00105

activation of MAPK activity,angiogenesis,transmemb...

signal transducer activity,protein kinase binding

extracellular region,Golgi lumen,integral componen...

9

46

56

GSLLLGGLDAEASR.2|ALLHVWAGGPWPQGATLR.3|ALLHVWAGGPWP...

SEN / CTL

P01344

Insulin-like growth factor II

IGF2

0.84

0.54

0.0067

0.00191

skeletal system development,ossification,positive ...

insulin receptor binding,insulin-like growth facto...

extracellular region,extracellular space,plasma me...

6

2

3

GIVEEC[CAM]C[CAM]FR.2|SC[CAM]DLALLETYC[CAM]ATPAK.2...

SEN / CTL

P35555

Fibrillin-1

FBN1

0.83

0.84

1.34e-11

1.85e-11

skeletal system development,metanephros developmen...

integrin binding,hormone activity,extracellular ma...

microfibril,extracellular region,proteinaceous ext...

48

32

32

ILELLPALTTLTNHNR.3|TLPGGNQC[CAM]IVPIC[CAM]R.2|TC[C...

SEN / CTL

Q15293

Reticulocalbin-1

RCN1

0.83

3.59

0.123

0.0265

in utero embryonic development,camera-type eye dev...

calcium ion binding

endoplasmic reticulum,endoplasmic reticulum lumen

15

29

48

AADLNGDLTATR.2|HWILPQDYDHAQAEAR.4|HWILPQDYDHAQAEAR...

SEN / CTL

Q14112

Nidogen-2

NID2

0.82

1.57

0.0979

0.0215

cell adhesion,cell-matrix adhesion,extracellular m...

calcium ion binding,protein binding,collagen bindi...

extracellular region,basement membrane,extracellul...

27

46

60

VLYREDTSPAVLGLAAR.3|AIAVDPIRGNLYWTDWNR.3|AGLELGAEP...

SEN / CTL

P15144

Aminopeptidase N

ANPEP

0.8

1.38

0.000186

0.0000812

angiogenesis,proteolysis,cell differentiation,pept...

virus receptor activity,aminopeptidase activity,re...

extracellular space,lysosomal membrane,endoplasmic...

15

60

99

YLSYTLNPDLIR.2|YLSYTLNPDLIR.3|ENKEVVLQWFTENSK.3|EN...

SEN / CTL

P28300

Protein-lysine 6-oxidase

LOX

0.8

0.7

0.0346

0.0085

cellular protein modification process,heart develo...

protein-lysine 6-oxidase activity,copper ion bindi...

extracellular region,proteinaceous extracellular m...

6

2

3

YTGHHAYASGC[CAM]TISPY.3|YTGHHAYASGC[CAM]TISPY.2|NQ...

SEN / CTL

P35442

Thrombospondin-2

THBS2

0.79

0.41

0.00000467

0.00000259

cell adhesion,negative regulation of angiogenesis,...

calcium ion binding,heparin binding

extracellular region,basement membrane,platelet al...

15

8

9

GTLLALEGPGLSQR.2|SC[CAM]DVTSNTC[CAM]LGPSIQTR.2|GLL...

SEN / CTL

P08294

Extracellular superoxide dismutase [Cu-Zn]

SOD3

0.79

1.28

0.00144

0.000493

response to reactive oxygen species,response to hy...

superoxide dismutase activity,copper ion binding,p...

extracellular region,extracellular space,nucleus,c...

21

10

14

VTEIWQEVMQR.2|VTEIWQEVM[Oxi]QR.2|VTGVVLFR.2|LAC[CA...

SEN / CTL

Q14315

Filamin-C

FLNC

0.77

1.22

6.29e-9

5.49e-9

cell junction assembly,muscle fiber development

protein binding,cytoskeletal protein binding,ankyr...

cytoplasm,cytosol,cytoskeleton,plasma membrane,foc...

51

146

209

LIALLEVLSQK.2|VAVGQEQAFSVNTR.2|YGGDEIPYSPFR.2|YWPT...

SEN / CTL

P05452

Tetranectin

CLEC3B

0.77

1.93

0.0022

0.00071

ossification,platelet degranulation,positive regul...

calcium ion binding,heparin binding,carbohydrate b...

granular component,extracellular region,extracellu...

21

11

14

LDTLAQEVALLK.2|GGTLGTPQTGSENDALYEYLR.3|GGTLGTPQTGS...

SEN / CTL

P10321

HLA class I histocompatibility antigen, Cw-7 alpha chain

HLA-C

0.75

2.06

0.00000156

9.25e-7

27

12

15

AYLEGTC[CAM]VEWLR.2|SWTAADTAAQITQR.2|SWTAADTAAQITQ...

SEN / CTL

P63241

Eukaryotic translation initiation factor 5A-1

EIF5A

0.75

1.6

0.00103

0.000369

mRNA export from nucleus,translational frameshifti...

RNA binding,translation elongation factor activity...

nucleus,annulate lamellae,nuclear pore,cytoplasm,e...

15

19

41

VHLVGIDIFTGK.3|VHLVGIDIFTGK.2|RNDFQLIGIQDGYLSLLQDS...

SEN / CTL

Q01518

Adenylyl cyclase-associated protein 1

CAP1

0.75

0.37

0.00376

0.00116

cell morphogenesis,ameboidal-type cell migration,r...

actin binding,adenylate cyclase binding

plasma membrane,focal adhesion,cortical actin cyto...

6

51

99

SSEMNVLIPTEGGDFNEFPVPEQFK.3|SSEMNVLIPTEGGDFNEFPVPE...

SEN / CTL

Q92520

Protein FAM3C

FAM3C

0.73

1.03

0.0397

0.00958

platelet degranulation,multicellular organism deve...

cytokine activity

extracellular region,Golgi apparatus,platelet dens...

9

12

17

MDASLGNLFAR.2|IC[CAM]LEDNVLMSGVK.2|IC[CAM]LEDNVLM[...

SEN / CTL

P06396

Gelsolin

GSN

0.72

1.08

2.42e-7

1.56e-7

phagocytosis, engulfment,positive regulation of ge...

actin binding,calcium ion binding,protein binding,...

podosome,extracellular region,extracellular space,...

45

53

102

QTQVSVLPEGGETPLFK.2|QTQVSVLPEGGETPLFK.3|AGALNSNDAF...

SEN / CTL

Q06830

Peroxiredoxin-1

PRDX1

0.72

1.38

0.00000873

0.00000467

response to reactive oxygen species,skeletal syste...

peroxidase activity,protein binding,thioredoxin pe...

extracellular space,nucleus,cytoplasm,mitochondrio...

30

29

60

GLFIIDDKGILR.3|GLFIIDDKGILR.2|LVQAFQFTDKHGEVC[CAM]...

SEN / CTL

O95967

EGF-containing fibulin-like extracellular matrix protein 2

EFEMP2

0.72

0.53

0.000137

0.0000612

extracellular matrix structural constituent,calciu...

extracellular region,basement membrane,extracellul...

12

6

6

SC[CAM]VDVNEC[CAM]DMGAPC[CAM]EQR.2|C[CAM]INHYGGYLC...

SEN / CTL

P10599

Thioredoxin

TXN

0.72

1.58

0.0606

0.0138

sulfate assimilation,negative regulation of transc...

protein binding,protein disulfide oxidoreductase a...

nucleus,nucleoplasm,cytoplasm,mitochondrion,cytoso...

12

12

20

C[CAM]MPTFQFFK.2|C[CAM]M[Oxi]PTFQFFK.2|VGEFSGANKEK...

SEN / CTL

P12110

Collagen alpha-2(VI) chain

COL6A2

0.7

1.66

1.38e-12

2.14e-12

cell adhesion,response to glucose,extracellular ma...

extracellular region,proteinaceous extracellular m...

60

42

57

AAVFHEKDYDSLAQPGFFDR.4|AAVFHEKDYDSLAQPGFFDR.3|VFAV...

SEN / CTL

Q6NZI2

Polymerase I and transcript release factor

PTRF

0.7

0.94

0.000958

0.00035

regulation of transcription, DNA-templated,transcr...

protein binding,rRNA primary transcript binding,po...

nucleus,nucleoplasm,cytoplasm,mitochondrion,endopl...

15

15

23

QAEMEGAVQSIQGELSK.3|QAEMEGAVQSIQGELSK.2|QAEM[Oxi]E...

SEN / CTL

P00747

Plasminogen

PLG

0.7

1.32

0.013

0.00353

platelet degranulation,proteolysis,blood coagulati...

serine-type endopeptidase activity,receptor bindin...

extracellular region,extracellular space,plasma me...

12

58

96

TPENYPNAGLTMNYC[CAM]R.3|TPENYPNAGLTMNYC[CAM]R.2|TP...

SEN / CTL

P26599

Polypyrimidine tract-binding protein 1

PTBP1

0.69

1.81

0.0418

0.01

alternative mRNA splicing, via spliceosome,regulat...

nucleotide binding,RNA binding,protein binding,pol...

nucleoplasm,nucleolus,membrane,extracellular exoso...

6

35

87

KLPIDVTEGEVISLGLPFGK.3|KLPIDVTEGEVISLGLPFGK.4|KLPI...

SEN / CTL

P08133

Annexin A6

ANXA6

0.68

0.81

0.00963

0.00268

calcium ion transport,regulation of muscle contrac...

calcium ion binding,protein binding,GTP binding,ca...

mitochondrion,lysosomal membrane,focal adhesion,me...

15

72

121

GLGTDEDTIIDIITHR.3|GLGTDEDTIIDIITHR.2|GFGSDKEAILDI...

SEN / CTL

O95084

Serine protease 23

PRSS23

0.67

0.74

0.0109

0.003

proteolysis

serine-type endopeptidase activity

nucleus,extracellular exosome

6

5

6

YAQIC[CAM]YWIK.2|LSTGC[CAM]TGTLVAEK.2|LEVSSSC[CAM]...

SEN / CTL

P14625

Endoplasmin

HSP90B1

0.66

2.09

0.000124

0.0000565

response to hypoxia,toll-like receptor signaling p...

RNA binding,calcium ion binding,protein binding,AT...

extracellular region,nucleus,endoplasmic reticulum...

24

85

166

GVVDSDDLPLNVSR.2|GVVDSDDLPLNVSR.3|FAFQAEVNR.2|FQSS...

SEN / CTL

Q15019

Septin-2

2-Sep

0.66

0.75

0.00635

0.00185

regulation of L-glutamate transport,mitotic nuclea...

protein binding,GTP binding,enzyme regulator activ...

exocyst,condensed chromosome kinetochore,nucleus,n...

9

30

53

TIISYIDEQFER.2|ASIPFSVVGSNQLIEAK.2|ASIPFSVVGSNQLIE...

SEN / CTL

P20908

Collagen alpha-1(V) chain

COL5A1

0.65

0.68

5.98e-7

3.75e-7

blood vessel development,heart morphogenesis,cell ...

integrin binding,extracellular matrix structural c...

extracellular region,collagen type V trimer,baseme...

33

15

18

SPVFLYEDHTGKPGPEDYPLFR.4|QLYPASAFPEDFSILTTVK.2|FLG...

SEN / CTL

P13797

Plastin-3

PLS3

0.65

0.87

0.0142

0.00382

actin filament bundle assembly,actin filament netw...

calcium ion binding,actin filament binding

cytoplasm,actin filament,actin filament bundle

15

45

74

VYALPEDLVEVKPK.3|VYALPEDLVEVKPK.2|MVMTVFAC[CAM]LMG...

SEN / CTL

O43852

Calumenin

CALU

0.64

0.8

0.0000754

0.0000356

biological_process

calcium ion binding,protein binding

extracellular region,endoplasmic reticulum,endopla...

21

34

62

WIYEDVER.2|IDGDKDGFVTVDELKDWIK.4|IDGDKDGFVTVDELKDW...

SEN / CTL

P15311

Ezrin

EZR

0.64

1.25

0.0237

0.00595

negative regulation of transcription from RNA poly...

actin binding,protein binding,microtubule binding,...

ruffle,immunological synapse,uropod,extracellular ...

12

50

90

QRIDEFEAL.2|SQEQLAAELAEYTAK.2|SQEQLAAELAEYTAK.3|GM...

SEN / CTL

Q13740

CD166 antigen

ALCAM

0.64

1.11

0.0729

0.0163

adaptive immune response,cell adhesion,heterophili...

receptor binding,protein binding

immunological synapse,integral component of plasma...

9

30

45

EMDPVTQLYTMTSTLEYK.3|EMDPVTQLYTMTSTLEYK.2|VLHPLEGA...

SEN / CTL

O60565

Q9H772

Gremlin-1;Gremlin-2

GREM1

GREM2

0.63

0.47

0.145

0.0309

cell morphogenesis,branching involved in ureteric ...

cytokine activity,protein binding,morphogen activi...

extracellular space,cell surface;extracellular reg...

3

1

1

FC[CAM]YGQC[CAM]NSFYIPR.2

SEN / CTL

Q9Y4K0

Lysyl oxidase homolog 2

LOXL2

0.62

0.85

0.00000769

0.0000042

response to hypoxia,epithelial to mesenchymal tran...

chromatin binding,transcription corepressor activi...

basement membrane,extracellular space,nucleus,nucl...

27

16

19

VVC[CAM]GMFGFPGER.2|LGQGIGPIHLNEIQC[CAM]TGNEK.3|NG...

SEN / CTL

Q14019

Coactosin-like protein

COTL1

0.62

0.66

0.00497

0.00149

biological_process,defense response to fungus

actin binding,enzyme binding

nucleus,cytoplasm,cytoskeleton,extracellular exoso...

12

20

26

SKFALITWIGENVSGLQR.3|SKFALITWIGENVSGLQR.2|FALITWIG...

SEN / CTL

P08758

Annexin A5

ANXA5

0.59

1.5

7.82e-9

6.75e-9

signal transduction,blood coagulation,response to ...

phospholipase inhibitor activity,calcium ion bindi...

intracellular,cytoplasm,focal adhesion,external si...

36

45

70

GLGTDEESILTLLTSR.3|GLGTDEESILTLLTSR.2|SEIDLFNIR.2|...

SEN / CTL

P09972

Fructose-bisphosphate aldolase C

ALDOC

0.59

1.11

0.00131

0.000458

fructose metabolic process,gluconeogenesis,fructos...

fructose-bisphosphate aldolase activity,protein bi...

mitochondrion,cytosol,cytoskeleton,extracellular e...

12

27

42

VDKGVVPLAGTDGETTTQGLDGLSER.3|VDKGVVPLAGTDGETTTQGLD...

SEN / CTL

Q04760

Lactoylglutathione lyase

GLO1

0.59

1.42

0.0798

0.0177

carbohydrate metabolic process,pyruvate metabolic ...

lactoylglutathione lyase activity,zinc ion binding

cytoplasm,cytosol,extracellular exosome

6

16

31

GLAFIQDPDGYWIEILNPNK.3|GLAFIQDPDGYWIEILNPNK.2|GFGH...

SEN / CTL

P09486

SPARC

SPARC

0.56

0.98

6.64e-10

6.56e-10

ossification,negative regulation of endothelial ce...

calcium ion binding,protein binding,collagen bindi...

extracellular region,basement membrane,extracellul...

48

14

22

YIPPC[CAM]LDSELTEFPLR.3|YIPPC[CAM]LDSELTEFPLR.2|FF...

SEN / CTL

P02787

Serotransferrin

TF

0.54

0.66

0.0596

0.0136

retina homeostasis,platelet degranulation,cellular...

protein binding,ferrous iron binding,ferric iron b...

extracellular region,extracellular space,early end...

6

86

160

C[CAM]LVEKGDVAFVK.3|C[CAM]LVEKGDVAFVK.2|NPDPWAK.2|...

SEN / CTL

P61224

P62834

Ras-related protein Rap-1b;Ras-related protein Rap-1A

RAP1B

RAP1A

0.54

1.54

0.173

0.0363

cell proliferation,response to carbohydrate,Rap pr...

GTPase activity,protein binding,GTP binding,GDP bi...

intracellular,lipid particle,cytosol,plasma membra...

6

2

3

SKINVNEIFYDLVR.3|SKINVNEIFYDLVR.2|LVVLGSGGVGK.2

SEN / CTL

P17936

Insulin-like growth factor-binding protein 3

IGFBP3

0.53

1.15

0.0000597

0.0000289

regulation of cell growth,osteoblast differentiati...

fibronectin binding,protein binding,insulin-like g...

extracellular region,extracellular space,nucleus,i...

24

10

13

C[CAM]QPSPDEARPLQALLDGR.3|FLNVLSPR.2|EPGC[CAM]GC[C...

SEN / CTL

P05121

Plasminogen activator inhibitor 1

SERPINE1

0.53

1.12

0.00103

0.000369

chronological cell aging,angiogenesis,platelet deg...

protease binding,serine-type endopeptidase inhibit...

extracellular region,extracellular space,plasma me...

18

9

10

MAPEEIIMDRPFLFVVR.3|HNPTGTVLFMGQVMEP.2|QFQADFTSLSD...

SEN / CTL

P32119

Peroxiredoxin-2

PRDX2

0.51

1.14

0.00705

0.002

response to reactive oxygen species,response to ox...

thioredoxin peroxidase activity,antioxidant activi...

cytoplasm,cytosol,extracellular exosome

9

24

40

KEGGLGPLNIPLLADVTR.3|KEGGLGPLNIPLLADVTR.2|ATAVVDGA...

SEN / CTL

P01023

Alpha-2-macroglobulin

A2M

0.5

1.34

0.00143

0.000491

negative regulation of complement activation, lect...

protease binding,serine-type endopeptidase inhibit...

extracellular region,cytosol,platelet alpha granul...

33

89

144

QTVSWAVTPK.2|ATVLNYLPK.2|IAQWQSFQLEGGLKQFSFPLSSEPF...

SEN / CTL

P61158

Actin-related protein 3

ACTR3

0.49

1.48

0.00101

0.000363

movement of cell or subcellular component,establis...

structural constituent of cytoskeleton,ATP binding...

cytosol,Arp2/3 protein complex,brush border,cell-c...

18

34

61

DITYFIQQLLR.2|DITYFIQQLLR.3|HGIVEDWDLMER.3|HGIVEDW...

SEN / CTL

P01008

Antithrombin-III

SERPINC1

0.49

0.9

0.0829

0.0184

acute inflammatory response to antigenic stimulus,...

protease binding,serine-type endopeptidase inhibit...

extracellular region,extracellular space,plasma me...

6

31

70

TSDQIHFFFAK.3|TSDQIHFFFAK.2|FRIEDGFSLK.3|FRIEDGFSL...

SEN / CTL

P00734

Prothrombin

F2

0.48

0.63

0.0729

0.0163

positive regulation of protein phosphorylation,sig...

serine-type endopeptidase activity,receptor bindin...

extracellular region,extracellular space,endoplasm...

6

42

86

SPQELLC[CAM]GASLISDR.2|SPQELLC[CAM]GASLISDR.3|KSPQ...

SEN / CTL

O00622

Protein CYR61

CYR61

0.45

0.77

0.0188

0.00483

regulation of cell growth,osteoblast differentiati...

integrin binding,insulin-like growth factor bindin...

proteinaceous extracellular matrix,extracellular m...

9

17

20

GLEC[CAM]NFGASSTALK.2|HQC[CAM]TC[CAM]IDGAVGC[CAM]I...

SEN / CTL

Q9BRK5

45 kDa calcium-binding protein

SDF4

0.43

1.86

0.0444

0.0105

UV protection,calcium ion regulated exocytosis,cer...

calcium ion binding,identical protein binding

cytoplasm,late endosome,Golgi apparatus,Golgi lume...

9

20

30

WYQADSPPADLLLTEEEFLSFLHPEHSR.4|DLGGFDEDAEPR.2|AVDP...

SEN / CTL

P20742

Pregnancy zone protein

PZP

0.43

0.84

0.127

0.0271

female pregnancy,negative regulation of endopeptid...

endopeptidase inhibitor activity,serine-type endop...

extracellular region,extracellular exosome,blood m...

6

23

26

DLFHC[CAM]VSFTLPR.3|DLFHC[CAM]VSFTLPR.2|SGTHTLPVES...

SEN / CTL

P18065

Insulin-like growth factor-binding protein 2

IGFBP2

0.42

1.23

0.0172

0.0045

regulation of cell growth,signal transduction,fema...

receptor binding,insulin-like growth factor I bind...

extracellular region,extracellular space,apical pl...

15

11

14

TPC[CAM]QQELDQVLER.2|LEGEAC[CAM]GVYTPR.2|MPC[CAM]A...

SEN / CTL

P35908

Keratin, type II cytoskeletal 2 epidermal

KRT2

0.4

1.24

1.5e-7

1.02e-7

keratinocyte development,epidermis development,ker...

structural constituent of cytoskeleton,protein bin...

extracellular space,nucleus,cytoplasm,Golgi appara...

75

54

102

YEELQVTVGR.2|FLEQQNQVLQTK.2|FLEQQNQVLQTK.3|VDLLNQE...

SEN / CTL

P13645

Keratin, type I cytoskeletal 10

KRT10

0.37

1.44

0.0000545

0.0000267

keratinocyte differentiation

structural constituent of epidermis

extracellular space,nucleus,cytoplasm,intermediate...

120

51

100

TIDDLKNQILNLTTDNANILLQIDNAR.4|TIDDLKNQILNLTTDNANIL...

SEN / CTL

P54727

UV excision repair protein RAD23 homolog B

RAD23B

0.36

1.82

0.068

0.0154

nucleotide-excision repair, DNA damage recognition...

damaged DNA binding,single-stranded DNA binding,pr...

proteasome complex,nucleus,nucleoplasm,cytoplasm,X...

6

20

33

QIIQQNPSLLPALLQQIGR.3|QIIQQNPSLLPALLQQIGR.4|QIIQQN...

SEN / CTL

P07437

Tubulin beta chain

TUBB

0.34

1.12

3.86e-13

6.38e-13

G2/M transition of mitotic cell cycle,movement of ...

GTPase activity,structural molecule activity,struc...

extracellular region,nucleus,nuclear envelope lume...

57

20

59

YLTVAAVFR.2|NSSYFVEWIPNNVK.2|NSSYFVEWIPNNVK.3|AILV...

SEN / CTL

P09936

Ubiquitin carboxyl-terminal hydrolase isozyme L1

UCHL1

0.33

2.19

0.0147

0.00391

response to ischemia,axon target recognition,adult...

cysteine-type endopeptidase activity,thiol-depende...

nucleoplasm,cytoplasm,endoplasmic reticulum membra...

30

20

39

C[CAM]FEKNEAIQAAHDAVAQEGQC[CAM]R.4|C[CAM]FEKNEAIQA...

SEN / CTL

P01024

Complement C3

C3

0.31

1.57

0.0000059

0.00000325

positive regulation of type IIa hypersensitivity,p...

serine-type endopeptidase activity,endopeptidase i...

extracellular region,extracellular space,plasma me...

39

130

202

YYGGGYGSTQATFMVFQALAQYQK.3|GYTQQLAFR.2|SGIPIVTSPYQ...

SEN / CTL

O00469

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2

PLOD2

0.31

1.64

0.24

0.0486

response to hypoxia,cellular protein modification ...

iron ion binding,procollagen-lysine 5-dioxygenase ...

endoplasmic reticulum,endoplasmic reticulum membra...

9

33

47

YLNSGGFIGYAPYVNR.2|AC[CAM]DELVEEMEHYGK.3|GFALLNFVV...

SEN / CTL

P12107

Collagen alpha-1(XI) chain

COL11A1

0.31

0.36

0.247

0.0499

cartilage condensation,ossification,chondrocyte de...

extracellular matrix structural constituent,protei...

extracellular region,collagen type XI trimer,endop...

3

8

8

SPVFLFEDHTGKPAPEDYPLFR.4|ALDFHNSPEGISK.3|DGLPGHPGQ...

SEN / CTL

P08572

Collagen alpha-2(IV) chain

COL4A2

0.3

1.08

0.0423

0.0101

angiogenesis,transcription, DNA-templated,negative...

extracellular matrix structural constituent

extracellular region,collagen type IV trimer,endop...

15

15

19

SVSIGYLLVK.2|FSTMPFLYC[CAM]NPGDVC[CAM]YYASR.3|RGPP...

SEN / CTL

Q00610

Clathrin heavy chain 1

CLTC

0.29

1.95

0.0000337

0.000017

osteoblast differentiation,intracellular protein t...

double-stranded RNA binding,structural molecule ac...

spindle,cytosol,plasma membrane,focal adhesion,mem...

30

154

302

LLLPWLEAR.2|SVDPTLALSVYLR.2|VANVELYYR.2|SVNESLNNLF...

SEN / CTL

P04114

Apolipoprotein B-100

APOB

0.29

0.77

0.0798

0.0177

retinoid metabolic process,in utero embryonic deve...

protein binding,phospholipid binding,heparin bindi...

extracellular region,extracellular space,cytoplasm...

15

186

272

IEGNLIFDPNNYLPK.2|GFEPTLEALFGK.2|ENFAGEATLQR.2|TEV...

SEN / CTL

P07996

Thrombospondin-1

THBS1

0.27

1.45

1.92e-9

1.75e-9

activation of MAPK activity,response to hypoxia,ne...

phosphatidylserine binding,glycoprotein binding,fi...

extracellular region,fibrinogen complex,extracellu...

126

63

89

FVFGTTPEDILR.2|GFLLLASLR.2|TIVTTLQDSIR.2|GGVNDNFQG...

SEN / CTL

P05997

Collagen alpha-2(V) chain

COL5A2

0.27

0.88

0.168

0.0355

skeletal system development,ossification,extracell...

molecular_function,extracellular matrix structural...

extracellular region,collagen type V trimer,endopl...

12

14

15

GSQFAYGDHQSPNTAITQMTFLR.3|SPDNKPVWYGLDMNR.3|QSGEYW...

SEN / CTL

P02545

Prelamin-A/C

LMNA

0.11

2.08

3.04e-11

3.92e-11

mitotic nuclear envelope disassembly,mitotic nucle...

structural molecule activity,protein binding

nucleus,nuclear envelope,lamin filament,nucleoplas...

57

85

142

VAVEEVDEEGKFVR.3|VAVEEVDEEGKFVR.2|LQLELSK.2|IRIDSL...

SEN / CTL

P36955

Pigment epithelium-derived factor

SERPINF1

0.04

1.8

0.0000962

0.0000443

kidney development,multicellular organism developm...

serine-type endopeptidase inhibitor activity,prote...

extracellular region,basement membrane,extracellul...

39

20

26

DTDTGALLFIGK.2|LAAAVSNFGYDLYR.2|LAAAVSNFGYDLYR.3|S...

SEN / CTL

P04259

Keratin, type II cytoskeletal 6B

KRT6B

0.03

1.52

0.095

0.0209

cytoskeleton organization,ectoderm development

structural constituent of cytoskeleton,protein bin...

keratin filament,extracellular exosome

21

9

14

YEELQITAGR.2|YEELQITAGR.1|SGFSSISVSR.2|VLDTKWTLLQE...

SEN / CTL

Q9NR12

PDZ and LIM domain protein 7

PDLIM7

-0.01

2.36

0.201

0.0417

ossification,receptor-mediated endocytosis,multice...

protein binding,zinc ion binding

stress fiber,ruffle,nucleus,cytoplasm,cell-cell ju...

9

23

36

VVLEGPAPWGFR.2|VVLEGPAPWGFR.3|VLEEGGFFEEK.2|LQGGKD...

SEN / CTL

P08729

Keratin, type II cytoskeletal 7

KRT7

-0.09

0.77

0.195

0.0406

viral process

structural molecule activity,protein binding

nucleus,cytoplasm,intermediate filament,keratin fi...

12

52

77

LALDIEIATYR.2|VDALNDEINFLR.2|SSRLPDIFEAQIAGLR.3|SS...

SEN / CTL

P02042

P02100

P68871

P69891

P69892

Hemoglobin subunit delta;Hemoglobin subunit epsilon;Hemoglobin subunit beta;Hemoglobin subunit gamma-1;Hemoglobin subunit gamma-2

HBD

HBE1

HBB

HBG1

HBG2

-0.28

0.53

0.112

0.0242

blood coagulation,oxygen transport;blood coagulati...

oxygen transporter activity,iron ion binding,prote...

cytosol,hemoglobin complex,blood microparticle;cyt...

6

1

2

LLVVYPWTQR.2|LLVVYPWTQR.3

SEN / CTL

Q02413

Desmoglein-1

DSG1

-0.41

1.23

0.226

0.0464

cell-cell junction assembly,homophilic cell adhesi...

calcium ion binding,protein binding,toxic substanc...

cytosol,plasma membrane,cytoplasmic side of plasma...

15

21

32

IIRQEPSDSPMFIINR.3|VIAPSSSLPTSLTIHHPR.4|VIAPSSSLPT...

SEN / CTL

P50995

Annexin A11

ANXA11

-0.47

1.14

0.0568

0.0132

phagocytosis,cell cycle,cell division,response to ...

calcium ion binding,protein binding,calcium-depend...

nuclear envelope,nucleoplasm,cytoplasm,spindle,mem...

6

29

45

NTPAFFAER.2|GVGTDEAC[CAM]LIEILASR.3|GVGTDEAC[CAM]L...

SEN / CTL

P29279

Connective tissue growth factor

CTGF

-0.55

0.85

0.0269

0.00673

cartilage condensation,ossification,angiogenesis,r...

fibronectin binding,integrin binding,protein bindi...

extracellular region,proteinaceous extracellular m...

9

8

8

DGAPC[CAM]IFGGTVYR.2|C[CAM]PAGVSLVLDGC[CAM]GC[CAM]...

SEN / CTL

P67936

Tropomyosin alpha-4 chain

TPM4

-0.85

2.41

0.102

0.0222

osteoblast differentiation,movement of cell or sub...

actin binding,calcium ion binding,protein binding,...

stress fiber,podosome,cytosol,cytoskeleton,muscle ...

18

25

42

KIQALQQQADEAEDRAQGLQR.4|KIQALQQQADEAEDRAQGLQR.3|KI...

SEN / CTL

P02533

Keratin, type I cytoskeletal 14

KRT14

-1.14

1.68

0.0139

0.00374

aging,epidermis development,response to zinc ion,r...

structural constituent of cytoskeleton,protein bin...

nucleus,cytoplasm,cytosol,intermediate filament,ke...

135

50

89

VLDELTLAR.2|ILTATVDNANVLLQIDNAR.3|ILTATVDNANVLLQID...

SEN / CTL

Q93084

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

ATP2A3

-1.23

1.98

0.101

0.0221

transport,calcium ion transport,cellular calcium i...

calcium-transporting ATPase activity,ATP binding,m...

endoplasmic reticulum,endoplasmic reticulum membra...

9

26

35

SLPSVETLGC[CAM]TSVIC[CAM]SDK.2|SLPSVETLGC[CAM]TSVI...

SEN / CTL

P02538

Keratin, type II cytoskeletal 6A

KRT6A

-1.35

1.41

1.22e-7

8.4e-8

morphogenesis of an epithelium,cytoskeleton organi...

structural constituent of cytoskeleton,protein bin...

nucleus,membrane,keratin filament,extracellular ex...

126

61

85

YEELQVTAGR.2|ADTLTDEINFLR.2|ADTLTDEINFLR.3|QNLEPLF...

SEN / CTL

P08779

Keratin, type I cytoskeletal 16

KRT16

-1.57

1.4

2.14e-9

1.94e-9

morphogenesis of an epithelium,inflammatory respon...

structural constituent of cytoskeleton,protein bin...

nucleus,cytoskeleton,intermediate filament,extrace...

96

25

45

APSTYGGGLSVSSR.2|DAETWFLSK.2|LLEGEDAHLSSQQASGQSYSS...

SEN / CTL

P11055

P12882

Q9UKX2

Myosin-3;Myosin-1;Myosin-2

MYH3

MYH1

MYH2

-1.63

2.06

0.0103

0.00285

skeletal muscle contraction,protein dephosphorylat...

microfilament motor activity,calmodulin binding,AT...

cytosol,muscle myosin complex,sarcomere,myosin fil...

9

3

3

HADSVAELGEQIDNLQR.3|GSSFQTVSALFR.2|LASADIETYLLEK.2

SEN / CTL

P12883

P13533

Myosin-7;Myosin-6

MYH7

MYH6

-1.68

1.58

0.231

0.0472

regulation of the force of heart contraction,regul...

microfilament motor activity,actin binding,protein...

stress fiber,muscle myosin complex,myosin complex,...

3

1

1

IEELEEELEAER.2

SEN / CTL

Q04695

Keratin, type I cytoskeletal 17

KRT17

-1.75

1.86

0.00619

0.00181

signal transduction,epidermis development,positive...

structural constituent of cytoskeleton,MHC class I...

cytoplasm,intermediate filament,extracellular exos...

30

28

43

ALEEANTELEVK.2|LSVEADINGLRR.3|LSVEADINGLRR.2|ILTAT...