Post-Atazanivir SASP in human fibroblasts (day 14)

[raw]



















































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































Comparison


UniProtIds


Protein Description


Genes


Log2 Ratio


Std. Dev.


PValue


QValue


GO Biological Process


GO Molecular Process


GO Cellular Process


Ratios


Unique Peptides


Elution Groups


Elution Group


SEN / CTL


P09341


P19875


P19876


Growth-regulated alpha protein;C-X-C motif chemokine 2;C-X-C motif chemokine 3


CXCL1


CXCL2


CXCL3


4.6


1.28


0.0179


0.00467


chemotaxis,inflammatory response,immune response,s…


receptor binding,chemokine activity,enzyme activat…


extracellular region,extracellular space,intracell…


3


1


2


SPGPHC[CAM]AQTEVIATLK.3|SPGPHC[CAM]AQTEVIATLK.2


SEN / CTL


Q8NBJ7


Sulfatase-modifying factor 2


SUMF2


4.33


0.81


0.012


0.00329


post-translational protein modification


metal ion binding


endoplasmic reticulum,endoplasmic reticulum lumen


3


14


22


SVLWWLPVEK.2|LEHPVLHVSWNDAR.4|LEHPVLHVSWNDAR.3|LEH…


SEN / CTL


P01889


HLA class I histocompatibility antigen, B-7 alpha chain


HLA-B


4.13


1


0.0159


0.00418


3


4


4


AYLEGEC[CAM]VEWLR.2|RAYLEGEC[CAM]VEWLR.3|GHDQYAYDG…


SEN / CTL


Q9Y287


Integral membrane protein 2B


ITM2B


3.98


0.51


0.00584


0.00173


nervous system development,negative regulation of …


beta-amyloid binding,protein binding,ATP binding


Golgi membrane,extracellular region,extracellular …


3


6


6


NLLELLINIK.2|FAVETLIC[CAM]S.2|VTFNSALAQK.2|IENIDHL…


SEN / CTL


P26022


Pentraxin-related protein PTX3


PTX3


3.77


1.12


5.33e-9


4.71e-9


response to yeast,inflammatory response,opsonizati…


complement component C1q binding,(1->3)-beta-D-glu…


extracellular region,extracellular space


15


7


7


LTSALDELLQATR.2|ALAAVLEELR.2|SWLPAGC[CAM]ETAILFPMR…


SEN / CTL


P03956


Interstitial collagenase


MMP1


3.72


1.13


3.1e-8


2.43e-8


proteolysis,viral process,extracellular matrix dis…


endopeptidase activity,metalloendopeptidase activi…


extracellular region,proteinaceous extracellular m…


12


6


6


AFQLWSNVTPLTFTK.2|DGFFYFFHGTR.3|SQNPVQPIGPQTPK.2|T…


SEN / CTL


P17096


High mobility group protein HMG-I/HMG-Y


HMGA1


3.59


1.1


0.0235


0.00595


DNA unwinding involved in DNA replication,nucleoso…


transcriptional activator activity, RNA polymerase…


nucleus,nucleoplasm,transcription factor complex,c…


3


9


13


KQPPVSPGTALVGSQKEPSEVPTPK.4|KQPPVSPGTALVGSQKEPSEVP…


SEN / CTL


Q6UVY6


DBH-like monooxygenase protein 1


MOXD1


3.48


1.94


0.0697


0.0157


oxidation-reduction process


copper ion binding,protein binding,oxidoreductase …


endoplasmic reticulum membrane,integral component …


3


2


2


LVLSLPVNVR.2|ELHTC[CAM]DINDK.2


SEN / CTL


P02765


Alpha-2-HS-glycoprotein


AHSG


3.32


3.73


0.0383


0.0093


skeletal system development,ossification,platelet …


endopeptidase inhibitor activity,cysteine-type end…


extracellular region,extracellular space,extracell…


9


15


28


C[CAM]NLLAEK.2|C[CAM]DSSPDSAEDVR.2|C[CAM]DSSPDSAED…


SEN / CTL


P78417


Glutathione S-transferase omega-1


GSTO1


3.25


1.38


0.0000576


0.0000281


glutathione metabolic process,regulation of releas…


glutathione transferase activity,oxidoreductase ac…


cytoplasm,cytosol,extracellular exosome


9


28


41


VPSLVGSFIR.2|MILELFSK.2|M[Oxi]ILELFSK.2|GIRHEVININ…


SEN / CTL


Q15904


V-type proton ATPase subunit S1


ATP6AP1


3.16


1.16


0.0299


0.00746


insulin receptor signaling pathway,ATP hydrolysis …


transporter activity,ATP binding,Rab GTPase bindin…


endosome membrane,integral component of membrane,p…


3


9


11


LGASPLHVDLATLR.3|LGASPLHVDLATLR.2|DVAVVAGGLGR.2|LF…


SEN / CTL


Q99988


Growth/differentiation factor 15


GDF15


3.08


0.59


0.00953


0.00266


signal transduction,transforming growth factor bet…


cytokine activity,transforming growth factor beta …


extracellular region,extracellular space,nucleus,c…


3


7


7


ASLEDLGWADWVLSPR.2|ASFPGPSELHSEDSR.3|RYEDLLTR.2|AA…


SEN / CTL


P04156


Major prion protein


PRNP


2.97


1.37


0.0423


0.0101


negative regulation of protein phosphorylation,cel…


copper ion binding,lamin binding,microtubule bindi…


nucleus,cytoplasm,endoplasmic reticulum,Golgi appa…


3


4


5


VVEQMC[CAM]ITQYER.2|VVEQM[Oxi]C[CAM]ITQYER.2|PIIHF…


SEN / CTL


P20962


Parathymosin


PTMS


2.94


1.39


0.0535


0.0126


immune system process,DNA replication


zinc ion binding


nucleus,cytosol


3


5


8


SVEAAAELSAK.2|AAEEEDEADPKR.3|AAEEEDEADPKR.2|RAAEEE…


SEN / CTL


Q06323


Proteasome activator complex subunit 1


PSME1


2.94


1.76


0.0589


0.0136


MAPK cascade,protein polyubiquitination,stimulator…


endopeptidase activator activity


proteasome complex,nucleoplasm,cytoplasm,cytosol,p…


3


26


39


NAYAVLYDIILK.2|NAYAVLYDIILK.3|IVVLLQR.2|VFELMTSLHT…


SEN / CTL


P30048


Thioredoxin-dependent peroxide reductase, mitochondrial


PRDX3


2.92


1.48


0.0593


0.0136


response to reactive oxygen species,maternal place…


protein binding,protein C-terminus binding,thiored…


cytoplasm,mitochondrion,mitochondrial matrix,early…


3


19


41


GLFIIDPNGVIK.2|HLSVNDLPVGR.3|HLSVNDLPVGR.2|SVEETLR…


SEN / CTL


P07585


Decorin


DCN


2.9


1.29


1.14e-19


3.93e-19


kidney development,placenta development,negative r…


protein kinase inhibitor activity,protein binding,…


extracellular region,collagen type VI trimer,extra…


45


22


33


VSPGAFTPLVKLER.3|ASYSGVSLFSNPVQYWEIQPSTFR.3|KVTFNG…


SEN / CTL


P04632


Calpain small subunit 1


CAPNS1


2.71


0.33


0.00589


0.00173


proteolysis,positive regulation of cell proliferat…


calcium-dependent cysteine-type endopeptidase acti…


cytosol,plasma membrane,membrane,extracellular exo…


3


18


39


THYSNIEANESEEVR.3|THYSNIEANESEEVR.2|LGFEEFK.2|VVTR…


SEN / CTL


Q9UHL4


Dipeptidyl peptidase 2


DPP7


2.71


2.36


0.234


0.0476


proteolysis


serine-type carboxypeptidase activity,serine-type …


lysosome,Golgi apparatus,cytosol,cytoplasmic, memb…


3


18


27


GHTELLTVEQALADFAELLR.3|KLEATIIGEWVK.3|KLEATIIGEWVK…


SEN / CTL


Q9UNW1


Multiple inositol polyphosphate phosphatase 1


MINPP1


2.63


0.66


0.0000716


0.000034


ossification,polyphosphate metabolic process,depho…


acid phosphatase activity,phosphohistidine phospha…


endoplasmic reticulum,endoplasmic reticulum lumen,…


6


12


13


LASLFPALFSR.2|SGLIVPYASNLIFVLYHC[CAM]ENAK.3|DKEPLT…


SEN / CTL


P01033


Metalloproteinase inhibitor 1


TIMP1


2.62


1.29


5e-15


9.5e-15


cell activation,platelet degranulation,aging,posit…


protease binding,cytokine activity,protein binding…


extracellular region,proteinaceous extracellular m…


33


7


11


TYTVGC[CAM]EEC[CAM]TVFPC[CAM]LSIPC[CAM]K.3|LQDGLLH…


SEN / CTL


Q08629


Testican-1


SPOCK1


2.62


0.17


0.00147


0.000501


regulation of cell growth,neuron migration,cell ad…


serine-type endopeptidase inhibitor activity,cyste…


proteinaceous extracellular matrix,extracellular s…


3


2


2


SLLGAFIPR.2|ATQC[CAM]HGSTGQC[CAM]WC[CAM]VDK.3


SEN / CTL


Q9Y646


Carboxypeptidase Q


CPQ


2.54


0.82


0.000366


0.000148


proteolysis,thyroid hormone generation,tissue rege…


carboxypeptidase activity,protein homodimerization…


extracellular space,cytoplasm,lysosome,endoplasmic…


6


10


10


LALLVDTVGPR.2|AIINLAVYGK.2|VHLEPVRIPHWER.4|VGALASL…


SEN / CTL


P39059


Collagen alpha-1(XV) chain


COL15A1


2.52


1.37


7.05e-8


5.1e-8


angiogenesis,cell adhesion,signal transduction,cel…


extracellular matrix structural constituent


extracellular region,collagen type XV trimer,extra…


18


14


24


NLVTAFSNMDDMLQK.2|AFLSSHLQDLSTIVR.3|AFLSSHLQDLSTIV…


SEN / CTL


P23284


Peptidyl-prolyl cis-trans isomerase B


PPIB


2.5


1.54


0.00000254


0.00000148


protein peptidyl-prolyl isomerization,positive reg…


peptidyl-prolyl cis-trans isomerase activity,prote…


nucleus,endoplasmic reticulum,endoplasmic reticulu…


15


28


56


TVDNFVALATGEK.2|TVDNFVALATGEK.3|VLEGMEVVR.2|VLEGM[…


SEN / CTL


P52823


Stanniocalcin-1


STC1


2.49


0.27


0.00386


0.00118


ossification,endothelial cell morphogenesis,growth…


hormone activity


extracellular space,nucleus,cytoplasm,apical plasm…


3


2


3


RNPEAITEVVQLPNHFSNR.3|IGPNMASLFHILQTDHC[CAM]AQTHPR…


SEN / CTL


P07858


Cathepsin B


CTSB


2.47


1.67


5.55e-13


8.79e-13


toll-like receptor signaling pathway,proteolysis,c…


cysteine-type endopeptidase activity,serine-type e…


extracellular region,extracellular space,intracell…


51


22


46


VMFTEDLKLPASFDAR.3|EQWPQC[CAM]PTIK.2|GQDHC[CAM]GIE…


SEN / CTL


P24821


Tenascin


TNC


2.46


1.4


1.5e-22


7.62e-22


osteoblast differentiation,cell adhesion,negative …


syndecan binding


extracellular region,basement membrane,interstitia…


63


77


105


TAHISGLPPSTDFIVYLSGLAPSIR.3|TAHISGLPPSTDFIVYLSGLAP…


SEN / CTL


P09429


High mobility group protein B1


HMGB1


2.46


0.87


0.0333


0.00821


negative regulation of transcription from RNA poly…


four-way junction DNA binding,bubble DNA binding,l…


condensed chromosome,extracellular region,extracel…


3


26


57


RPPSAFFLFC[CAM]SEYRPK.3|RPPSAFFLFC[CAM]SEYRPK.4|RP…


SEN / CTL


Q14766


Latent-transforming growth factor beta-binding protein 1


LTBP1


2.43


1.51


9.2e-7


5.55e-7


ventricular septum development,transmembrane recep…


transforming growth factor beta-activated receptor…


microfibril,extracellular region,proteinaceous ext…


18


35


44


VQEGYTC[CAM]DC[CAM]FDGYHLDTAK.3|MTC[CAM]VDVNEC[CAM…


SEN / CTL


P10619


Lysosomal protective protein


CTSA


2.41


1.89


0.0109


0.003


proteolysis,glycosphingolipid metabolic process,in…


carboxypeptidase activity,serine-type carboxypepti…


nucleoplasm,lysosome,endoplasmic reticulum,membran…


6


15


29


C[CAM]NFYDNKDLEC[CAM]VTNLQEVAR.3|GAGHMVPTDKPLAAFTM…


SEN / CTL


P07339


Cathepsin D


CTSD


2.39


1.33


1.42e-9


1.34e-9


proteolysis,autophagy,antigen processing and prese…


aspartic-type endopeptidase activity,cysteine-type…


extracellular region,extracellular space,lysosome,…


24


30


62


FDGILGMAYPR.2|FDGILGM[Oxi]AYPR.2|QVFGEATKQPGITFIAA…


SEN / CTL


P40261


Nicotinamide N-methyltransferase


NNMT


2.37


0.9


0.000598


0.000229


response to organonitrogen compound,animal organ r…


nicotinamide N-methyltransferase activity,pyridine…


cytosol


6


13


20


NLGSLLKPGGFLVIMDALK.3|NLGSLLKPGGFLVIM[Oxi]DALK.3|N…


SEN / CTL


Q15149


Plectin


PLEC


2.35


1.93


5.4e-22


2.41e-21


hemidesmosome assembly,cell-cell adhesion


actin binding,protein binding,structural constitue…


cytoplasm,cytosol,plasma membrane,brush border,cel…


117


489


728


VLADPSDDTKGFFDPNTHENLTYR.4|IISLETYNLLR.2|SQVEEELFS…


SEN / CTL


Q7Z304


MAM domain-containing protein 2


MAMDC2


2.33


0.37


0.00776


0.00219


proteinaceous extracellular matrix,endoplasmic ret…


3


1


1


AGDHTTGLGYYLLANTK.3


SEN / CTL


Q13443


Disintegrin and metalloproteinase domain-containing protein 9


ADAM9


2.33


1.23


0.0603


0.0138


activation of MAPKK activity,membrane protein ecto…


metalloendopeptidase activity,protein kinase C bin…


extracellular space,focal adhesion,cell surface,in…


3


22


24


QVSYVIQAEGK.2|EGTLITDHPNIQNHC[CAM]HYR.5|EGTLITDHPN…


SEN / CTL


P53621


Coatomer subunit alpha


COPA


2.3


0.67


0.00000113


6.78e-7


intracellular protein transport,ER to Golgi vesicl…


hormone activity,structural molecule activity


Golgi membrane,extracellular space,cytoplasm,endop…


9


92


167


VTTVTEIGKDVIGLR.3|VTTVTEIGKDVIGLR.2|TLDLPIYVTR.2|L…


SEN / CTL


O60814


P06899


P23527


P33778


P57053


P58876


P62807


Q16778


Q5QNW6


Q8N257


Q93079


Q99877


Q99879


Q99880


Histone H2B type 1-K;Histone H2B type 1-J;Histone H2B type 1-O;Histone H2B type 1-B;Histone H2B type F-S;Histone H2B type 1-D;Histone H2B type 1-C/E/F/G/I;Histone H2B type 2-E;Histone H2B type 2-F;Histone H2B type 3-B;Histone H2B type 1-H;Histone H2B type 1-N;Histone H2B type 1-M;Histone H2B type 1-L


HIST1H2BK


HIST1H2BJ


HIST1H2BO


HIST1H2BB


H2BFS


HIST1H2BD


HIST1H2BC


HIST2H2BE


HIST2H2BF


HIST3H2BB


HIST1H2BH


HIST1H2BN


HIST1H2BM


HIST1H2BL


2.3


0.56


0.0153


0.00405


innate immune response in mucosa,nucleosome assemb…


molecular_function,DNA binding,protein heterodimer…


nuclear nucleosome,extracellular space,nucleus,nuc…


3


1


8


AMGIMNSFVNDIFER.2|AM[Oxi]GIMNSFVNDIFER.3|AMGIM[Oxi…


SEN / CTL


Q96AY3


Peptidyl-prolyl cis-trans isomerase FKBP10


FKBP10


2.28


1.06


0.00000836


0.00000454


protein peptidyl-prolyl isomerization,chaperone-me…


peptidyl-prolyl cis-trans isomerase activity,calci…


endoplasmic reticulum lumen,endoplasmic reticulum …


12


34


53


IIIPPFLAYGEK.2|GMDQGLLGMC[CAM]PGER.2|GM[Oxi]DQGLLG…


SEN / CTL


P22392


Nucleoside diphosphate kinase B


NME2


2.28


0.67


0.000179


0.0000792


negative regulation of myeloid leukocyte different…


DNA binding,transcription factor activity, sequenc…


ruffle,nucleus,cytoplasm,cytosol,intermediate fila…


6


19


36


SAEKEISLWFKPEELVDYK.4|SAEKEISLWFKPEELVDYK.3|SAEKEI…


SEN / CTL


Q15113


Procollagen C-endopeptidase enhancer 1


PCOLCE


2.26


1.64


0.000396


0.000158


proteolysis,multicellular organism development,pos…


protein binding,collagen binding,heparin binding,p…


extracellular space,extracellular exosome,extracel…


9


9


10


YDALEVFAGSGTSGQR.2|TGGLDLPSPPTGASLK.2|FDLEPDTYC[CA…


SEN / CTL


O60506


Heterogeneous nuclear ribonucleoprotein Q


SYNCRIP


2.24


0.51


0.0136


0.00367


mRNA splicing, via spliceosome,osteoblast differen…


nucleotide binding,RNA binding,poly(A) binding,pol…


nucleus,nucleoplasm,endoplasmic reticulum,membrane…


3


48


77


LMMDPLTGLNR.2|LM[Oxi]MDPLTGLNR.2|LMM[Oxi]DPLTGLNR….


SEN / CTL


Q7Z7M9


Polypeptide N-acetylgalactosaminyltransferase 5


GALNT5


2.24


1.52


0.0585


0.0135


glycosaminoglycan biosynthetic process,O-glycan pr…


polypeptide N-acetylgalactosaminyltransferase acti…


Golgi membrane,cellular_component,integral compone…


3


4


4


C[CAM]PVMAGGLFSIDK.2|VEVDLDQTQR.2|EILLVDDFSTK.2|EG…


SEN / CTL


O00391


Sulfhydryl oxidase 1


QSOX1


2.23


1.07


4.34e-24


2.75e-23


platelet degranulation,negative regulation of macr…


protein disulfide isomerase activity,flavin-linked…


extracellular region,extracellular space,Golgi app…


60


23


29


KFGVTDFPSC[CAM]YLLFR.3|SFYTAYLQR.2|SALYSPSDPLTLLQA…


SEN / CTL


P62310


U6 snRNA-associated Sm-like protein LSm3


LSM3


2.23


1.76


0.105


0.0229


mRNA splicing, via spliceosome,mRNA processing,cyt…


RNA binding,protein binding,poly(A) RNA binding


cytoplasmic mRNA processing body,nucleus,nucleopla…


3


4


4


GDGVVLVAPPLRVG.2|NIPMLFVR.2|RNIPMLFVR.2|GDGVVLVAPP…


SEN / CTL


P49721


Proteasome subunit beta type-2


PSMB2


2.22


0.49


0.0111


0.00305


MAPK cascade,protein polyubiquitination,stimulator…


threonine-type endopeptidase activity


proteasome complex,nucleus,nucleoplasm,cytosol,pro…


3


21


33


FILNLPTFSVR.2|AVELLRK.2|VAASNIVQMKDDHDK.4|VAASNIVQ…


SEN / CTL


P17405


Sphingomyelin phosphodiesterase


SMPD1


2.22


0.74


0.0225


0.00572


sphingomyelin metabolic process,sphingomyelin cata…


sphingomyelin phosphodiesterase activity,zinc ion …


extracellular space,lysosome,endosome,plasma membr…


3


8


10


IGGFYALSPYPGLR.2|GHPPSEPC[CAM]GTPC[CAM]R.3|GHPPSEP…


SEN / CTL


P17931


Galectin-3


LGALS3


2.2


0.84


0.00284


0.000897


monocyte chemotaxis,mRNA processing,RNA splicing,n…


protein binding,IgE binding,carbohydrate binding,c…


immunological synapse,extracellular space,nucleus,…


6


12


19


MLITILGTVKPNANR.3|M[Oxi]LITILGTVKPNANR.3|GNDVAFHFN…


SEN / CTL


Q16363


Laminin subunit alpha-4


LAMA4


2.19


1.46


8.71e-21


3.48e-20


cell adhesion,regulation of cell adhesion,extracel…


receptor binding,extracellular matrix structural c…


extracellular region,basement membrane,basal lamin…


63


42


51


SLLSDVEELVEKENQASR.3|C[CAM]LDGYIGDSIR.2|ELVDEEADEA…


SEN / CTL


O43399


Tumor protein D54


TPD52L2


2.18


0.53


0.0147


0.00391


poly(A) RNA binding


3


18


28


TPAVEGLTEAEEEELRAELTKVEEEIVTLR.4|TPAVEGLTEAEEEELRA…


SEN / CTL


Q13822


Ectonucleotide pyrophosphatase/phosphodiesterase family member 2


ENPP2


2.17


0.96


0.0000784


0.0000368


phosphate-containing compound metabolic process,re…


nucleic acid binding,phosphodiesterase I activity,…


extracellular space,plasma membrane,integral compo…


9


5


5


WWGGQPLWITATK.2|AGTFFWSVVIPHER.3|TYLHTYESEI.2|YGPF…


SEN / CTL


Q15582


Transforming growth factor-beta-induced protein ig-h3


TGFBI


2.13


1.99


3.05e-27


2.58e-26


angiogenesis,chondrocyte differentiation,cell adhe…


integrin binding,protein binding,collagen binding,…


extracellular region,proteinaceous extracellular m…


105


38


60


EGVYTVFAPTNEAFR.2|GC[CAM]PAALPLSNLYETLGVVGSTTTQLYT…


SEN / CTL


P61769


Beta-2-microglobulin


B2M


2.12


1.07


0.0000714


0.000034


retina homeostasis,positive regulation of T cell m…


glycoprotein binding,protein binding,identical pro…


Golgi membrane,extracellular region,extracellular …


12


7


9


SNFLNC[CAM]YVSGFHPSDIEVDLLK.3|SNFLNC[CAM]YVSGFHPSD…


SEN / CTL


P15121


Aldose reductase


AKR1B1


2.11


0.83


0.00142


0.000491


tissue homeostasis,carbohydrate metabolic process,…


alditol:NADP+ 1-oxidoreductase activity,aldo-keto …


extracellular space,nucleoplasm,cytoplasm,cytosol,…


6


26


42


VAIDVGYR.2|MPILGLGTWK.2|M[Oxi]PILGLGTWK.2|LLLNNGAK…


SEN / CTL


P00736


Complement C1r subcomponent


C1R


2.1


1.41


5.1e-13


8.24e-13


proteolysis,immune response,complement activation,…


serine-type endopeptidase activity,calcium ion bin…


extracellular region,extracellular exosome,blood m…


48


25


35


TLDEFTIIQNLQPQYQFR.3|LVFQQFDLEPSEGC[CAM]FYDYVK.3|Q…


SEN / CTL


P22692


Insulin-like growth factor-binding protein 4


IGFBP4


2.1


0.92


1.55e-7


1.04e-7


skeletal system development,regulation of cell gro…


receptor binding,insulin-like growth factor I bind…


extracellular region,extracellular space


15


3


5


THEDLYIIPIPNC[CAM]DR.3|THEDLYIIPIPNC[CAM]DR.2|GELD…


SEN / CTL


P80723


Brain acid soluble protein 1


BASP1


2.1


0.58


0.0202


0.00516


thorax and anterior abdomen determination,gonad de…


transcription corepressor activity,protein binding…


nucleus,cytoplasm,cytoskeleton,plasma membrane,nuc…


3


28


41


AQGPAASAEEPKPVEAPAANSDQTVTVKE.3|AQGPAASAEEPKPVEAPA…


SEN / CTL


P07237


Protein disulfide-isomerase


P4HB


2.09


1.13


2.47e-17


5.88e-17


response to reactive oxygen species,peptidyl-proli…


protein disulfide isomerase activity,integrin bind…


extracellular region,endoplasmic reticulum,endopla…


54


62


113


EADDIVNWLK.2|ILEFFGLK.2|LITLEEEMTK.2|LITLEEEM[Oxi]…


SEN / CTL


P05155


Plasma protease C1 inhibitor


SERPING1


2.09


1.29


5.86e-11


6.95e-11


negative regulation of complement activation, lect…


serine-type endopeptidase inhibitor activity,prote…


extracellular region,extracellular space,platelet …


33


19


34


FQPTLLTLPR.2|LVLLNAIYLSAK.2|IKVTTSQDMLSIMEK.3|LLDS…


SEN / CTL


P07093


Glia-derived nexin


SERPINE2


2.09


1.6


2.12e-10


2.27e-10


blood coagulation,negative regulation of cell prol…


serine-type endopeptidase inhibitor activity,recep…


extracellular region,extracellular space,cytosol,e…


27


11


14


ASAATTAILIAR.2|SYQVPMLAQLSVFR.2|DMIDNLLSPDLIDGVLTR…


SEN / CTL


Q12907


Vesicular integral-membrane protein VIP36


LMAN2


2.09


2.22


0.147


0.0311


ER to Golgi vesicle-mediated transport,retrograde …


glycoprotein binding,mannose binding,carbohydrate …


Golgi membrane,extracellular space,endoplasmic ret…


3


21


31


NLHGDGIALWYTR.3|NLHGDGIALWYTR.2|DRLVPGPVFGSK.3|DRL…


SEN / CTL


P80303


Nucleobindin-2


NUCB2


2.08


1.3


7.85e-8


5.63e-8


DNA binding,calcium ion binding


extracellular space,nuclear envelope,endoplasmic r…


21


26


37


LVTLEEFLK.2|LHDVNSDGFLDEQELEALFTK.3|VYDPKNEEDDMVEM…


SEN / CTL


O75828


P16152


Carbonyl reductase [NADPH] 3;Carbonyl reductase [NADPH] 1


CBR3


CBR1


2.08


0.12


0.00123


0.000432


phylloquinone catabolic process,cognition,oxidatio…


3-keto sterol reductase activity,carbonyl reductas…


extracellular space,nucleoplasm,cytoplasm,cytosol;…


3


1


2


FHQLDIDDLQSIR.3|FHQLDIDDLQSIR.2


SEN / CTL


P61604


10 kDa heat shock protein, mitochondrial


HSPE1


2.07


1.21


0.00218


0.000706


osteoblast differentiation,protein folding,activat…


protein binding,ATP binding,poly(A) RNA binding,me…


mitochondrion,mitochondrial matrix,membrane,extrac…


6


19


27


FLPLFDR.2|VLQATVVAVGSGSK.2|VLQATVVAVGSGSK.3|GKGGEI…


SEN / CTL


P12111


Collagen alpha-3(VI) chain


COL6A3


2.06


1.38


7.15e-86


5.43e-84


cell adhesion,muscle organ development,negative re…


serine-type endopeptidase inhibitor activity


extracellular region,proteinaceous extracellular m…


342


165


233


ALILVGLER.2|LSDAGITPLFLTR.2|LLPSFVSSENAFYLSPDIR.3|…


SEN / CTL


P09871


Complement C1s subcomponent


C1S


2.06


1.32


7.03e-14


1.24e-13


proteolysis,complement activation,complement activ…


serine-type endopeptidase activity,calcium ion bin…


extracellular region,extracellular exosome,blood m…


48


26


38


TNFDNDIALVR.2|MGPTVSPIC[CAM]LPGTSSDYNLMDGDLGLISGWG…


SEN / CTL


Q15084


Protein disulfide-isomerase A6


PDIA6


2.06


1.35


5.06e-11


6.31e-11


protein folding,response to endoplasmic reticulum …


protein disulfide isomerase activity,protein bindi…


endoplasmic reticulum,endoplasmic reticulum lumen,…


27


32


56


TGEAIVDAALSALR.2|TGEAIVDAALSALR.3|ALDLFSDNAPPPELLE…


SEN / CTL


Q9Y2E5


Epididymis-specific alpha-mannosidase


MAN2B2


2.06


1.36


0.000916


0.000336


mannose metabolic process,protein deglycosylation,…


alpha-mannosidase activity,zinc ion binding,mannan…


lysosomal lumen,extracellular exosome


9


15


22


FIAVEQEFFR.2|GHLDPTWALQQLQQLR.3|GHLDPTWALQQLQQLR.2…


SEN / CTL


P15586


N-acetylglucosamine-6-sulfatase


GNS


2.06


0.12


0.00109


0.000387


glycosaminoglycan catabolic process,keratan sulfat…


N-acetylglucosamine-6-sulfatase activity,sulfuric …


lysosomal lumen,extracellular exosome


3


18


33


IQEPNTFPAILR.2|RQLYEFDIK.3|RQLYEFDIK.2|TIDPELLGK.2…


SEN / CTL


P00558


Phosphoglycerate kinase 1


PGK1


2.05


1.11


4.83e-23


2.62e-22


gluconeogenesis,phosphorylation,epithelial cell di…


phosphoglycerate kinase activity,ATP binding


cytosol,membrane,membrane raft,extracellular exoso…


66


59


126


AC[CAM]ANPAAGSVILLENLR.2|AC[CAM]ANPAAGSVILLENLR.3|…


SEN / CTL


P14550


Alcohol dehydrogenase [NADP(+)]


AKR1A1


2.05


0.9


0.00193


0.000633


glucose metabolic process,cellular aldehyde metabo…


alditol:NADP+ 1-oxidoreductase activity,aldo-keto …


extracellular space,cytosol,apical plasma membrane…


6


26


45


MPLIGLGTWK.2|M[Oxi]PLIGLGTWK.2|GLEVTAYSPLGSSDR.2|G…


SEN / CTL


Q16610


Extracellular matrix protein 1


ECM1


2.04


0.99


1.04e-16


2.32e-16


ossification,angiogenesis,positive regulation of e…


protease binding,signal transducer activity,interl…


extracellular region,proteinaceous extracellular m…


42


22


28


ELLALIQLER.2|RAPYPNYDRDILTIDIGR.4|LVWEEAMSR.2|AC[C…


SEN / CTL


P30044


Peroxiredoxin-5, mitochondrial


PRDX5


2.04


0.72


0.000685


0.000259


response to reactive oxygen species,apoptotic proc…


RNA polymerase III regulatory region DNA binding,p…


extracellular space,nucleus,cytoplasm,mitochondrio…


6


19


35


FSMVVQDGIVK.2|FSM[Oxi]VVQDGIVK.2|THLPGFVEQAEALK.3|…


SEN / CTL


P06576


ATP synthase subunit beta, mitochondrial


ATP5B


2.03


1.3


9.19e-8


6.52e-8


angiogenesis,osteoblast differentiation,generation…


transporter activity,protein binding,ATP binding,t…


nucleus,mitochondrion,mitochondrial proton-transpo…


21


47


115


AHGGYSVFAGVGER.3|AHGGYSVFAGVGER.2|IGLFGGAGVGK.2|FT…


SEN / CTL


P12109


Collagen alpha-1(VI) chain


COL6A1


2.01


1.35


1.27e-16


2.77e-16


osteoblast differentiation,cell adhesion,extracell…


platelet-derived growth factor binding


extracellular region,collagen type VI trimer,lysos…


63


49


69


LLLFSDGNSQGATPAAIEK.2|LLLFSDGNSQGATPAAIEK.3|IALVIT…


SEN / CTL


P68104


Elongation factor 1-alpha 1


EEF1A1


2


1.49


9.16e-11


1.02e-10


transcription, DNA-templated,regulation of transcr…


tRNA binding,translation elongation factor activit…


extracellular space,nucleus,nucleolus,cytoplasm,cy…


42


52


144


EHALLAYTLGVK.3|EHALLAYTLGVK.2|IGGIGTVPVGR.2|YYVTII…


SEN / CTL


P55058


Phospholipid transfer protein


PLTP


2


2.42


0.00251


0.0008


lipid metabolic process,lipid transport,vitamin E …


lipid binding


extracellular region,extracellular space


12


6


7


FLEQELETITIPDLR.2|FLEQELETITIPDLR.3|GVQIPLPEGINFVH…


SEN / CTL


P11047


Laminin subunit gamma-1


LAMC1


1.99


0.9


1.51e-35


1.86e-34


protein complex assembly,cell adhesion,endoderm de…


extracellular matrix structural constituent


extracellular region,basement membrane,laminin-1 c…


81


77


97


SQEC[CAM]YFDPELYR.2|TREDGPWIPYQYYSGSC[CAM]ENTYSK.3…


SEN / CTL


P51884


Lumican


LUM


1.99


1.42


1.4e-23


8.21e-23


visual perception,response to organic cyclic compo…


extracellular matrix structural constituent,collag…


extracellular region,proteinaceous extracellular m…


69


21


29


SLEYLDLSFNQIAR.2|SLEYLDLSFNQIAR.3|FNALQYLR.2|LPSGL…


SEN / CTL


P01034


Cystatin-C


CST3


1.99


0.6


1.13e-10


1.24e-10


eye development,response to hypoxia,cell activatio…


beta-amyloid binding,protease binding,endopeptidas…


extracellular region,basement membrane,extracellul…


18


7


11


ALDFAVGEYNK.2|KQIVAGVNYFLDVELGR.3|AFC[CAM]SFQIYAVP…


SEN / CTL


Q9NR99


Matrix-remodeling-associated protein 5


MXRA5


1.99


1


0.0468


0.0111


biological_process


molecular_function


extracellular exosome


3


3


3


C[CAM]VASNAAGADSLAIR.2|HSEKEPETNVAEGR.3|VLVQSPSTQP…


SEN / CTL


O00151


PDZ and LIM domain protein 1


PDLIM1


1.97


1.39


0.0000155


0.00000789


response to hypoxia,regulation of transcription, D…


transcription coactivator activity,zinc ion bindin…


transcription factor complex,cytoplasm,cytoskeleto…


15


27


50


GHFFVEDQIYC[CAM]EK.3|GHFFVEDQIYC[CAM]EK.2|IKGC[CAM…


SEN / CTL


P51888


Prolargin


PRELP


1.97


1.49


0.000313


0.000128


skeletal system development,cell aging,keratan sul…


extracellular matrix structural constituent,hepari…


extracellular region,proteinaceous extracellular m…


9


19


26


VLEKLPGLVFLYMEK.3|LDGNYLKPPIPLDLMMC[CAM]FR.3|LENLL…


SEN / CTL


P49588


Alanine–tRNA ligase, cytoplasmic


AARS


1.97


0.52


0.0205


0.00522


hair follicle development,tRNA modification,tRNA a…


tRNA binding,aminoacyl-tRNA editing activity,alani…


cytoplasm,cytosol,membrane,extracellular exosome,m…


3


62


112


NVGC[CAM]LQEALQLATSFAQLR.3|NVGC[CAM]LQEALQLATSFAQL…


SEN / CTL


Q9NWM8


Peptidyl-prolyl cis-trans isomerase FKBP14


FKBP14


1.97


0.92


0.0438


0.0104


protein peptidyl-prolyl isomerization,IRE1-mediate…


peptidyl-prolyl cis-trans isomerase activity,calci…


endoplasmic reticulum lumen,endoplasmic reticulum …


3


8


10


GKIPPESTLIFNIDLLEIR.3|HNNGQPIWFTLGILEALK.4|HNNGQPI…


SEN / CTL


Q9Y6C2


EMILIN-1


EMILIN1


1.96


1.22


8.1e-11


9.47e-11


cell adhesion


protein binding,extracellular matrix constituent c…


extracellular region,proteinaceous extracellular m…


27


36


48


VLLNDGGYYDPETGVFTAPLAGR.3|FRGLEEGQAQAGQC[CAM]PSLEG…


SEN / CTL


P55268


Laminin subunit beta-2


LAMB2


1.96


1.08


3.63e-10


3.72e-10


cell adhesion,axon guidance,neuromuscular junction…


integrin binding,structural molecule activity


extracellular region,basement membrane,basal lamin…


24


53


60


SLADVDAILAR.2|GAVADTRDTEQTLYQVQER.3|TGGSAQPETPYSGP…


SEN / CTL


Q01995


Transgelin


TAGLN


1.96


1.46


2.07e-8


1.71e-8


muscle organ development,epithelial cell different…


actin binding


cytoplasm


33


24


41


LGFQVWLK.2|QMEQVAQFLK.2|QM[Oxi]EQVAQFLK.2|TDMFQTVD…


SEN / CTL


Q9NZN4


EH domain-containing protein 2


EHD2


1.96


0.86


0.0548


0.0128


endocytosis,blood coagulation,cortical actin cytos…


nucleic acid binding,calcium ion binding,protein b…


nucleus,cytosol,plasma membrane,caveola,endosome m…


3


30


46


SKYDEIFYNLAPADGK.3|SKYDEIFYNLAPADGK.2|DIQGLPR.2|VH…


SEN / CTL


Q02818


Nucleobindin-1


NUCB1


1.95


1.24


8.51e-22


3.59e-21


response to cisplatin,regulation of protein target…


G-protein alpha-subunit binding,DNA binding,calciu…


extracellular space,nucleus,early endosome,rough e…


66


33


46


DLELLIQTATR.2|ELQQAVLHMEQR.3|ELQQAVLHMEQR.2|LLERLP…


SEN / CTL


P98095


Fibulin-2


FBLN2


1.94


0.6


8.08e-10


7.87e-10


positive regulation of cell-substrate adhesion


extracellular matrix structural constituent,calciu…


extracellular region,proteinaceous extracellular m…


15


7


8


ITHYQLNFQTGLLVPAHIFR.4|RLNAYTGVVYLQR.3|IGPAPAFTGDT…


SEN / CTL


P37837


Transaldolase


TALDO1


1.94


0.43


0.0135


0.00367


carbohydrate metabolic process,xylulose biosynthet…


sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosp…


nucleus,cytoplasm,cytosol,extracellular exosome


3


31


43


ALAGC[CAM]DFLTISPK.2|ALAGC[CAM]DFLTISPK.3|KLGGSQED…


SEN / CTL


O75882


Attractin


ATRN


1.94


0.9


0.05


0.0118


inflammatory response,response to oxidative stress…


receptor activity,carbohydrate binding


extracellular space,cytoplasm,plasma membrane,inte…


3


29


41


LTLTPWVGLR.2|EQYAVVGHSAHIVTLK.4|EQYAVVGHSAHIVTLK.3…


SEN / CTL


P17900


Ganglioside GM2 activator


GM2A


1.93


1.85


0.00192


0.000632


glycosphingolipid metabolic process,ganglioside ca…


lipid transporter activity,phospholipase activator…


mitochondrion,hydrogen:potassium-exchanging ATPase…


9


10


12


SEFVVPDLELPSWLTTGNYR.3|SEFVVPDLELPSWLTTGNYR.2|IPC[…


SEN / CTL


P08253


72 kDa type IV collagenase


MMP2


1.93


0.5


0.0194


0.00497


angiogenesis,response to hypoxia,blood vessel matu…


metalloendopeptidase activity,serine-type endopept…


extracellular region,proteinaceous extracellular m…


3


2


2


IIGYTPDLDPETVDDAFAR.2|IDAVYEAPQEEK.2


SEN / CTL


P16070


CD44 antigen


CD44


1.92


0.48


0.00000262


0.00000151


cell-matrix adhesion,single organismal cell-cell a…


collagen binding,hyaluronic acid binding,cytokine …


cytoplasm,Golgi apparatus,plasma membrane,integral…


9


12


18


YGFIEGHVVIPR.3|YGFIEGHVVIPR.2|ALSIGFETC[CAM]R.2|SQ…


SEN / CTL


P04406


Glyceraldehyde-3-phosphate dehydrogenase


GAPDH


1.91


1.18


6.91e-20


2.5e-19


microtubule cytoskeleton organization,gluconeogene…


glyceraldehyde-3-phosphate dehydrogenase (NAD+) (p…


nucleus,cytoplasm,lipid particle,cytosol,plasma me…


72


51


166


VPTANVSVVDLTC[CAM]R.2|VPTANVSVVDLTC[CAM]R.3|IISNAS…


SEN / CTL


P09382


Galectin-1


LGALS1


1.91


1.51


3.75e-13


6.33e-13


plasma cell differentiation,apoptotic process,sign…


glycoprotein binding,signal transducer activity,pr…


proteinaceous extracellular matrix,extracellular s…


48


17


33


SFVLNLGKDSNNLC[CAM]LHFNPR.4|SFVLNLGKDSNNLC[CAM]LHF…


SEN / CTL


P23142


Fibulin-1


FBLN1


1.9


1.48


1.65e-17


4.18e-17


negative regulation of protein phosphorylation,neg…


fibronectin binding,extracellular matrix structura…


extracellular region,proteinaceous extracellular m…


66


25


36


EFTRPEEIIFLR.3|EFTRPEEIIFLR.2|RGYQLSDVDGVTC[CAM]ED…


SEN / CTL


P31946


14-3-3 protein beta/alpha


YWHAB


1.9


1.22


0.00000998


0.0000053


MAPK cascade,protein targeting,viral process,negat…


transcription corepressor activity,protein binding…


nucleus,cytoplasm,mitochondrion,cytosol,cell-cell …


15


37


87


NLLSVAYK.2|NLLSVAYK.1|LAEQAERYDDMAAAMK.3|LAEQAERYD…


SEN / CTL


O75347


Tubulin-specific chaperone A


TBCA


1.9


1.33


0.0000482


0.0000238


protein folding,tubulin complex assembly,post-chap…


poly(A) RNA binding,beta-tubulin binding,chaperone…


nucleolus,cytoplasm,microtubule,microtubule cytosk…


12


14


23


ILENEKDLEEAEEYKEAR.4|ILENEKDLEEAEEYKEAR.3|RLEAAYLD…


SEN / CTL


P14174


Macrophage migration inhibitory factor


MIF


1.89


0.6


1.56e-11


2.08e-11


prostaglandin biosynthetic process,negative regula…


dopachrome isomerase activity,receptor binding,cyt…


extracellular region,extracellular space,nucleopla…


21


10


22


LLC[CAM]GLLAER.2|ASVPDGFLSELTQQLAQATGKPPQYIAVHVVPD…


SEN / CTL


P14314


Glucosidase 2 subunit beta


PRKCSH


1.89


0.54


7.82e-7


4.79e-7


protein folding,N-glycan processing,intracellular …


protein kinase C binding,calcium ion binding,ion c…


intracellular,endoplasmic reticulum,endoplasmic re…


9


34


64


SLEDQVEMLR.2|SLEDQVEM[Oxi]LR.2|ESLQQMAEVTR.2|ESLQQ…


SEN / CTL


Q02809


Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1


PLOD1


1.88


1.03


3.06e-32


2.91e-31


response to hypoxia,cellular protein modification …


iron ion binding,procollagen-lysine 5-dioxygenase …


endoplasmic reticulum membrane,rough endoplasmic r…


99


37


56


SEDYVDIVQGR.2|FWTFETGC[CAM]TVC[CAM]DEGLR.2|FLLEYIA…


SEN / CTL


P24592


Insulin-like growth factor-binding protein 6


IGFBP6


1.88


0.34


1.05e-7


7.37e-8


regulation of cell growth,signal transduction,nega…


receptor binding,insulin-like growth factor I bind…


extracellular region,extracellular space,Golgi app…


9


4


4


HLDSVLQQLQTEVYR.3|EGQEC[CAM]GVYTPNC[CAM]APGLQC[CAM…


SEN / CTL


P31949


Protein S100-A11


S100A11


1.88


1.18


0.000301


0.000124


signal transduction,negative regulation of DNA rep…


calcium ion binding,protein homodimerization activ…


ruffle,extracellular space,nucleus,cytoplasm,cell-…


12


8


13


TEFLSFMNTELAAFTK.2|TEFLSFMNTELAAFTK.3|TEFLSFM[Oxi]…


SEN / CTL


Q969H8


Myeloid-derived growth factor


MYDGF


1.88


2.3


0.179


0.0375


angiogenesis,positive regulation of protein phosph…


protein binding


extracellular space,endoplasmic reticulum lumen,en…


3


8


13


SYLYFTQFK.2|PGGVVHSFSHNVGPGDK.4|PGGVVHSFSHNVGPGDK….


SEN / CTL


Q9UBX5


Fibulin-5


FBLN5


1.87


0.92


2.25e-7


1.48e-7


regulation of cell growth,cell-matrix adhesion,ext…


integrin binding,calcium ion binding,protein bindi…


extracellular region,proteinaceous extracellular m…


15


9


10


YPGAYYIFQIK.2|SVPADIFQMQATTR.2|DQPFTILYR.2|IYVSQYP…


SEN / CTL


P26447


Protein S100-A4


S100A4


1.87


1.06


0.00638


0.00185


epithelial to mesenchymal transition,positive regu…


actin binding,calcium ion binding,protein binding,…


extracellular space,nucleus,neuron projection,peri…


6


6


10


ALDVMVSTFHK.3|ALDVMVSTFHK.2|ALDVM[Oxi]VSTFHK.3|ALD…


SEN / CTL


Q08431


Lactadherin


MFGE8


1.86


1.3


1.53e-8


1.29e-8


angiogenesis,phagocytosis, recognition,phagocytosi…


phosphatidylserine binding,integrin binding,phosph…


extracellular region,extracellular space,external …


27


15


19


VTFLGLQHWVPELAR.3|VTFLGLQHWVPELAR.2|TWGLHLFSWNPSYA…


SEN / CTL


P34096


Ribonuclease 4


RNASE4


1.86


0.24


0.00534


0.00159


mRNA cleavage,RNA phosphodiester bond hydrolysis, …


nucleic acid binding,endonuclease activity,ribonuc…


extracellular region,extracellular exosome


3


5


6


RVVIAC[CAM]EGNPQVPVHFDG.3|RFNTFIHEDIWNIR.4|RFNTFIH…


SEN / CTL


P35579


Myosin-9


MYH9


1.85


1.2


1.89e-50


2.87e-49


meiotic spindle organization,cytokinesis,angiogene…


microfilament motor activity,motor activity,actin …


stress fiber,ruffle,uropod,nucleus,cytoplasm,spind…


186


243


483


ALELDSNLYR.2|TRLQQELDDLLVDLDHQR.4|TRLQQELDDLLVDLDH…


SEN / CTL


P07910


Heterogeneous nuclear ribonucleoproteins C1/C2


HNRNPC


1.84


1.24


0.00319


0.000993


mRNA splicing, via spliceosome,osteoblast differen…


nucleotide binding,RNA polymerase II core promoter…


nuclear chromatin,nucleus,nucleoplasm,spliceosomal…


6


30


47


GFAFVQYVNER.2|GFAFVQYVNER.3|VFIGNLNTLVVK.2|VFIGNLN…


SEN / CTL


P16949


Stathmin


STMN1


1.84


1.45


0.112


0.0242


mitotic cytokinesis,microtubule depolymerization,m…


signal transducer activity,tubulin binding


intracellular,cytoplasm,cytosol,microtubule,membra…


3


18


24


ASGQAFELILSPR.2|ASGQAFELILSPR.3|DLSLEEIQKK.3|DLSLE…


SEN / CTL


Q99439


Calponin-2


CNN2


1.83


0.52


1.03e-9


9.91e-10


cytoskeleton organization,actomyosin structure org…


actin binding,calmodulin binding,cadherin binding …


stress fiber,cytoskeleton,cell-cell junction,cell-…


15


17


33


TWIEGLTGLSIGPDFQK.2|TWIEGLTGLSIGPDFQK.3|GLKDGTILC[…


SEN / CTL


Q9Y2B0


Protein canopy homolog 2


CNPY2


1.82


0.62


0.00013


0.000059


enzyme linked receptor protein signaling pathway,t…


protein binding


endoplasmic reticulum,integral component of plasma…


6


15


27


SEAHLTELLEEIC[CAM]DR.3|SEAHLTELLEEIC[CAM]DR.2|INPD…


SEN / CTL


P15291


Beta-1,4-galactosyltransferase 1


B4GALT1


1.82


1.06


0.00026


0.00011


epithelial cell development,acute inflammatory res…


beta-N-acetylglucosaminylglycopeptide beta-1,4-gal…


Golgi trans cisterna,Golgi membrane,extracellular …


9


7


9


QQLDYGIYVINQAGDTIFNR.3|VAIIIPFR.2|ETMLSDGLNSLTYQVL…


SEN / CTL


P28066


Proteasome subunit alpha type-5


PSMA5


1.82


0.42


0.0178


0.00465


MAPK cascade,protein polyubiquitination,stimulator…


threonine-type endopeptidase activity,protein bind…


proteasome complex,nucleus,nucleoplasm,cytoplasm,c…


3


17


34


LFQVEYAIEAIK.2|LFQVEYAIEAIK.3|PFGVALLFGGVDEK.3|PFG…


SEN / CTL


Q8IUX7


Adipocyte enhancer-binding protein 1


AEBP1


1.8


1.03


1.34e-8


1.15e-8


negative regulation of transcription from RNA poly…


RNA polymerase II regulatory region sequence-speci…


extracellular space,nucleus,cytoplasm,extracellula…


18


9


11


YLSPDATVSTEVR.2|YTAGIHGNEVLGR.3|YTAGIHGNEVLGR.2|NP…


SEN / CTL


Q08380


Galectin-3-binding protein


LGALS3BP


1.79


0.85


2.39e-17


5.86e-17


platelet degranulation,receptor-mediated endocytos…


scavenger receptor activity


extracellular region,proteinaceous extracellular m…


42


23


30


SDLAVPSELALLK.2|IYTSPTWSAFVTDSSWSAR.3|IYTSPTWSAFVT…


SEN / CTL


P30101


Protein disulfide-isomerase A3


PDIA3


1.79


1.19


6.1e-12


8.75e-12


antigen processing and presentation of peptide ant…


protein disulfide isomerase activity,cysteine-type…


nucleus,endoplasmic reticulum,endoplasmic reticulu…


33


62


120


ELSDFISYLQR.2|ELSDFISYLQR.3|FISDKDASIVGFFDDSFSEAHS…


SEN / CTL


O15145


Actin-related protein 2/3 complex subunit 3


ARPC3


1.79


0.14


0.00192


0.000632


movement of cell or subcellular component,Arp2/3 c…


structural constituent of cytoskeleton,protein bin…


cytosol,Arp2/3 protein complex,focal adhesion,acti…


3


16


27


LIGNMALLPIR.2|LIGNMALLPIR.3|LIGNM[Oxi]ALLPIR.2|NYE…


SEN / CTL


P11021


78 kDa glucose-regulated protein


HSPA5


1.78


1.21


2.13e-18


5.79e-18


ER overload response,activation of signaling prote…


glycoprotein binding,calcium ion binding,protein b…


nucleus,mitochondrion,endoplasmic reticulum,endopl…


54


68


133


IINEPTAAAIAYGLDKR.3|IINEPTAAAIAYGLDKR.2|TKPYIQVDIG…


SEN / CTL


P06748


Nucleophosmin


NPM1


1.77


0.78


1.12e-7


7.79e-8


DNA repair,nucleosome assembly,intracellular prote…


DNA binding,transcription coactivator activity,RNA…


nucleus,nucleoplasm,nucleolus,cytoplasm,centrosome…


15


26


61


MSVQPTVSLGGFEITPPVVLR.3|MSVQPTVSLGGFEITPPVVLR.2|M[…


SEN / CTL


Q14393


Growth arrest-specific protein 6


GAS6


1.75


0.76


1.86e-8


1.56e-8


neuron migration,positive regulation of protein ph…


phosphatidylserine binding,receptor binding,voltag…


extracellular region,extracellular space,cytoplasm…


15


11


13


SPVLTFAGGLPDVPVTSAPVTAFYR.3|TC[CAM]QDIDEC[CAM]ADSE…


SEN / CTL


P46940


Ras GTPase-activating-like protein IQGAP1


IQGAP1


1.75


0.96


0.000161


0.0000717


regulation of cytokine production,signal transduct…


GTPase inhibitor activity,GTPase activator activit…


ruffle,nucleus,cytoplasm,cytosol,microtubule,actin…


9


128


200


EQLWLANEGLITR.2|EQLWLANEGLITR.3|NKYQELINDIAR.3|NKY…


SEN / CTL


P61916


Epididymal secretory protein E1


NPC2


1.75


1.04


0.000554


0.000214


cholesterol metabolic process,response to virus,ph…


protein binding,cholesterol binding,enzyme binding


lysosome,endoplasmic reticulum,extracellular exoso…


9


12


19


DC[CAM]GSVDGVIKEVNVSPC[CAM]PTQPC[CAM]QLSK.3|AVVHGI…


SEN / CTL


Q15262


Receptor-type tyrosine-protein phosphatase kappa


PTPRK


1.73


0.07


2.84e-8


2.26e-8


protein dephosphorylation,cell adhesion,signal tra…


protein tyrosine phosphatase activity,transmembran…


photoreceptor outer segment,integral component of …


6


12


13


VLLTRPGEGGTGLPGPPLITR.3|GLNPGTLNILVR.2|YENHSATAESS…


SEN / CTL


P60842


Eukaryotic initiation factor 4A-I


EIF4A1


1.73


1.26


0.0000108


0.00000562


nuclear-transcribed mRNA poly(A) tail shortening,t…


RNA cap binding,double-stranded RNA binding,mRNA b…


cytoplasm,cytosol,membrane,eukaryotic translation …


15


39


86


VLITTDLLAR.2|AEVQKLQMEAPHIIVGTPGR.4|LQMEAPHIIVGTPG…


SEN / CTL


P07602


Prosaposin


PSAP


1.73


2.11


0.0000124


0.00000639


platelet degranulation,glycosphingolipid metabolic…


G-protein coupled receptor binding,protein binding…


extracellular region,extracellular space,cytoplasm…


21


30


59


EIVDSYLPVILDIIK.2|EIVDSYLPVILDIIK.3|GEMSRPGEVC[CAM…


SEN / CTL


P55083


Microfibril-associated glycoprotein 4


MFAP4


1.72


0.86


0.00026


0.00011


cell adhesion,UV protection,regulation of collagen…


molecular_function,protein binding


microfibril,extracellular region,extracellular mat…


9


4


9


ADGEYWLGLQNMHLLTLK.3|ADGEYWLGLQNMHLLTLK.2|ADGEYWLG…


SEN / CTL


P21333


Filamin-A


FLNA


1.7


1.02


8.42e-77


2.13e-75


platelet degranulation,adenylate cyclase-inhibitin…


G-protein coupled receptor binding,glycoprotein bi…


extracellular region,nucleus,nucleolus,cytoplasm,c…


234


207


388


LYSVSYLLK.2|YGGDEIPFSPYR.2|AEAGVPAEFSIWTR.2|AEAGVP…


SEN / CTL


P40926


Malate dehydrogenase, mitochondrial


MDH2


1.69


1.83


3.18e-8


2.47e-8


gluconeogenesis,tricarboxylic acid cycle,oxaloacet…


L-malate dehydrogenase activity,protein self-assoc…


nucleus,nucleoplasm,mitochondrion,mitochondrial in…


27


31


62


ANTFVAELK.2|IFGVTTLDIVR.2|IFGVTTLDIVR.3|GYLGPEQLPD…


SEN / CTL


Q12931


Heat shock protein 75 kDa, mitochondrial


TRAP1


1.69


0.1


0.00121


0.000424


response to stress,translational attenuation,chape…


tumor necrosis factor receptor binding,protein bin…


nucleoplasm,mitochondrion,mitochondrial inner memb…


3


53


85


GVVDSEDIPLNLSR.2|GVVDSEDIPLNLSR.3|LNELLVK.2|HLAEHS…


SEN / CTL


P22626


Heterogeneous nuclear ribonucleoproteins A2/B1


HNRNPA2B1


1.69


0.94


0.00287


0.000902


negative regulation of transcription from RNA poly…


nucleotide binding,RNA binding,mRNA 3′-UTR binding…


nucleus,nucleoplasm,spliceosomal complex,cytoplasm…


6


47


96


GFGFVTFDDHDPVDKIVLQK.4|GFGFVTFDDHDPVDKIVLQK.3|GFGF…


SEN / CTL


P49747


Cartilage oligomeric matrix protein


COMP


1.69


0.17


0.00337


0.00105


skeletal system development,growth plate cartilage…


protease binding,extracellular matrix structural c…


extracellular region,proteinaceous extracellular m…


3


10


11


C[CAM]EAC[CAM]PPGYSGPTHQGVGLAFAK.3|AVAEPGIQLK.2|FC…


SEN / CTL


Q9BTY2


Plasma alpha-L-fucosidase


FUCA2


1.69


1.79


0.00653


0.00189


fucose metabolic process,response to bacterium,gly…


alpha-L-fucosidase activity


extracellular space,extracellular exosome


9


12


14


FDPTWESLDAR.2|LVYAIFLK.2|FFNANQWADIFQASGAK.3|FFNAN…


SEN / CTL


P21810


Biglycan


BGN


1.68


1.59


1.26e-15


2.52e-15


blood vessel remodeling,negative regulation of pro…


protein kinase inhibitor activity,extracellular ma…


extracellular region,proteinaceous extracellular m…


69


23


37


IQAIELEDLLR.2|DLPETLNELHLDHNKIQAIELEDLLR.5|DLPETLN…


SEN / CTL


P06865


Beta-hexosaminidase subunit alpha


HEXA


1.68


1.26


4.71e-11


5.97e-11


carbohydrate metabolic process,glycosaminoglycan b…


beta-N-acetylhexosaminidase activity,acetylglucosa…


membrane,azurophil granule,lysosomal lumen,extrace…


30


21


32


ALLSAPWYLNR.2|GLETFSQLVWK.2|YRDLLFGSGSWPRPYLTGK.4|…


SEN / CTL


P53634


Dipeptidyl peptidase 1


CTSC


1.68


0.49


0.000215


0.0000929


T cell mediated cytotoxicity,proteolysis,ER to Gol…


cysteine-type endopeptidase activity,serine-type e…


Golgi membrane,extracellular space,lysosome,endopl…


6


16


31


ILHLPTSWDWR.3|ILHLPTSWDWR.2|NSWGTGWGENGYFR.2|VVVYL…


SEN / CTL


Q9NZP8


Complement C1r subcomponent-like protein


C1RL


1.68


2.79


0.233


0.0474


proteolysis,complement activation, classical pathw…


serine-type endopeptidase activity


extracellular space,extracellular exosome


3


9


11


WILTAAHTIYPK.3|WILTAAHTIYPK.2|VVVHPDYR.2|EAC[CAM]N…


SEN / CTL


P35556


Fibrillin-2


FBN2


1.66


1.12


0.00655


0.00189


extracellular matrix disassembly,extracellular mat…


extracellular matrix structural constituent,calciu…


microfibril,extracellular region,extracellular mat…


6


5


5


C[CAM]WGIGTIPEAC[CAM]PVR.2|LSSTGLIC[CAM]IDSLK.2|RP…


SEN / CTL


P08238


Heat shock protein HSP 90-beta


HSP90AB1


1.65


1.13


1.05e-9


9.97e-10


placenta development,protein folding,response to u…


glycoprotein binding,UTP binding,CTP binding,doubl…


nucleoplasm,cytoplasm,mitochondrion,lysosomal memb…


33


84


175


ELISNASDALDKIR.3|ELISNASDALDKIR.2|GVVDSEDLPLNISR.2…


SEN / CTL


P08865


40S ribosomal protein SA


RPSA


1.65


0.17


0.00409


0.00125


ribosomal small subunit assembly,nuclear-transcrib…


virus receptor activity,structural constituent of …


nucleus,nucleoplasm,cytoplasm,cytosol,plasma membr…


3


21


46


AIVAIENPADVSVISSR.2|AIVAIENPADVSVISSR.3|FAAATGATPI…


SEN / CTL


Q99536


Synaptic vesicle membrane protein VAT-1 homolog


VAT1


1.65


0.89


0.00426


0.0013


negative regulation of mitochondrial fusion,oxidat…


zinc ion binding,oxidoreductase activity


mitochondrial outer membrane,integral component of…


6


28


53


AC[CAM]GLNFADLMAR.2|AC[CAM]GLNFADLM[Oxi]AR.2|GVDIV…


SEN / CTL


P48740


Mannan-binding lectin serine protease 1


MASP1


1.64


1.17


0.0000436


0.0000217


complement activation, lectin pathway,proteolysis,…


serine-type endopeptidase activity,calcium ion bin…


extracellular region,extracellular space


15


18


21


TGVITSPDFPNPYPK.2|APGELEHGLITFSTR.3|APGELEHGLITFST…


SEN / CTL


P13693


Translationally-controlled tumor protein


TPT1


1.64


0.55


0.000454


0.000179


calcium ion transport,cellular calcium ion homeost…


calcium ion binding,protein binding,microtubule bi…


extracellular space,nucleus,cytoplasm,multivesicul…


6


14


26


DLISHDEMFSDIYK.3|DLISHDEM[Oxi]FSDIYK.3|DLISHDEM[Ox…


SEN / CTL


O14950


P19105


Myosin regulatory light chain 12B;Myosin regulatory light chain 12A


MYL12B


MYL12A


1.63


0.44


0.000193


0.0000836


muscle contraction,regulation of cell shape;muscle…


calcium ion binding,myosin heavy chain binding;cal…


stress fiber,cytosol,brush border,myosin II comple…


6


18


38


GNFNYIEFTR.2|ELLTTMGDRFTDEEVDELYR.3|ELLTTM[Oxi]GDR…


SEN / CTL


Q92743


Serine protease HTRA1


HTRA1


1.63


0.62


0.00104


0.000371


regulation of cell growth,placenta development,pro…


serine-type endopeptidase activity,insulin-like gr…


extracellular region,extracellular space,cytosol,p…


6


2


2


IAPAVVHIELFR.3|SSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQR.3


SEN / CTL


Q9BS26


Endoplasmic reticulum resident protein 44


ERP44


1.63


1.82


0.00464


0.0014


protein folding,response to unfolded protein,glyco…


protein disulfide isomerase activity


endoplasmic reticulum lumen,endoplasmic reticulum …


9


22


40


TPADC[CAM]PVIAIDSFR.2|TPADC[CAM]PVIAIDSFR.3|VANILH…


SEN / CTL


O75369


Filamin-B


FLNB


1.62


1.07


8.26e-11


9.51e-11


keratinocyte development,epithelial cell morphogen…


actin binding,protein binding,poly(A) RNA binding,…


stress fiber,cytoplasm,cytosol,plasma membrane,bru…


27


208


346


VLFASQEIPASPFR.2|VLFASQEIPASPFR.3|SPFTVGVAAPLDLSK….


SEN / CTL


P06744


Glucose-6-phosphate isomerase


GPI


1.62


2


0.0017


0.000565


angiogenesis,in utero embryonic development,mesode…


glucose-6-phosphate isomerase activity,cytokine ac…


extracellular space,nucleoplasm,cytoplasm,cytosol,…


12


49


107


ILLANFLAQTEALMR.2|ILLANFLAQTEALMR.3|ILLANFLAQTEALM…


SEN / CTL


P06733


Alpha-enolase


ENO1


1.61


1.13


2.03e-18


5.73e-18


gluconeogenesis,transcription, DNA-templated,respo…


magnesium ion binding,DNA binding,phosphopyruvate …


phosphopyruvate hydratase complex,extracellular sp…


66


54


117


SFIKDYPVVSIEDPFDQDDWGAWQK.3|SFIKDYPVVSIEDPFDQDDWGA…


SEN / CTL


Q9UBG0


C-type mannose receptor 2


MRC2


1.6


0.87


0.000335


0.000136


osteoblast differentiation,endocytosis,signal tran…


transmembrane signaling receptor activity,protein …


integral component of plasma membrane,focal adhesi…


9


30


39


TLGDQLSLLLGAR.2|DC[CAM]SIALPYVC[CAM]K.2|WSDGVGFSYH…


SEN / CTL


O75368


SH3 domain-binding glutamic acid-rich-like protein


SH3BGRL


1.6


1.28


0.000758


0.000284


positive regulation of signal transduction


SH3/SH2 adaptor activity,SH3 domain binding


extracellular space,nucleus,cytoplasm,extracellula…


9


12


17


VYIASSSGSTAIK.2|ENNAVYAFLGLTAPPGSK.3|ENNAVYAFLGLTA…


SEN / CTL


P24593


Insulin-like growth factor-binding protein 5


IGFBP5


1.6


1.46


0.0304


0.00755


regulation of cell growth,osteoblast differentiati…


fibronectin binding,protein binding,insulin-like g…


extracellular region,intracellular,insulin-like gr…


6


3


3


ALSMC[CAM]PPSPLGC[CAM]ELVK.2|HMEASLQELK.2|FVGGAENT…


SEN / CTL


Q9UJJ9


N-acetylglucosamine-1-phosphotransferase subunit gamma


GNPTG


1.59


0.59


0.000536


0.000208


N-glycan processing to lysosome,carbohydrate phosp…


UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylg…


Golgi membrane,Golgi apparatus,extracellular exoso…


6


6


9


LAHVSEPSTC[CAM]VYALTFETPLVC[CAM]HPHALLVYPTLPEALQR….


SEN / CTL


Q15121


Astrocytic phosphoprotein PEA-15


PEA15


1.59


0.81


0.0776


0.0173


DNA damage checkpoint,MAPK cascade,activation of M…


protein binding


cytosol,microtubule associated complex


3


11


16


RPDLLTMVVDYR.3|RPDLLTMVVDYR.2|SAC[CAM]KEDIPSEK.3|S…


SEN / CTL


P04216


Thy-1 membrane glycoprotein


THY1


1.59


1.96


0.189


0.0393


angiogenesis,negative regulation of protein kinase…


GTPase activator activity,integrin binding,protein…


endoplasmic reticulum,cytosol,plasma membrane,inte…


3


4


7


KHVLFGTVGVPEHTYR.4|HVLFGTVGVPEHTYR.4|HVLFGTVGVPEHT…


SEN / CTL


P62937


Peptidyl-prolyl cis-trans isomerase A


PPIA


1.58


0.65


7.25e-19


2.4e-18


protein peptidyl-prolyl isomerization,RNA-dependen…


peptidyl-prolyl cis-trans isomerase activity,prote…


extracellular region,extracellular space,nucleus,c…


42


24


52


VSFELFADKVPK.3|VSFELFADKVPK.2|VNPTVFFDIAVDGEPLGR.3…


SEN / CTL


P60174


Triosephosphate isomerase


TPI1


1.58


1.46


1.1e-18


3.35e-18


gluconeogenesis,glycolytic process,pentose-phospha…


triose-phosphate isomerase activity,ubiquitin prot…


extracellular space,nucleus,cytosol,extracellular …


78


37


70


VVLAYEPVWAIGTGK.2|VVLAYEPVWAIGTGK.3|KQSLGELIGTLNAA…


SEN / CTL


Q13308


Inactive tyrosine-protein kinase 7


PTK7


1.58


1.3


1.35e-7


9.27e-8


establishment of planar polarity,ventricular septu…


protein kinase activity,protein binding,ATP bindin…


integral component of plasma membrane,cell-cell ju…


21


30


35


ADGSSLPEWVTDNAGTLHFAR.3|VVLAPQDVVVAR.2|WIEAGPVVLKH…


SEN / CTL


P60660


Myosin light polypeptide 6


MYL6


1.58


0.72


1.63e-7


1.09e-7


muscle contraction,skeletal muscle tissue developm…


motor activity,calcium ion binding,structural cons…


cytosol,brush border,membrane,myosin complex,uncon…


15


13


27


NKDQGTYEDYVEGLR.3|NKDQGTYEDYVEGLR.2|NKDQGTYEDYVEGL…


SEN / CTL


P50990


T-complex protein 1 subunit theta


CCT8


1.58


1.11


0.000779


0.00029


protein folding,binding of sperm to zona pellucida…


protein binding,ATP binding,ATPase activity, coupl…


zona pellucida receptor complex,nucleoplasm,cytopl…


9


59


110


LFVTNDAATILR.2|LFVTNDAATILR.3|NLRDIDEVSSLLR.3|NLRD…


SEN / CTL


P05067


Amyloid beta A4 protein


APP


1.57


0.96


1.72e-7


1.14e-7


response to yeast,suckling behavior,platelet degra…


DNA binding,serine-type endopeptidase inhibitor ac…


extracellular region,extracellular space,nuclear e…


18


21


26


WYFDVTEGK.2|ISYGNDALMPSLTETK.2|AVIQHFQEKVESLEQEAAN…


SEN / CTL


P07942


Laminin subunit beta-1


LAMB1


1.55


1.35


3.47e-22


1.65e-21


cell adhesion,neuronal-glial interaction involved …


structural molecule activity,extracellular matrix …


extracellular region,basement membrane,laminin-1 c…


93


76


100


ISGVIGPYRETVDSVER.3|IPSWTGAGFVR.2|SC[CAM]YQDPVTLQL…


SEN / CTL


P07355


Annexin A2


ANXA2


1.55


1.06


2.43e-18


6.38e-18


angiogenesis,membrane raft assembly,positive regul…


protease binding,calcium ion binding,protein bindi…


ruffle,basement membrane,extracellular space,nucle…


66


49


99


GLGTDEDSLIEIIC[CAM]SR.2|GLGTDEDSLIEIIC[CAM]SR.3|GV…


SEN / CTL


P18669


Phosphoglycerate mutase 1


PGAM1


1.55


0.68


1.33e-13


2.3e-13


gluconeogenesis,glycolytic process,regulation of g…


bisphosphoglycerate mutase activity,phosphoglycera…


cytoplasm,cytosol,membrane,extracellular exosome


30


38


83


ALPFWNEEIVPQIK.2|ALPFWNEEIVPQIK.3|YADLTEDQLPSC[CAM…


SEN / CTL


P0CG47


P0CG48


P62979


P62987


Polyubiquitin-B;Polyubiquitin-C;Ubiquitin-40S ribosomal protein S27a;Ubiquitin-60S ribosomal protein L40


UBB


UBC


RPS27A


UBA52


1.55


1.04


0.00304


0.000951


G2/M transition of mitotic cell cycle,negative reg…


protein binding;protease binding,protein binding,p…


extracellular space,nucleus,nucleoplasm,mitochondr…


6


1


2


TITLEVEPSDTIENVK.2|TITLEVEPSDTIENVK.3


SEN / CTL


P54802


Alpha-N-acetylglucosaminidase


NAGLU


1.54


1.24


0.00000848


0.00000457


glycosaminoglycan catabolic process,lysosome organ…


alpha-N-acetylglucosaminidase activity


lysosome,lysosomal lumen,extracellular exosome


15


21


31


FLLGSWLEQAR.2|YDLLDLTR.2|AGGVLAYELLPALDEVLASDSR.3|…


SEN / CTL


P40925


Malate dehydrogenase, cytoplasmic


MDH1


1.54


0.48


0.000418


0.000165


gluconeogenesis,tricarboxylic acid cycle,oxaloacet…


malic enzyme activity,L-malate dehydrogenase activ…


extracellular space,cytoplasm,mitochondrion,centro…


6


23


39


FVEGLPINDFSR.2|NVIIWGNHSSTQYPDVNHAK.4|NVIIWGNHSSTQ…


SEN / CTL


P62942


Peptidyl-prolyl cis-trans isomerase FKBP1A


FKBP1A


1.54


0.59


0.00098


0.000356


protein peptidyl-prolyl isomerization,heart morpho…


peptidyl-prolyl cis-trans isomerase activity,signa…


cytoplasm,endoplasmic reticulum membrane,cytosol,t…


6


8


23


GWEEGVAQMSVGQR.2|GWEEGVAQMSVGQR.3|GWEEGVAQM[Oxi]SV…


SEN / CTL


P26641


Elongation factor 1-gamma


EEF1G


1.53


0.41


0.0236


0.00595


translational elongation,glutathione metabolic pro…


translation elongation factor activity,glutathione…


nucleus,cytoplasm,cytosol,cell-cell adherens junct…


3


36


59


ALIAAQYSGAQVR.2|ALIAAQYSGAQVR.3|FAETQPK.2|STFVLDEF…


SEN / CTL


P30041


Peroxiredoxin-6


PRDX6


1.52


1.3


1.74e-12


2.59e-12


response to reactive oxygen species,lipid cataboli…


glutathione peroxidase activity,protein binding,hy…


extracellular space,cytoplasm,lysosome,cytosol,cel…


45


31


62


FHDFLGDSWGILFSHPR.4|FHDFLGDSWGILFSHPR.3|FHDFLGDSWG…


SEN / CTL


O14786


Neuropilin-1


NRP1


1.52


0.8


6.85e-8


5e-8


angiogenesis,patterning of blood vessels,neuron mi…


vascular endothelial growth factor-activated recep…


semaphorin receptor complex,extracellular space,ea…


18


12


14


EGNKPVLFQGNTNPTDVVVAVFPKPLITR.4|FVTAVGTQGAISK.2|YD…


SEN / CTL


P05387


60S acidic ribosomal protein P2


RPLP2


1.52


1.47


0.0000838


0.0000388


nuclear-transcribed mRNA catabolic process, nonsen…


structural constituent of ribosome,large ribosomal…


cytosol,focal adhesion,membrane,cytosolic large ri…


15


13


30


NIEDVIAQGIGK.2|NIEDVIAQGIGK.3|YVASYLLAALGGNSSPSAK….


SEN / CTL


P09211


Glutathione S-transferase P


GSTP1


1.51


0.57


2.29e-11


3e-11


response to reactive oxygen species,negative regul…


glutathione transferase activity,glutathione perox…


extracellular space,intracellular,nucleus,cytoplas…


21


20


44


PPYTVVYFPVR.2|PPYTVVYFPVR.3|FQDGDLTLYQSNTILR.2|FQD…


SEN / CTL


P14618


Pyruvate kinase PKM


PKM


1.5


1.17


7.05e-25


5.36e-24


programmed cell death,canonical glycolysis,cell-ce…


magnesium ion binding,pyruvate kinase activity,pro…


nucleus,cytoplasm,mitochondrion,cytosol,plasma mem…


102


71


161


GDLGIEIPAEK.2|IYVDDGLISLQVK.2|IYVDDGLISLQVK.3|KGVN…


SEN / CTL


Q9UBR2


Cathepsin Z


CTSZ


1.5


1.25


0.000367


0.000148


angiotensin maturation,proteolysis,ER to Golgi ves…


cysteine-type endopeptidase activity,protein bindi…


Golgi membrane,extracellular space,lysosome,endopl…


12


16


25


STYPRPHEYLSPADLPK.4|STYPRPHEYLSPADLPK.3|VGDYGSLSGR…


SEN / CTL


Q16881


Thioredoxin reductase 1, cytoplasmic


TXNRD1


1.5


1.03


0.000904


0.000334


response to reactive oxygen species,mesoderm forma…


thioredoxin-disulfide reductase activity,electron …


nucleus,mitochondrion,cytosol,extracellular exosom…


9


36


59


QFVPIKVEQIEAGTPGR.3|VVGFHVLGPNAGEVTQGFAAALK.3|VVGF…


SEN / CTL


P39060


Collagen alpha-1(XVIII) chain


COL18A1


1.49


0.69


0.00000403


0.00000227


angiogenesis,endothelial cell morphogenesis,cell a…


structural molecule activity,metal ion binding


extracellular region,collagen trimer,basement memb…


12


31


46


IFSFDGKDVLR.3|AAVPIVNLKDELLFPSWEALFSGSEGPLKPGAR.4|…


SEN / CTL


P07737


Profilin-1


PFN1


1.48


1.25


1.05e-11


1.48e-11


neural tube closure,positive regulation of epithel…


adenyl-nucleotide exchange factor activity,actin b…


nucleus,cytoplasm,cytosol,cytoskeleton,cell-cell a…


36


19


37


TFVNITPAEVGVLVGKDR.3|TFVNITPAEVGVLVGKDR.2|STGGAPTF…


SEN / CTL


Q16555


Dihydropyrimidinase-related protein 2


DPYSL2


1.48


1.7


0.000621


0.000237


response to amphetamine,nucleobase-containing comp…


dihydropyrimidinase activity,protein binding,micro…


mitochondrion,cytosol,dendrite,growth cone,neurona…


12


35


74


AITIANQTNC[CAM]PLYITK.2|AITIANQTNC[CAM]PLYITK.3|GS…


SEN / CTL


P58546


Myotrophin


MTPN


1.47


1.04


0.0000354


0.0000177


regulation of translation,catecholamine metabolic …


sequence-specific DNA binding


nucleus,cytosol,F-actin capping protein complex,ax…


12


13


27


TLEGGRKPLHYAADC[CAM]GQLEILEFLLLK.5|TLEGGRKPLHYAADC…


SEN / CTL


P11142


Heat shock cognate 71 kDa protein


HSPA8


1.46


1.17


3.38e-8


2.59e-8


mRNA splicing, via spliceosome,transcription, DNA-…


G-protein coupled receptor binding,phosphatidylser…


Prp19 complex,extracellular space,intracellular,nu…


45


50


118


ARFEELNADLFR.3|ARFEELNADLFR.2|DAGTIAGLNVLR.2|DAGTI…


SEN / CTL


O60888


Protein CutA


CUTA


1.46


0.88


4.12e-8


3.13e-8


protein localization,response to metal ion


copper ion binding,enzyme binding


membrane,extracellular exosome


18


7


14


TQSSLVPALTDFVR.2|TQSSLVPALTDFVR.3|SVHPYEVAEVIALPVE…


SEN / CTL


P07686


Beta-hexosaminidase subunit beta


HEXB


1.46


1.87


0.000109


0.00005


skeletal system development,glycosphingolipid meta…


beta-N-acetylhexosaminidase activity,acetylglucosa…


acrosomal vesicle,extracellular space,membrane,azu…


21


27


38


VLDIIATINK.2|EISEVFPDQFIHLGGDEVEFK.3|LAPGTIVEVWKDS…


SEN / CTL


Q96TA1


Niban-like protein 1


FAM129B


1.46


0.53


0.000702


0.000264


negative regulation of apoptotic process,cell-cell…


cadherin binding involved in cell-cell adhesion


nucleus,nucleoplasm,nucleolus,cytoplasm,cytosol,pl…


6


38


58


FQELIFEDFAR.2|ILTSVDQYLELIGNSLPGTTAK.3|ILTSVDQYLEL…


SEN / CTL


P11413


Glucose-6-phosphate 1-dehydrogenase


G6PD


1.46


0.16


0.00496


0.00149


glucose metabolic process,pentose-phosphate shunt,…


glucose-6-phosphate dehydrogenase activity,glucose…


nucleus,cytoplasm,centrosome,microtubule organizin…


3


50


86


LFYLALPPTVYEAVTK.2|LFYLALPPTVYEAVTK.3|NVKLPDAYER.3…


SEN / CTL


Q96CN7


Isochorismatase domain-containing protein 1


ISOC1


1.46


1.1


0.11


0.0239


biological_process,metabolic process


molecular_function,catalytic activity


cytoplasm,peroxisome,extracellular exosome


3


16


25


FSM[Oxi]VLPEVEAALAEIPGVR.3|FSMVLPEVEAALAEIPGVR.3|F…


SEN / CTL


O14818


Q8TAA3


Proteasome subunit alpha type-7;Proteasome subunit alpha type-7-like


PSMA7


PSMA8


1.46


1.34


0.156


0.0329


MAPK cascade,protein polyubiquitination,stimulator…


threonine-type endopeptidase activity,protein bind…


proteasome complex,nucleus,nucleoplasm,cytosol,pro…


3


1


2


LTVEDPVTVEYITR.2|LTVEDPVTVEYITR.3


SEN / CTL


Q12805


EGF-containing fibulin-like extracellular matrix protein 1


EFEMP1


1.45


1.25


1.48e-11


2.01e-11


regulation of transcription, DNA-templated,epiderm…


epidermal growth factor-activated receptor activit…


extracellular region,proteinaceous extracellular m…


33


16


18


SVPSDIFQIQATTIYANTINTFR.3|RGEQC[CAM]VDIDEC[CAM]TIP…


SEN / CTL


P0DMV8


P0DMV9


Heat shock 70 kDa protein 1A;Heat shock 70 kDa protein 1B


HSPA1A


HSPA1B


1.45


1.55


0.000309


0.000127


positive regulation of gene expression,regulation …


virus receptor activity,G-protein coupled receptor…


nucleoplasm,cytoplasm,mitochondrion,centriole,cyto…


21


60


132


ARFEELC[CAM]SDLFR.3|ARFEELC[CAM]SDLFR.2|TTPSYVAFTD…


SEN / CTL


P47756


F-actin-capping protein subunit beta


CAPZB


1.45


0.52


0.00133


0.000462


movement of cell or subcellular component,cytoskel…


actin binding,actin filament binding,cadherin bind…


cytosol,cytoskeleton,actin filament,cell-cell adhe…


6


22


40


SGSGTMNLGGSLTR.2|SGSGTM[Oxi]NLGGSLTR.2|SPWSNKYDPPL…


SEN / CTL


O43707


Alpha-actinin-4


ACTN4


1.44


1.48


2.77e-14


5.02e-14


response to hypoxia,platelet degranulation,protein…


RNA polymerase II regulatory region sequence-speci…


stress fiber,extracellular region,extracellular sp…


108


85


169


VGWEQLLTTIAR.2|VGWEQLLTTIAR.3|ETTDTDTADQVIASFK.2|E…


SEN / CTL


P16035


Metalloproteinase inhibitor 2


TIMP2


1.43


0.92


2.26e-8


1.85e-8


central nervous system development,aging,negative …


protease binding,integrin binding,metalloendopepti…


extracellular region,proteinaceous extracellular m…


27


8


11


MHITLC[CAM]DFIVPWDTLSTTQKK.4|MHITLC[CAM]DFIVPWDTLS…


SEN / CTL


P13929


Beta-enolase


ENO3


1.43


0.36


0.00000244


0.00000143


gluconeogenesis,aging,response to drug,skeletal mu…


magnesium ion binding,phosphopyruvate hydratase ac…


phosphopyruvate hydratase complex,extracellular sp…


9


16


23


YGKDATNVGDEGGFAPNILENNEALELLK.4|VNQIGSVTESIQAC[CAM…


SEN / CTL


P10253


Lysosomal alpha-glucosidase


GAA


1.43


1.56


0.00148


0.000501


maltose metabolic process,regulation of the force …


alpha-1,4-glucosidase activity,oligo-1,6-glucosida…


lysosome,lysosomal membrane,membrane,lysosomal lum…


12


34


49


GAYTQVIFLAR.2|WTQLGAFYPFMR.2|WTQLGAFYPFM[Oxi]R.2|A…


SEN / CTL


P27348


14-3-3 protein theta


YWHAQ


1.43


1.72


0.00886


0.00249


protein targeting,small GTPase mediated signal tra…


protein binding,protein C-terminus binding,protein…


cytoplasm,mitochondrion,cytosol,focal adhesion,mem…


9


23


46


SIC[CAM]TTVLELLDKYLIANATNPESK.3|SIC[CAM]TTVLELLDKY…


SEN / CTL


Q06481


Amyloid-like protein 2


APLP2


1.43


0.76


0.0639


0.0145


platelet degranulation,G-protein coupled receptor …


DNA binding,serine-type endopeptidase inhibitor ac…


nucleus,plasma membrane,membrane,integral componen…


3


16


20


VPYVAQEIQEEIDELLQEQR.3|HYQHVLAVDPEK.3|HYQHVLAVDPEK…


SEN / CTL


P28072


Proteasome subunit beta type-6


PSMB6


1.43


1.25


0.206


0.0426


MAPK cascade,protein polyubiquitination,stimulator…


endopeptidase activity,threonine-type endopeptidas…


proteasome complex,nucleus,nucleoplasm,cytoplasm,G…


3


11


17


LAAIAESGVER.2|DGSSGGVIR.2|VTDKLTPIHDR.3|VTDKLTPIHD…


SEN / CTL


Q09666


Neuroblast differentiation-associated protein AHNAK


AHNAK


1.41


1.42


7.35e-15


1.36e-14


regulation of RNA splicing,protein oligomerization…


protein binding,S100 protein binding,poly(A) RNA b…


nucleus,cytoplasm,lysosomal membrane,cytosol,plasm…


78


433


666


ISMPEVDLNLKGPK.3|ISIPDVDLDLKGPK.3|ISMPDLDLNLKGPK.3…


SEN / CTL


Q6EMK4


Vasorin


VASN


1.41


1.32


0.0000188


0.00000954


negative regulation of epithelial to mesenchymal t…


transforming growth factor beta binding,cadherin b…


extracellular space,mitochondrion,lysosomal membra…


15


8


8


SLTLGIEPVSPTSLR.2|LAGLGLQQLDEGLFSR.2|LLLLDLSHNSLLA…


SEN / CTL


Q12841


Follistatin-related protein 1


FSTL1


1.4


0.89


0.00000415


0.00000232


BMP signaling pathway,response to starvation


calcium ion binding,protein binding,heparin bindin…


extracellular region,extracellular space,extracell…


15


12


12


LSFQEFLK.2|IIQWLEAEIIPDGWFSK.3|IC[CAM]ANVFC[CAM]GA…


SEN / CTL


P00441


Superoxide dismutase [Cu-Zn]


SOD1


1.39


0.62


2.48e-10


2.59e-10


activation of MAPK activity,response to reactive o…


superoxide dismutase activity,copper ion binding,p…


extracellular region,extracellular space,nucleus,n…


21


20


39


GLTEGLHGFHVHEFGDNTAGC[CAM]TSAGPHFNPLSR.5|GLTEGLHGF…


SEN / CTL


P02461


Collagen alpha-1(III) chain


COL3A1


1.39


1.38


6.07e-8


4.53e-8


skeletal system development,cell-matrix adhesion,t…


integrin binding,extracellular matrix structural c…


extracellular region,collagen type III trimer,extr…


30


25


27


SVNGQIESLISPDGSR.2|VFC[CAM]NMETGETC[CAM]ISANPLNVPR…


SEN / CTL


P62258


14-3-3 protein epsilon


YWHAE


1.39


2.21


0.00947


0.00266


G2/M transition of mitotic cell cycle,neuron migra…


protein binding,potassium channel regulator activi…


mitochondrion,cytosol,kinesin complex,cell-cell ad…


18


36


102


LIC[CAM]C[CAM]DILDVLDKHLIPAANTGESK.4|LIC[CAM]C[CAM…


SEN / CTL


Q13442


28 kDa heat- and acid-stable phosphoprotein


PDAP1


1.39


1.55


0.127


0.0271


signal transduction,cell proliferation


poly(A) RNA binding


3


15


23


KVTQLDLDGPK.2|KVTQLDLDGPK.3|KVTQLDLDGPKELSR.4|KVTQ…


SEN / CTL


Q9BYZ2


L-lactate dehydrogenase A-like 6B


LDHAL6B


1.38


0.41


0.000385


0.000154


carbohydrate metabolic process,pyruvate metabolic …


L-lactate dehydrogenase activity


nucleus,mitochondrial matrix


6


1


2


LIIVSNPVDILTYVAWK.3|LIIVSNPVDILTYVAWK.2


SEN / CTL


P12814


Alpha-actinin-1


ACTN1


1.37


1.42


6.06e-17


1.4e-16


platelet degranulation,actin filament organization…


double-stranded RNA binding,integrin binding,calci…


stress fiber,ruffle,extracellular region,extracell…


81


84


180


DGLGFC[CAM]ALIHR.2|DGLGFC[CAM]ALIHR.3|LLETIDQLYLEY…


SEN / CTL


Q9Y240


C-type lectin domain family 11 member A


CLEC11A


1.37


1.15


0.00000323


0.00000183


positive regulation of cell proliferation


growth factor activity,carbohydrate binding


extracellular region,extracellular space,cytoplasm


24


12


16


DFEAQAAAQAR.2|VVELTQGLR.2|LAGLDAGLHQLHVR.3|LAGLDAG…


SEN / CTL


P52565


Rho GDP-dissociation inhibitor 1


ARHGDIA


1.37


1.05


0.000183


0.0000804


movement of cell or subcellular component,negative…


Rho GDP-dissociation inhibitor activity,GTPase act…


cytosol,cytoskeleton,extracellular exosome


15


15


29


AEEYEFLTPVEEAPK.2|AEEYEFLTPVEEAPK.3|SIQEIQELDKDDES…


SEN / CTL


P08670


Vimentin


VIM


1.36


1.35


3.75e-24


2.59e-23


movement of cell or subcellular component,positive…


glycoprotein binding,double-stranded RNA binding,s…


cytoplasm,peroxisome,cytosol,cytoskeleton,intermed…


138


93


188


ILLAELEQLKGQGK.3|ILLAELEQLKGQGK.2|KVESLQEEIAFLK.3|…


SEN / CTL


Q6YHK3


CD109 antigen


CD109


1.36


1.2


3.47e-9


3.11e-9


negative regulation of protein phosphorylation,hai…


serine-type endopeptidase inhibitor activity,trans…


extracellular space,plasma membrane,cell surface,a…


30


27


34


ISVTQPDSIVGIVAVDK.2|TLTLPSLPLNSADEIYELR.3|TLTLPSLP…


SEN / CTL


Q9P2E9


Ribosome-binding protein 1


RRBP1


1.36


0.71


0.00247


0.000793


osteoblast differentiation,translation,protein tra…


receptor activity,poly(A) RNA binding


endoplasmic reticulum,ribosome,membrane,integral c…


6


99


145


SIEALLEAGQAR.2|SIEALLEAGQAR.3|LREAEETQSTLQAEC[CAM]…


SEN / CTL


O00410


Importin-5


IPO5


1.36


0.92


0.00587


0.00173


protein import into nucleus, docking,protein impor…


GTPase inhibitor activity,protein binding,nuclear …


nucleus,nuclear pore,nucleoplasm,nucleolus,cytopla…


6


60


117


AIGTEPDSDVLSEIMHSFAK.3|AIGTEPDSDVLSEIMHSFAK.2|ITFL…


SEN / CTL


Q9UHB6


LIM domain and actin-binding protein 1


LIMA1


1.36


0.89


0.0951


0.0209


negative regulation of actin filament depolymeriza…


actin monomer binding,zinc ion binding,actin filam…


stress fiber,cytoplasm,plasma membrane,brush borde…


3


53


80


LLANQQVFHISC[CAM]FR.3|LLANQQVFHISC[CAM]FR.2|ADHPPA…


SEN / CTL


P29401


Transketolase


TKT


1.35


1.13


6.44e-7


4.01e-7


xylulose biosynthetic process,pentose-phosphate sh…


transketolase activity,protein homodimerization ac…


nucleus,nucleoplasm,peroxisome,cytosol,vesicle,mye…


18


53


103


ILATPPQEDAPSVDIANIR.3|ILATPPQEDAPSVDIANIR.2|ILATPP…


SEN / CTL


P10909


Clusterin


CLU


1.34


1.48


0.000011


0.00000569


cell morphogenesis,microglial cell activation,rele…


protein binding,ubiquitin protein ligase binding,c…


extracellular region,extracellular space,nucleus,c…


21


25


42


LFDSDPITVTVPVEVSR.2|LFDSDPITVTVPVEVSR.3|ELDESLQVAE…


SEN / CTL


P07900


Heat shock protein HSP 90-alpha


HSP90AA1


1.34


1.12


0.000136


0.0000612


G2/M transition of mitotic cell cycle,neuron migra…


nucleotide binding,glycoprotein binding,UTP bindin…


extracellular region,nucleus,nucleoplasm,cytoplasm…


15


69


151


LVTSPC[CAM]C[CAM]IVTSTYGWTANMER.3|LVTSPC[CAM]C[CAM…


SEN / CTL


P27797


Calreticulin


CALR


1.32


0.83


0.00000233


0.00000137


negative regulation of transcription from RNA poly…


complement component C1q binding,glycoprotein bind…


acrosomal vesicle,extracellular region,proteinaceo…


15


52


95


EQFLDGDGWTSR.2|FYALSASFEPFSNK.2|FYALSASFEPFSNK.3|S…


SEN / CTL


P42785


Lysosomal Pro-X carboxypeptidase


PRCP


1.32


1.32


0.001


0.000363


regulation of thyroid hormone mediated signaling p…


serine-type carboxypeptidase activity,dipeptidyl-p…


lysosome,plasma membrane,basal part of cell,extrac…


12


11


19


NALDPMSVLLAR.2|NALDPMSVLLAR.3|NALDPM[Oxi]SVLLAR.2|…


SEN / CTL


Q8NBS9


Thioredoxin domain-containing protein 5


TXNDC5


1.32


1.59


0.00252


0.0008


protein folding,response to endoplasmic reticulum …


protein disulfide isomerase activity


endoplasmic reticulum,endoplasmic reticulum lumen,…


15


30


49


GYPTLLLFR.2|GYPTLLWFR.2|DLESLREYVESQLQR.3|DLESLREY…


SEN / CTL


P35052


Glypican-1


GPC1


1.31


1.21


2.86e-8


2.26e-8


retinoid metabolic process,glycosaminoglycan biosy…


copper ion binding,fibroblast growth factor bindin…


proteinaceous extracellular matrix,extracellular s…


24


13


13


VLQAMLATQLR.2|GFSLSDVPQAEISGEHLR.3|SFVQGLGVASDVVR….


SEN / CTL


P12259


Coagulation factor V


F5


1.3


2.19


0.036


0.00882


platelet degranulation,proteolysis,ER to Golgi ves…


serine-type endopeptidase activity,copper ion bind…


Golgi membrane,extracellular region,extracellular …


6


40


46


AEVDDVIQVR.2|DIHSGLIGPLLIC[CAM]QK.3|FC[CAM]ENPDEVK…


SEN / CTL


Q16851


UTP–glucose-1-phosphate uridylyltransferase


UGP2


1.3


1.1


0.118


0.0254


glycogen biosynthetic process,UDP-glucose metaboli…


UTP:glucose-1-phosphate uridylyltransferase activi…


nucleus,cytosol,extracellular exosome


3


37


59


SFENSLGINVPR.2|SFENSLGINVPR.3|ILTTASSHEFEHTK.4|ILT…


SEN / CTL


P00338


L-lactate dehydrogenase A chain


LDHA


1.29


1.86


5.53e-11


6.67e-11


response to hypoxia,lactate metabolic process,pyru…


L-lactate dehydrogenase activity,protein binding,k…


nucleus,cytosol,cell-cell adherens junction,membra…


60


38


92


LVIITAGAR.2|VTLTSEEEAR.2|SADTLWGIQKELQF.2|LLIVSNPV…


SEN / CTL


P07951


Tropomyosin beta chain


TPM2


1.29


1.1


1.87e-9


1.73e-9


muscle contraction,muscle filament sliding,regulat…


actin binding,structural constituent of muscle


cytosol,muscle thin filament tropomyosin


42


34


56


IQLVEEELDR.2|IQLVEEELDRAQER.3|IQLVEEELDRAQER.2|RIQ…


SEN / CTL


A5A3E0


POTE ankyrin domain family member F


POTEF


1.29


1.17


0.0015


0.000504


retina homeostasis


extracellular space,cell cortex,extracellular exos…


9


3


4


VAPEEHPVLLTEATLNPK.3|LC[CAM]YVALDFEQEMATVASSSSLEK….


SEN / CTL


Q14118


Dystroglycan


DAG1


1.29


0.51


0.0411


0.00987


morphogenesis of an epithelial sheet,protein O-lin…


virus receptor activity,dystroglycan binding,actin…


extracellular region,basement membrane,extracellul…


3


17


21


VTIPTDLIASSGDIIK.2|GGLSAVDAFEIHVHR.4|GGLSAVDAFEIHV…


SEN / CTL


Q99715


Collagen alpha-1(XII) chain


COL12A1


1.28


1.12


1.72e-35


1.86e-34


skeletal system development,cell adhesion,collagen…


extracellular matrix structural constituent confer…


extracellular region,collagen type XII trimer,extr…


153


96


114


IVEVFDIGPK.2|LLPETPSDPFAIWQITDRDYKPQVGVIADPSSK.4|N…


SEN / CTL


P62158


Calmodulin


CALM1


1.28


1.1


0.00000281


0.0000016


G2/M transition of mitotic cell cycle,MAPK cascade…


Ras guanyl-nucleotide exchange factor activity,cal…


spindle pole,extracellular region,nucleus,nucleopl…


21


13


30


VFDKDGNGYISAAELR.3|VFDKDGNGYISAAELR.2|EAFSLFDKDGDG…


SEN / CTL


P07195


L-lactate dehydrogenase B chain


LDHB


1.27


2.19


0.00026


0.00011


carbohydrate metabolic process,lactate metabolic p…


L-lactate dehydrogenase activity,protein binding,k…


cytoplasm,mitochondrion,cytosol,membrane,myelin sh…


24


35


73


IVVVTAGVR.2|MVVESAYEVIK.2|MVVESAYEVIK.3|M[Oxi]VVES…


SEN / CTL


P00742


Coagulation factor X


F10


1.27


0.72


0.00569


0.00169


signal peptide processing,ER to Golgi vesicle-medi…


serine-type endopeptidase activity,calcium ion bin…


extracellular region,endoplasmic reticulum lumen,G…


6


13


15


ETYDFDIAVLR.2|MLEVPYVDR.2|TGIVSGFGR.2|NTEQEEGGEAVH…


SEN / CTL


P08603


Complement factor H


CFH


1.26


1.09


1.6e-12


2.43e-12


complement activation,complement activation, alter…


protein binding,heparin binding,heparan sulfate pr…


extracellular region,extracellular space,extracell…


42


65


114


C[CAM]FEGFGIDGPAIAK.2|EIMENYNIALR.2|EIMENYNIALR.3|…


SEN / CTL


P55290


Cadherin-13


CDH13


1.26


0.92


0.00458


0.00139


mitotic cell cycle,positive regulation of endothel…


calcium ion binding,low-density lipoprotein partic…


extracellular space,cytoplasm,plasma membrane,cave…


9


7


9


SIVVSPILIPENQR.2|DIQGSLQDIFK.2|TLEGPVPLEVIVIDQNDNR…


SEN / CTL


P63104


14-3-3 protein zeta/delta


YWHAZ


1.25


1.21


3.06e-7


1.94e-7


protein targeting,signal transduction,platelet act…


protein binding,transcription factor binding,prote…


extracellular space,nucleus,nucleoplasm,cytoplasm,…


24


22


53


IETELRDIC[CAM]NDVLSLLEK.3|IETELRDIC[CAM]NDVLSLLEK….


SEN / CTL


O60568


Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3


PLOD3


1.25


1.51


0.00664


0.0019


in utero embryonic development,endothelial cell mo…


iron ion binding,protein binding,procollagen-lysin…


endoplasmic reticulum membrane,rough endoplasmic r…


24


41


68


VFLAVFVEQPTPFLPR.3|VFLAVFVEQPTPFLPR.2|QVGYEDQWLQLL…


SEN / CTL


Q99497


Protein deglycase DJ-1


PARK7


1.24


0.96


0.000476


0.000187


negative regulation of protein phosphorylation,neg…


transcription coactivator activity,mRNA binding,re…


chromatin,nucleus,cytoplasm,mitochondrion,mitochon…


12


27


55


GAEEMETVIPVDVMR.2|GAEEMETVIPVDVMR.3|GAEEMETVIPVDVM…


SEN / CTL


P07711


Cathepsin L1


CTSL


1.23


0.78


0.0184


0.00474


toll-like receptor signaling pathway,adaptive immu…


fibronectin binding,cysteine-type endopeptidase ac…


extracellular region,extracellular space,nucleus,l…


6


9


13


VFQEPLFYEAPR.2|VFQEPLFYEAPR.3|NSWGEEWGMGGYVK.2|NSW…


SEN / CTL


P55072


Transitional endoplasmic reticulum ATPase


VCP


1.22


1.68


1.2e-10


1.31e-10


DNA repair,double-strand break repair,NADH metabol…


protein binding,ATP binding,lipid binding,ATPase a…


proteasome complex,nucleus,nucleoplasm,cytoplasm,e…


42


94


187


LGDVISIQPC[CAM]PDVK.2|LGDVISIQPC[CAM]PDVK.3|LIVDEA…


SEN / CTL


P14543


Nidogen-1


NID1


1.22


1.68


2.56e-8


2.07e-8


cell-matrix adhesion,positive regulation of cell-s…


calcium ion binding,collagen binding,laminin bindi…


extracellular region,basement membrane,basal lamin…


51


38


50


VYYREDLSPSITQR.3|VLFETDLVNPR.2|ALEGLQYPFAVTSYGK.2|…


SEN / CTL


P98160


Basement membrane-specific heparan sulfate proteoglycan core protein


HSPG2


1.21


1.1


4.48e-66


8.5e-65


retinoid metabolic process,angiogenesis,glycosamin…


calcium ion binding,protein binding,protein C-term…


extracellular region,basement membrane,extracellul…


291


163


239


AGLSSGFIGC[CAM]VR.2|FSSGITGC[CAM]VK.2|C[CAM]LIHDGA…


SEN / CTL


P21291


Cysteine and glycine-rich protein 1


CSRP1


1.21


0.92


0.000624


0.000237


platelet aggregation


zinc ion binding,poly(A) RNA binding


nucleus,focal adhesion,extracellular exosome


9


16


31


GLESTTLADKDGEIYC[CAM]K.3|GLESTTLADKDGEIYC[CAM]K.2|…


SEN / CTL


Q16769


Glutaminyl-peptide cyclotransferase


QPCT


1.2


0.36


0.0368


0.00895


cellular protein modification process,peptidyl-pyr…


zinc ion binding,glutaminyl-peptide cyclotransfera…


extracellular exosome


3


7


8


VFVGATDSAVPC[CAM]AMMLELAR.3|VFVGATDSAVPC[CAM]AMMLE…


SEN / CTL


O75083


WD repeat-containing protein 1


WDR1


1.19


0.83


6.47e-8


4.77e-8


platelet degranulation,sensory perception of sound…


actin filament binding


podosome,extracellular region,cytoplasm,cytosol,ac…


21


47


76


LYSILGTTLKDEGK.3|LYSILGTTLKDEGK.2|YAPSGFYIASGDVSGK…


SEN / CTL


P18206


Vinculin


VCL


1.17


1.35


8.46e-11


9.59e-11


morphogenesis of an epithelium,platelet degranulat…


dystroglycan binding,actin binding,structural mole…


extracellular region,cytosol,cytoskeleton,plasma m…


72


102


192


AIPDLTAPVAAVQAAVSNLVR.3|AIPDLTAPVAAVQAAVSNLVR.2|WI…


SEN / CTL


Q32P28


Prolyl 3-hydroxylase 1


LEPRE1


1.17


0.08


0.00151


0.000504


protein folding,negative regulation of cell prolif…


molecular_function,iron ion binding,procollagen-pr…


proteinaceous extracellular matrix,endoplasmic ret…


3


29


36


GDWPGVVLSMER.2|TAIEEVQAERK.3|LTNVAATSGDGYR.3|LTNVA…


SEN / CTL


Q96CG8


Collagen triple helix repeat-containing protein 1


CTHRC1


1.16


2.63


0.056


0.013


cell migration,positive regulation of protein bind…


frizzled binding,Wnt-protein binding


proteinaceous extracellular matrix,collagen trimer…


6


3


3


IIIEELPK.2|QC[CAM]SWSSLNYGIDLGK.2|GDASTGWNSVSR.2


SEN / CTL


Q07954


Prolow-density lipoprotein receptor-related protein 1


LRP1


1.14


1.7


0.000283


0.000118


retinoid metabolic process,receptor-mediated endoc…


protease binding,receptor activity,low-density lip…


nucleolus,cytoplasm,lysosomal membrane,endosome,pl…


18


65


72


AALSGANVLTLIEKDIR.3|LDGLC[CAM]IPLR.2|VFFTDYGQIPK.2…


SEN / CTL


P08123


Collagen alpha-2(I) chain


COL1A2


1.13


1.28


1.57e-20


5.97e-20


skeletal system development,blood vessel developme…


extracellular matrix structural constituent,protei…


extracellular region,collagen type I trimer,extrac…


96


44


57


SLNNQIETLLTPEGSR.2|SLNNQIETLLTPEGSR.3|DYEVDATLK.2|…


SEN / CTL


P68363


Tubulin alpha-1B chain


TUBA1B


1.13


1.02


3.18e-12


4.64e-12


microtubule cytoskeleton organization,microtubule-…


double-stranded RNA binding,GTPase activity,struct…


microtubule,cytoplasmic microtubule,myelin sheath,…


48


11


28


AVFVDLEPTVIDEVR.2|AVFVDLEPTVIDEVR.3|LISQIVSSITASLR…


SEN / CTL


P13639


Elongation factor 2


EEF2


1.13


1.27


3.78e-10


3.83e-10


hematopoietic progenitor cell differentiation,resp…


p53 binding,translation elongation factor activity…


nucleus,cytoplasm,cytosol,plasma membrane,cell-cel…


48


83


182


VFSGLVSTGLK.2|LMEPIYLVEIQC[CAM]PEQVVGGIYGVLNR.3|LM…


SEN / CTL


Q16270


Insulin-like growth factor-binding protein 7


IGFBP7


1.11


1.27


7.7e-7


4.76e-7


regulation of cell growth,cell adhesion,embryo imp…


protein binding,insulin-like growth factor binding


extracellular region,extracellular space,extracell…


33


12


15


TELLPGDRDNLAIQTR.3|TELLPGDRDNLAIQTR.2|SRYPVC[CAM]G…


SEN / CTL


P04083


Annexin A1


ANXA1


1.11


1.49


8.66e-7


5.26e-7


DNA strand renaturation,neutrophil homeostasis,ada…


single-stranded DNA binding,single-stranded RNA bi…


cornified envelope,phagocytic cup,extracellular re…


42


38


69


GLGTDEDTLIEILASR.2|GLGTDEDTLIEILASR.3|DLAKDITSDTSG…


SEN / CTL


Q13361


Microfibrillar-associated protein 5


MFAP5


1.11


1.87


0.218


0.045


extracellular matrix organization,extracellular fi…


extracellular matrix structural constituent


microfibril,extracellular region


3


2


2


QC[CAM]IHQLC[CAM]FTSLR.3|EHEAMKDELC[CAM]R.3


SEN / CTL


P02751


Fibronectin


FN1


1.1


1.31


8.76e-83


3.33e-81


angiogenesis,regulation of protein phosphorylation…


protease binding,integrin binding,protein binding,…


extracellular region,fibrinogen complex,basal lami…


402


126


209


FLATTPNSLLVSWQPPR.3|FLATTPNSLLVSWQPPR.2|VTWAPPPSID…


SEN / CTL


Q15063


Periostin


POSTN


1.1


1.37


1.15e-15


2.36e-15


skeletal system development,response to hypoxia,ne…


protein binding,heparin binding,metal ion binding,…


proteinaceous extracellular matrix,extracellular s…


81


48


80


GC[CAM]PAVLPIDHVYGTLGIVGATTTQR.3|GC[CAM]PAVLPIDHVY…


SEN / CTL


O00468


Agrin


AGRN


1.1


1.65


0.0000797


0.0000372


retinoid metabolic process,glycosaminoglycan biosy…


dystroglycan binding,structural constituent of cyt…


extracellular region,basal lamina,cytoplasm,Golgi …


36


54


64


SIESTLDDLFR.2|SFLAFPTLR.2|GKDFLALALLDGR.3|TEATQGLV…


SEN / CTL


P30086


Phosphatidylethanolamine-binding protein 1


PEBP1


1.1


1


0.000494


0.000193


MAPK cascade,negative regulation of endopeptidase …


serine-type endopeptidase inhibitor activity,prote…


nucleus,cytosol,extracellular exosome


15


25


48


WSGPLSLQEVDEQPQHPLHVTYAGAAVDELGK.4|WSGPLSLQEVDEQPQ…


SEN / CTL


P23528


Cofilin-1


CFL1


1.09


1.01


5.36e-11


6.57e-11


cytoskeleton organization,Rho protein signal trans…


protein binding,actin filament binding


extracellular space,nucleus,cytoplasm,focal adhesi…


42


24


46


ESKKEDLVFIFWAPESAPLK.4|ESKKEDLVFIFWAPESAPLK.3|ESKK…


SEN / CTL


O00584


Ribonuclease T2


RNASET2


1.09


0.7


0.0008


0.000296


RNA catabolic process,RNA phosphodiester bond hydr…


RNA binding,ribonuclease activity,ribonuclease T2 …


extracellular region,extracellular space,lysosome,…


9


17


29


ELDLNSVLLK.2|SWPFNLEEIKDLLPEMR.3|LGIKPSINYYQVADFKD…


SEN / CTL


P50395


Rab GDP dissociation inhibitor beta


GDI2


1.07


1.36


3.01e-7


1.92e-7


signal transduction,small GTPase mediated signal t…


Rab GDP-dissociation inhibitor activity,GTPase act…


cytoplasm,Golgi apparatus,cytosol,focal adhesion,m…


36


56


113


KFDLGQDVIDFTGHALALYR.3|KFDLGQDVIDFTGHALALYR.4|KFDL…


SEN / CTL


O00299


Chloride intracellular channel protein 1


CLIC1


1.07


1.63


0.0000602


0.0000289


chloride transport,signal transduction,regulation …


voltage-gated ion channel activity,chloride channe…


extracellular space,nucleus,nuclear envelope,cytop…


24


24


42


LAALNPESNTAGLDIFAK.2|LAALNPESNTAGLDIFAK.3|GFTIPEAF…


SEN / CTL


P60709


P63261


Actin, cytoplasmic 1;Actin, cytoplasmic 2


ACTB


ACTG1


1.05


1.52


6.46e-16


1.36e-15


retina homeostasis,movement of cell or subcellular…


structural constituent of cytoskeleton,protein bin…


nuclear chromatin,extracellular space,nucleoplasm,…


174


28


111


SYELPDGQVITIGNER.2|SYELPDGQVITIGNER.3|GYSFTTTAEREI…


SEN / CTL


P68032


Actin, alpha cardiac muscle 1


ACTC1


1.05


1.12


0.0000104


0.0000055


apoptotic process,positive regulation of gene expr…


ATP binding,ATPase activity,myosin binding


extracellular space,cytoplasm,cytosol,actin filame…


48


8


32


EKLC[CAM]YVALDFENEM[Oxi]ATAASSSSLEK.3|VAPEEHPTLLTE…


SEN / CTL


Q05682


Caldesmon


CALD1


1.04


1.82


0.00258


0.000819


movement of cell or subcellular component,muscle c…


actin binding,calmodulin binding,tropomyosin bindi…


cytosol,cytoskeleton,plasma membrane,cell-cell adh…


15


61


87


QKEFDPTITDASLSLPSRR.4|YEIEETETVTK.2|QERYEIEETETVTK…


SEN / CTL


Q9H173


Nucleotide exchange factor SIL1


SIL1


1.03


1.39


0.0151


0.00401


protein folding,intracellular protein transport


unfolded protein binding


extracellular space,endoplasmic reticulum,endoplas…


9


9


11


VVTLLYDLVTEK.2|VLQTLGVLLTTC[CAM]R.2|VLQTLGVLLTTC[C…


SEN / CTL


P04350


Tubulin beta-4A chain


TUBB4A


1.02


0.83


0.00191


0.000632


G2/M transition of mitotic cell cycle,cytoskeleton…


GTPase activity,structural constituent of cytoskel…


nucleus,cytosol,microtubule,cilium,internode regio…


12


7


19


MREIVHLQAGQC[CAM]GNQIGAK.4|MREIVHLQAGQC[CAM]GNQIGA…


SEN / CTL


Q9ULV4


Coronin-1C


CORO1C


1.01


0.53


0.00692


0.00197


neural crest cell migration,regulation of protein …


protein binding,Rac GTPase binding,actin filament …


cytoplasm,focal adhesion,actin cytoskeleton,latera…


6


36


54


VTWDSSFC[CAM]AVNPR.2|AIFLADGNVFTTGFSR.2|AIFLADGNVF…


SEN / CTL


Q10588


ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2


BST1


1


0.37


0.0015


0.000504


humoral immune response,multicellular organism dev…


NAD+ nucleosidase activity,transferase activity,ph…


plasma membrane,extrinsic component of membrane,an…


6


11


13


VADFLSWC[CAM]R.2|FMPLSDVLYGR.2|ALLSPEQR.2|GEGTSAHL…


SEN / CTL


P00352


Retinal dehydrogenase 1


ALDH1A1


1


1.18


0.00225


0.000725


ethanol oxidation,cellular aldehyde metabolic proc…


retinal dehydrogenase activity,aldehyde dehydrogen…


cytoplasm,cytosol,extracellular exosome


12


44


78


LYSNAYLNDLAGC[CAM]IK.2|LYSNAYLNDLAGC[CAM]IK.3|TIPI…


SEN / CTL


Q92626


Peroxidasin homolog


PXDN


0.99


1.05


0.0000106


0.00000557


negative regulation of cytokine-mediated signaling…


peroxidase activity,interleukin-1 receptor antagon…


proteinaceous extracellular matrix,extracellular s…


24


30


36


SPNDLLALFR.2|LYGSTLNIDLFPALVVEDLVPGSR.3|ISGVALHDQG…


SEN / CTL


Q14697


Neutral alpha-glucosidase AB


GANAB


0.99


1.71


0.000277


0.000116


carbohydrate metabolic process,protein folding


carbohydrate binding,glucan 1,3-alpha-glucosidase …


endoplasmic reticulum lumen,Golgi apparatus,membra…


27


70


141


YFTWDPSRFPQPR.3|SLLLSVNAR.2|LSFQHDPETSVLVLR.3|LSFQ…


SEN / CTL


Q9H299


SH3 domain-binding glutamic acid-rich-like protein 3


SH3BGRL3


0.99


0.89


0.0393


0.00952


regulation of actin filament depolymerization,regu…


GTPase activator activity,electron carrier activit…


nucleus,cytoplasm,lamellipodium,extracellular exos…


6


7


15


IQYQLVDISQDNALRDEMR.3|IQYQLVDISQDNALRDEMR.4|IQYQLV…


SEN / CTL


Q562R1


Beta-actin-like protein 2


ACTBL2


0.98


0.37


4.41e-10


4.41e-10


biological_process


molecular_function,ATP binding


extracellular space,cytoplasm,cytoskeleton,extrace…


18


9


17


KDLYANTVLSGGSTM[Oxi]YPGIADR.3|VAPDEHPILLTEAPLNPK.3…


SEN / CTL


P13611


Versican core protein


VCAN


0.98


1.3


0.0327


0.00808


skeletal system development,osteoblast differentia…


extracellular matrix structural constituent,calciu…


extracellular region,proteinaceous extracellular m…


6


17


23


YTLNFEAAQK.2|LATVGELQAAWR.2|YEINSLIR.2|VGHDYQWIGLN…


SEN / CTL


P05090


Apolipoprotein D


APOD


0.98


2.96


0.0557


0.013


response to reactive oxygen species,angiogenesis,g…


lipid transporter activity,protein binding,cholest…


extracellular region,extracellular space,endoplasm…


6


11


13


C[CAM]PNPPVQENFDVNKYLGR.3|WYEIEKIPTTFENGR.3|VLNQEL…


SEN / CTL


P02452


Collagen alpha-1(I) chain


COL1A1


0.96


1.35


2.32e-10


2.44e-10


skeletal system development,blood vessel developme…


extracellular matrix structural constituent,protei…


extracellular region,collagen type I trimer,extrac…


66


47


55


DRDLEVDTTLK.3|DRDLEVDTTLK.2|SGEYWIDPNQGC[CAM]NLDAI…


SEN / CTL


Q9Y696


Chloride intracellular channel protein 4


CLIC4


0.95


1.12


0.000295


0.000122


angiogenesis,endothelial cell morphogenesis,chlori…


voltage-gated ion channel activity,chloride channe…


intracellular,cytoplasm,mitochondrion,centrosome,c…


15


25


45


YLTNAYSRDEFTNTC[CAM]PSDKEVEIAYSDVAK.4|TDVNKIEEFLEE…


SEN / CTL


Q3ZCM7


Tubulin beta-8 chain


TUBB8


0.95


0.87


0.183


0.0383


oocyte maturation,spindle assembly involved in fem…


molecular_function,GTPase activity,structural cons…


cytoplasm,microtubule,extracellular exosome,meioti…


3


4


13


LPTPTYGDLNHLVSATMSGVTTC[CAM]LR.3|ALTVAELTQQM[Oxi]F…


SEN / CTL


Q92734


Protein TFG


TFG


0.95


1


0.223


0.0458


signal transduction,positive regulation of I-kappa…


signal transducer activity,protein binding,identic…


Golgi membrane,cytoplasm,cytosol,extracellular exo…


3


17


33


RIPIHNEDITYDELVLMMQR.4|RIPIHNEDITYDELVLM[Oxi]MQR.4…


SEN / CTL


P37802


Transgelin-2


TAGLN2


0.93


1.62


2.41e-7


1.56e-7


epithelial cell differentiation,cell-cell adhesion


cadherin binding involved in cell-cell adhesion


cell-cell adherens junction,vesicle,extracellular …


39


26


53


QMEQISQFLQAAER.2|QMEQISQFLQAAER.3|QM[Oxi]EQISQFLQA…


SEN / CTL


P60981


Destrin


DSTN


0.93


0.74


0.0169


0.00445


actin polymerization or depolymerization,actin fil…


protein binding,actin filament binding


actin cytoskeleton,cortical actin cytoskeleton,ext…


6


22


34


YALYDASFETK.2|KEELMFFLWAPELAPLK.3|KEELM[Oxi]FFLWAP…


SEN / CTL


Q71U36


Tubulin alpha-1A chain


TUBA1A


0.93


1.23


0.0183


0.00474


G2/M transition of mitotic cell cycle,cytoskeleton…


GTPase activity,structural molecule activity,struc…


nucleus,cytosol,microtubule,cytoplasmic microtubul…


6


36


88


TIQFVDWC[CAM]PTGFK.2|TIQFVDWC[CAM]PTGFK.3|RTIQFVDW…


SEN / CTL


P50454


Serpin H1


SERPINH1


0.92


0.78


4.84e-15


9.43e-15


chondrocyte development involved in endochondral b…


serine-type endopeptidase inhibitor activity,colla…


endoplasmic reticulum,endoplasmic reticulum lumen,…


48


33


71


LYGPSSVSFADDFVR.2|LYGPSSVSFADDFVR.3|AVLSAEQLRDEEVH…


SEN / CTL


Q9Y490


Talin-1


TLN1


0.91


0.87


1.34e-18


3.93e-18


platelet degranulation,movement of cell or subcell…


integrin binding,structural constituent of cytoske…


ruffle,extracellular region,cytoplasm,microtubule …


69


186


355


GLAGAVSELLR.2|AVASAAAALVLK.2|TLAESALQLLYTAK.2|TLAE…


SEN / CTL


P26038


Moesin


MSN


0.91


1.32


5.07e-8


3.81e-8


movement of cell or subcellular component,cytoskel…


double-stranded RNA binding,actin binding,receptor…


uropod,extracellular space,nucleus,cytoplasm,cytos…


39


60


110


IGFPWSEIR.2|ERQEAEEAKEALLQASR.3|ERQEAEEAKEALLQASR….


SEN / CTL


Q14847


LIM and SH3 domain protein 1


LASP1


0.91


1.06


0.00212


0.000692


ion transport,positive regulation of signal transd…


SH3/SH2 adaptor activity,protein binding,zinc ion …


cytoplasm,cell-cell adherens junction,focal adhesi…


12


20


35


QSFTMVADTPENLR.2|QSFTMVADTPENLR.3|QSFTM[Oxi]VADTPE…


SEN / CTL


P81605


Dermcidin


DCD


0.89


1.16


0.173


0.0363


proteolysis,killing of cells of other organism,def…


peptidase activity,poly(A) RNA binding


extracellular region,extracellular matrix,extracel…


3


4


6


LGKDAVEDLESVGK.3|LGKDAVEDLESVGK.2|GAVHDVKDVLDSVL.3…


SEN / CTL


P04075


Fructose-bisphosphate aldolase A


ALDOA


0.88


1.21


7.71e-19


2.44e-18


platelet degranulation,fructose metabolic process,…


actin binding,fructose-bisphosphate aldolase activ…


extracellular region,extracellular space,nucleus,c…


87


51


110


VDKGVVPLAGTNGETTTQGLDGLSER.3|VDKGVVPLAGTNGETTTQGLD…


SEN / CTL


P25788


Proteasome subunit alpha type-3


PSMA3


0.88


0.97


0.0362


0.00885


MAPK cascade,protein polyubiquitination,stimulator…


threonine-type endopeptidase activity,protein bind…


proteasome complex,nucleus,nucleoplasm,cytoplasm,c…


6


15


25


AVENSSTAIGIR.2|VFQVEYAMK.2|VFQVEYAM[Oxi]K.2|C[CAM]…


SEN / CTL


P52907


F-actin-capping protein subunit alpha-1


CAPZA1


0.86


1.15


0.0254


0.00636


protein complex assembly,movement of cell or subce…


actin binding,cadherin binding involved in cell-ce…


extracellular region,cytosol,cytoskeleton,cell-cel…


9


20


42


FTITPPTAQVVGVLK.2|FTITPPTAQVVGVLK.3|LLLNNDNLLR.2|L…


SEN / CTL


Q96D15


Reticulocalbin-3


RCN3


0.85


1.41


0.000255


0.000109


calcium ion binding


endoplasmic reticulum lumen


15


13


20


AGDGDGWVSLAELR.2|EVAKEFDQLTPEESQAR.3|EVAKEFDQLTPEE…


SEN / CTL


Q6UVK1


Chondroitin sulfate proteoglycan 4


CSPG4


0.85


0.75


0.00339


0.00105


activation of MAPK activity,angiogenesis,transmemb…


signal transducer activity,protein kinase binding


extracellular region,Golgi lumen,integral componen…


9


46


56


GSLLLGGLDAEASR.2|ALLHVWAGGPWPQGATLR.3|ALLHVWAGGPWP…


SEN / CTL


P01344


Insulin-like growth factor II


IGF2


0.84


0.54


0.0067


0.00191


skeletal system development,ossification,positive …


insulin receptor binding,insulin-like growth facto…


extracellular region,extracellular space,plasma me…


6


2


3


GIVEEC[CAM]C[CAM]FR.2|SC[CAM]DLALLETYC[CAM]ATPAK.2…


SEN / CTL


P35555


Fibrillin-1


FBN1


0.83


0.84


1.34e-11


1.85e-11


skeletal system development,metanephros developmen…


integrin binding,hormone activity,extracellular ma…


microfibril,extracellular region,proteinaceous ext…


48


32


32


ILELLPALTTLTNHNR.3|TLPGGNQC[CAM]IVPIC[CAM]R.2|TC[C…


SEN / CTL


Q15293


Reticulocalbin-1


RCN1


0.83


3.59


0.123


0.0265


in utero embryonic development,camera-type eye dev…


calcium ion binding


endoplasmic reticulum,endoplasmic reticulum lumen


15


29


48


AADLNGDLTATR.2|HWILPQDYDHAQAEAR.4|HWILPQDYDHAQAEAR…


SEN / CTL


Q14112


Nidogen-2


NID2


0.82


1.57


0.0979


0.0215


cell adhesion,cell-matrix adhesion,extracellular m…


calcium ion binding,protein binding,collagen bindi…


extracellular region,basement membrane,extracellul…


27


46


60


VLYREDTSPAVLGLAAR.3|AIAVDPIRGNLYWTDWNR.3|AGLELGAEP…


SEN / CTL


P15144


Aminopeptidase N


ANPEP


0.8


1.38


0.000186


0.0000812


angiogenesis,proteolysis,cell differentiation,pept…


virus receptor activity,aminopeptidase activity,re…


extracellular space,lysosomal membrane,endoplasmic…


15


60


99


YLSYTLNPDLIR.2|YLSYTLNPDLIR.3|ENKEVVLQWFTENSK.3|EN…


SEN / CTL


P28300


Protein-lysine 6-oxidase


LOX


0.8


0.7


0.0346


0.0085


cellular protein modification process,heart develo…


protein-lysine 6-oxidase activity,copper ion bindi…


extracellular region,proteinaceous extracellular m…


6


2


3


YTGHHAYASGC[CAM]TISPY.3|YTGHHAYASGC[CAM]TISPY.2|NQ…


SEN / CTL


P35442


Thrombospondin-2


THBS2


0.79


0.41


0.00000467


0.00000259


cell adhesion,negative regulation of angiogenesis,…


calcium ion binding,heparin binding


extracellular region,basement membrane,platelet al…


15


8


9


GTLLALEGPGLSQR.2|SC[CAM]DVTSNTC[CAM]LGPSIQTR.2|GLL…


SEN / CTL


P08294


Extracellular superoxide dismutase [Cu-Zn]


SOD3


0.79


1.28


0.00144


0.000493


response to reactive oxygen species,response to hy…


superoxide dismutase activity,copper ion binding,p…


extracellular region,extracellular space,nucleus,c…


21


10


14


VTEIWQEVMQR.2|VTEIWQEVM[Oxi]QR.2|VTGVVLFR.2|LAC[CA…


SEN / CTL


Q14315


Filamin-C


FLNC


0.77


1.22


6.29e-9


5.49e-9


cell junction assembly,muscle fiber development


protein binding,cytoskeletal protein binding,ankyr…


cytoplasm,cytosol,cytoskeleton,plasma membrane,foc…


51


146


209


LIALLEVLSQK.2|VAVGQEQAFSVNTR.2|YGGDEIPYSPFR.2|YWPT…


SEN / CTL


P05452


Tetranectin


CLEC3B


0.77


1.93


0.0022


0.00071


ossification,platelet degranulation,positive regul…


calcium ion binding,heparin binding,carbohydrate b…


granular component,extracellular region,extracellu…


21


11


14


LDTLAQEVALLK.2|GGTLGTPQTGSENDALYEYLR.3|GGTLGTPQTGS…


SEN / CTL


P10321


HLA class I histocompatibility antigen, Cw-7 alpha chain


HLA-C


0.75


2.06


0.00000156


9.25e-7


27


12


15


AYLEGTC[CAM]VEWLR.2|SWTAADTAAQITQR.2|SWTAADTAAQITQ…


SEN / CTL


P63241


Eukaryotic translation initiation factor 5A-1


EIF5A


0.75


1.6


0.00103


0.000369


mRNA export from nucleus,translational frameshifti…


RNA binding,translation elongation factor activity…


nucleus,annulate lamellae,nuclear pore,cytoplasm,e…


15


19


41


VHLVGIDIFTGK.3|VHLVGIDIFTGK.2|RNDFQLIGIQDGYLSLLQDS…


SEN / CTL


Q01518


Adenylyl cyclase-associated protein 1


CAP1


0.75


0.37


0.00376


0.00116


cell morphogenesis,ameboidal-type cell migration,r…


actin binding,adenylate cyclase binding


plasma membrane,focal adhesion,cortical actin cyto…


6


51


99


SSEMNVLIPTEGGDFNEFPVPEQFK.3|SSEMNVLIPTEGGDFNEFPVPE…


SEN / CTL


Q92520


Protein FAM3C


FAM3C


0.73


1.03


0.0397


0.00958


platelet degranulation,multicellular organism deve…


cytokine activity


extracellular region,Golgi apparatus,platelet dens…


9


12


17


MDASLGNLFAR.2|IC[CAM]LEDNVLMSGVK.2|IC[CAM]LEDNVLM[…


SEN / CTL


P06396


Gelsolin


GSN


0.72


1.08


2.42e-7


1.56e-7


phagocytosis, engulfment,positive regulation of ge…


actin binding,calcium ion binding,protein binding,…


podosome,extracellular region,extracellular space,…


45


53


102


QTQVSVLPEGGETPLFK.2|QTQVSVLPEGGETPLFK.3|AGALNSNDAF…


SEN / CTL


Q06830


Peroxiredoxin-1


PRDX1


0.72


1.38


0.00000873


0.00000467


response to reactive oxygen species,skeletal syste…


peroxidase activity,protein binding,thioredoxin pe…


extracellular space,nucleus,cytoplasm,mitochondrio…


30


29


60


GLFIIDDKGILR.3|GLFIIDDKGILR.2|LVQAFQFTDKHGEVC[CAM]…


SEN / CTL


O95967


EGF-containing fibulin-like extracellular matrix protein 2


EFEMP2


0.72


0.53


0.000137


0.0000612


extracellular matrix structural constituent,calciu…


extracellular region,basement membrane,extracellul…


12


6


6


SC[CAM]VDVNEC[CAM]DMGAPC[CAM]EQR.2|C[CAM]INHYGGYLC…


SEN / CTL


P10599


Thioredoxin


TXN


0.72


1.58


0.0606


0.0138


sulfate assimilation,negative regulation of transc…


protein binding,protein disulfide oxidoreductase a…


nucleus,nucleoplasm,cytoplasm,mitochondrion,cytoso…


12


12


20


C[CAM]MPTFQFFK.2|C[CAM]M[Oxi]PTFQFFK.2|VGEFSGANKEK…


SEN / CTL


P12110


Collagen alpha-2(VI) chain


COL6A2


0.7


1.66


1.38e-12


2.14e-12


cell adhesion,response to glucose,extracellular ma…


extracellular region,proteinaceous extracellular m…


60


42


57


AAVFHEKDYDSLAQPGFFDR.4|AAVFHEKDYDSLAQPGFFDR.3|VFAV…


SEN / CTL


Q6NZI2


Polymerase I and transcript release factor


PTRF


0.7


0.94


0.000958


0.00035


regulation of transcription, DNA-templated,transcr…


protein binding,rRNA primary transcript binding,po…


nucleus,nucleoplasm,cytoplasm,mitochondrion,endopl…


15


15


23


QAEMEGAVQSIQGELSK.3|QAEMEGAVQSIQGELSK.2|QAEM[Oxi]E…


SEN / CTL


P00747


Plasminogen


PLG


0.7


1.32


0.013


0.00353


platelet degranulation,proteolysis,blood coagulati…


serine-type endopeptidase activity,receptor bindin…


extracellular region,extracellular space,plasma me…


12


58


96


TPENYPNAGLTMNYC[CAM]R.3|TPENYPNAGLTMNYC[CAM]R.2|TP…


SEN / CTL


P26599


Polypyrimidine tract-binding protein 1


PTBP1


0.69


1.81


0.0418


0.01


alternative mRNA splicing, via spliceosome,regulat…


nucleotide binding,RNA binding,protein binding,pol…


nucleoplasm,nucleolus,membrane,extracellular exoso…


6


35


87


KLPIDVTEGEVISLGLPFGK.3|KLPIDVTEGEVISLGLPFGK.4|KLPI…


SEN / CTL


P08133


Annexin A6


ANXA6


0.68


0.81


0.00963


0.00268


calcium ion transport,regulation of muscle contrac…


calcium ion binding,protein binding,GTP binding,ca…


mitochondrion,lysosomal membrane,focal adhesion,me…


15


72


121


GLGTDEDTIIDIITHR.3|GLGTDEDTIIDIITHR.2|GFGSDKEAILDI…


SEN / CTL


O95084


Serine protease 23


PRSS23


0.67


0.74


0.0109


0.003


proteolysis


serine-type endopeptidase activity


nucleus,extracellular exosome


6


5


6


YAQIC[CAM]YWIK.2|LSTGC[CAM]TGTLVAEK.2|LEVSSSC[CAM]…


SEN / CTL


P14625


Endoplasmin


HSP90B1


0.66


2.09


0.000124


0.0000565


response to hypoxia,toll-like receptor signaling p…


RNA binding,calcium ion binding,protein binding,AT…


extracellular region,nucleus,endoplasmic reticulum…


24


85


166


GVVDSDDLPLNVSR.2|GVVDSDDLPLNVSR.3|FAFQAEVNR.2|FQSS…


SEN / CTL


Q15019


Septin-2


2-Sep


0.66


0.75


0.00635


0.00185


regulation of L-glutamate transport,mitotic nuclea…


protein binding,GTP binding,enzyme regulator activ…


exocyst,condensed chromosome kinetochore,nucleus,n…


9


30


53


TIISYIDEQFER.2|ASIPFSVVGSNQLIEAK.2|ASIPFSVVGSNQLIE…


SEN / CTL


P20908


Collagen alpha-1(V) chain


COL5A1


0.65


0.68


5.98e-7


3.75e-7


blood vessel development,heart morphogenesis,cell …


integrin binding,extracellular matrix structural c…


extracellular region,collagen type V trimer,baseme…


33


15


18


SPVFLYEDHTGKPGPEDYPLFR.4|QLYPASAFPEDFSILTTVK.2|FLG…


SEN / CTL


P13797


Plastin-3


PLS3


0.65


0.87


0.0142


0.00382


actin filament bundle assembly,actin filament netw…


calcium ion binding,actin filament binding


cytoplasm,actin filament,actin filament bundle


15


45


74


VYALPEDLVEVKPK.3|VYALPEDLVEVKPK.2|MVMTVFAC[CAM]LMG…


SEN / CTL


O43852


Calumenin


CALU


0.64


0.8


0.0000754


0.0000356


biological_process


calcium ion binding,protein binding


extracellular region,endoplasmic reticulum,endopla…


21


34


62


WIYEDVER.2|IDGDKDGFVTVDELKDWIK.4|IDGDKDGFVTVDELKDW…


SEN / CTL


P15311


Ezrin


EZR


0.64


1.25


0.0237


0.00595


negative regulation of transcription from RNA poly…


actin binding,protein binding,microtubule binding,…


ruffle,immunological synapse,uropod,extracellular …


12


50


90


QRIDEFEAL.2|SQEQLAAELAEYTAK.2|SQEQLAAELAEYTAK.3|GM…


SEN / CTL


Q13740


CD166 antigen


ALCAM


0.64


1.11


0.0729


0.0163


adaptive immune response,cell adhesion,heterophili…


receptor binding,protein binding


immunological synapse,integral component of plasma…


9


30


45


EMDPVTQLYTMTSTLEYK.3|EMDPVTQLYTMTSTLEYK.2|VLHPLEGA…


SEN / CTL


O60565


Q9H772


Gremlin-1;Gremlin-2


GREM1


GREM2


0.63


0.47


0.145


0.0309


cell morphogenesis,branching involved in ureteric …


cytokine activity,protein binding,morphogen activi…


extracellular space,cell surface;extracellular reg…


3


1


1


FC[CAM]YGQC[CAM]NSFYIPR.2


SEN / CTL


Q9Y4K0


Lysyl oxidase homolog 2


LOXL2


0.62


0.85


0.00000769


0.0000042


response to hypoxia,epithelial to mesenchymal tran…


chromatin binding,transcription corepressor activi…


basement membrane,extracellular space,nucleus,nucl…


27


16


19


VVC[CAM]GMFGFPGER.2|LGQGIGPIHLNEIQC[CAM]TGNEK.3|NG…


SEN / CTL


Q14019


Coactosin-like protein


COTL1


0.62


0.66


0.00497


0.00149


biological_process,defense response to fungus


actin binding,enzyme binding


nucleus,cytoplasm,cytoskeleton,extracellular exoso…


12


20


26


SKFALITWIGENVSGLQR.3|SKFALITWIGENVSGLQR.2|FALITWIG…


SEN / CTL


P08758


Annexin A5


ANXA5


0.59


1.5


7.82e-9


6.75e-9


signal transduction,blood coagulation,response to …


phospholipase inhibitor activity,calcium ion bindi…


intracellular,cytoplasm,focal adhesion,external si…


36


45


70


GLGTDEESILTLLTSR.3|GLGTDEESILTLLTSR.2|SEIDLFNIR.2|…


SEN / CTL


P09972


Fructose-bisphosphate aldolase C


ALDOC


0.59


1.11


0.00131


0.000458


fructose metabolic process,gluconeogenesis,fructos…


fructose-bisphosphate aldolase activity,protein bi…


mitochondrion,cytosol,cytoskeleton,extracellular e…


12


27


42


VDKGVVPLAGTDGETTTQGLDGLSER.3|VDKGVVPLAGTDGETTTQGLD…


SEN / CTL


Q04760


Lactoylglutathione lyase


GLO1


0.59


1.42


0.0798


0.0177


carbohydrate metabolic process,pyruvate metabolic …


lactoylglutathione lyase activity,zinc ion binding


cytoplasm,cytosol,extracellular exosome


6


16


31


GLAFIQDPDGYWIEILNPNK.3|GLAFIQDPDGYWIEILNPNK.2|GFGH…


SEN / CTL


P09486


SPARC


SPARC


0.56


0.98


6.64e-10


6.56e-10


ossification,negative regulation of endothelial ce…


calcium ion binding,protein binding,collagen bindi…


extracellular region,basement membrane,extracellul…


48


14


22


YIPPC[CAM]LDSELTEFPLR.3|YIPPC[CAM]LDSELTEFPLR.2|FF…


SEN / CTL


P02787


Serotransferrin


TF


0.54


0.66


0.0596


0.0136


retina homeostasis,platelet degranulation,cellular…


protein binding,ferrous iron binding,ferric iron b…


extracellular region,extracellular space,early end…


6


86


160


C[CAM]LVEKGDVAFVK.3|C[CAM]LVEKGDVAFVK.2|NPDPWAK.2|…


SEN / CTL


P61224


P62834


Ras-related protein Rap-1b;Ras-related protein Rap-1A


RAP1B


RAP1A


0.54


1.54


0.173


0.0363


cell proliferation,response to carbohydrate,Rap pr…


GTPase activity,protein binding,GTP binding,GDP bi…


intracellular,lipid particle,cytosol,plasma membra…


6


2


3


SKINVNEIFYDLVR.3|SKINVNEIFYDLVR.2|LVVLGSGGVGK.2


SEN / CTL


P17936


Insulin-like growth factor-binding protein 3


IGFBP3


0.53


1.15


0.0000597


0.0000289


regulation of cell growth,osteoblast differentiati…


fibronectin binding,protein binding,insulin-like g…


extracellular region,extracellular space,nucleus,i…


24


10


13


C[CAM]QPSPDEARPLQALLDGR.3|FLNVLSPR.2|EPGC[CAM]GC[C…


SEN / CTL


P05121


Plasminogen activator inhibitor 1


SERPINE1


0.53


1.12


0.00103


0.000369


chronological cell aging,angiogenesis,platelet deg…


protease binding,serine-type endopeptidase inhibit…


extracellular region,extracellular space,plasma me…


18


9


10


MAPEEIIMDRPFLFVVR.3|HNPTGTVLFMGQVMEP.2|QFQADFTSLSD…


SEN / CTL


P32119


Peroxiredoxin-2


PRDX2


0.51


1.14


0.00705


0.002


response to reactive oxygen species,response to ox…


thioredoxin peroxidase activity,antioxidant activi…


cytoplasm,cytosol,extracellular exosome


9


24


40


KEGGLGPLNIPLLADVTR.3|KEGGLGPLNIPLLADVTR.2|ATAVVDGA…


SEN / CTL


P01023


Alpha-2-macroglobulin


A2M


0.5


1.34


0.00143


0.000491


negative regulation of complement activation, lect…


protease binding,serine-type endopeptidase inhibit…


extracellular region,cytosol,platelet alpha granul…


33


89


144


QTVSWAVTPK.2|ATVLNYLPK.2|IAQWQSFQLEGGLKQFSFPLSSEPF…


SEN / CTL


P61158


Actin-related protein 3


ACTR3


0.49


1.48


0.00101


0.000363


movement of cell or subcellular component,establis…


structural constituent of cytoskeleton,ATP binding…


cytosol,Arp2/3 protein complex,brush border,cell-c…


18


34


61


DITYFIQQLLR.2|DITYFIQQLLR.3|HGIVEDWDLMER.3|HGIVEDW…


SEN / CTL


P01008


Antithrombin-III


SERPINC1


0.49


0.9


0.0829


0.0184


acute inflammatory response to antigenic stimulus,…


protease binding,serine-type endopeptidase inhibit…


extracellular region,extracellular space,plasma me…


6


31


70


TSDQIHFFFAK.3|TSDQIHFFFAK.2|FRIEDGFSLK.3|FRIEDGFSL…


SEN / CTL


P00734


Prothrombin


F2


0.48


0.63


0.0729


0.0163


positive regulation of protein phosphorylation,sig…


serine-type endopeptidase activity,receptor bindin…


extracellular region,extracellular space,endoplasm…


6


42


86


SPQELLC[CAM]GASLISDR.2|SPQELLC[CAM]GASLISDR.3|KSPQ…


SEN / CTL


O00622


Protein CYR61


CYR61


0.45


0.77


0.0188


0.00483


regulation of cell growth,osteoblast differentiati…


integrin binding,insulin-like growth factor bindin…


proteinaceous extracellular matrix,extracellular m…


9


17


20


GLEC[CAM]NFGASSTALK.2|HQC[CAM]TC[CAM]IDGAVGC[CAM]I…


SEN / CTL


Q9BRK5


45 kDa calcium-binding protein


SDF4


0.43


1.86


0.0444


0.0105


UV protection,calcium ion regulated exocytosis,cer…


calcium ion binding,identical protein binding


cytoplasm,late endosome,Golgi apparatus,Golgi lume…


9


20


30


WYQADSPPADLLLTEEEFLSFLHPEHSR.4|DLGGFDEDAEPR.2|AVDP…


SEN / CTL


P20742


Pregnancy zone protein


PZP


0.43


0.84


0.127


0.0271


female pregnancy,negative regulation of endopeptid…


endopeptidase inhibitor activity,serine-type endop…


extracellular region,extracellular exosome,blood m…


6


23


26


DLFHC[CAM]VSFTLPR.3|DLFHC[CAM]VSFTLPR.2|SGTHTLPVES…


SEN / CTL


P18065


Insulin-like growth factor-binding protein 2


IGFBP2


0.42


1.23


0.0172


0.0045


regulation of cell growth,signal transduction,fema…


receptor binding,insulin-like growth factor I bind…


extracellular region,extracellular space,apical pl…


15


11


14


TPC[CAM]QQELDQVLER.2|LEGEAC[CAM]GVYTPR.2|MPC[CAM]A…


SEN / CTL


P35908


Keratin, type II cytoskeletal 2 epidermal


KRT2


0.4


1.24


1.5e-7


1.02e-7


keratinocyte development,epidermis development,ker…


structural constituent of cytoskeleton,protein bin…


extracellular space,nucleus,cytoplasm,Golgi appara…


75


54


102


YEELQVTVGR.2|FLEQQNQVLQTK.2|FLEQQNQVLQTK.3|VDLLNQE…


SEN / CTL


P13645


Keratin, type I cytoskeletal 10


KRT10


0.37


1.44


0.0000545


0.0000267


keratinocyte differentiation


structural constituent of epidermis


extracellular space,nucleus,cytoplasm,intermediate…


120


51


100


TIDDLKNQILNLTTDNANILLQIDNAR.4|TIDDLKNQILNLTTDNANIL…


SEN / CTL


P54727


UV excision repair protein RAD23 homolog B


RAD23B


0.36


1.82


0.068


0.0154


nucleotide-excision repair, DNA damage recognition…


damaged DNA binding,single-stranded DNA binding,pr…


proteasome complex,nucleus,nucleoplasm,cytoplasm,X…


6


20


33


QIIQQNPSLLPALLQQIGR.3|QIIQQNPSLLPALLQQIGR.4|QIIQQN…


SEN / CTL


P07437


Tubulin beta chain


TUBB


0.34


1.12


3.86e-13


6.38e-13


G2/M transition of mitotic cell cycle,movement of …


GTPase activity,structural molecule activity,struc…


extracellular region,nucleus,nuclear envelope lume…


57


20


59


YLTVAAVFR.2|NSSYFVEWIPNNVK.2|NSSYFVEWIPNNVK.3|AILV…


SEN / CTL


P09936


Ubiquitin carboxyl-terminal hydrolase isozyme L1


UCHL1


0.33


2.19


0.0147


0.00391


response to ischemia,axon target recognition,adult…


cysteine-type endopeptidase activity,thiol-depende…


nucleoplasm,cytoplasm,endoplasmic reticulum membra…


30


20


39


C[CAM]FEKNEAIQAAHDAVAQEGQC[CAM]R.4|C[CAM]FEKNEAIQA…


SEN / CTL


P01024


Complement C3


C3


0.31


1.57


0.0000059


0.00000325


positive regulation of type IIa hypersensitivity,p…


serine-type endopeptidase activity,endopeptidase i…


extracellular region,extracellular space,plasma me…


39


130


202


YYGGGYGSTQATFMVFQALAQYQK.3|GYTQQLAFR.2|SGIPIVTSPYQ…


SEN / CTL


O00469


Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2


PLOD2


0.31


1.64


0.24


0.0486


response to hypoxia,cellular protein modification …


iron ion binding,procollagen-lysine 5-dioxygenase …


endoplasmic reticulum,endoplasmic reticulum membra…


9


33


47


YLNSGGFIGYAPYVNR.2|AC[CAM]DELVEEMEHYGK.3|GFALLNFVV…


SEN / CTL


P12107


Collagen alpha-1(XI) chain


COL11A1


0.31


0.36


0.247


0.0499


cartilage condensation,ossification,chondrocyte de…


extracellular matrix structural constituent,protei…


extracellular region,collagen type XI trimer,endop…


3


8


8


SPVFLFEDHTGKPAPEDYPLFR.4|ALDFHNSPEGISK.3|DGLPGHPGQ…


SEN / CTL


P08572


Collagen alpha-2(IV) chain


COL4A2


0.3


1.08


0.0423


0.0101


angiogenesis,transcription, DNA-templated,negative…


extracellular matrix structural constituent


extracellular region,collagen type IV trimer,endop…


15


15


19


SVSIGYLLVK.2|FSTMPFLYC[CAM]NPGDVC[CAM]YYASR.3|RGPP…


SEN / CTL


Q00610


Clathrin heavy chain 1


CLTC


0.29


1.95


0.0000337


0.000017


osteoblast differentiation,intracellular protein t…


double-stranded RNA binding,structural molecule ac…


spindle,cytosol,plasma membrane,focal adhesion,mem…


30


154


302


LLLPWLEAR.2|SVDPTLALSVYLR.2|VANVELYYR.2|SVNESLNNLF…


SEN / CTL


P04114


Apolipoprotein B-100


APOB


0.29


0.77


0.0798


0.0177


retinoid metabolic process,in utero embryonic deve…


protein binding,phospholipid binding,heparin bindi…


extracellular region,extracellular space,cytoplasm…


15


186


272


IEGNLIFDPNNYLPK.2|GFEPTLEALFGK.2|ENFAGEATLQR.2|TEV…


SEN / CTL


P07996


Thrombospondin-1


THBS1


0.27


1.45


1.92e-9


1.75e-9


activation of MAPK activity,response to hypoxia,ne…


phosphatidylserine binding,glycoprotein binding,fi…


extracellular region,fibrinogen complex,extracellu…


126


63


89


FVFGTTPEDILR.2|GFLLLASLR.2|TIVTTLQDSIR.2|GGVNDNFQG…


SEN / CTL


P05997


Collagen alpha-2(V) chain


COL5A2


0.27


0.88


0.168


0.0355


skeletal system development,ossification,extracell…


molecular_function,extracellular matrix structural…


extracellular region,collagen type V trimer,endopl…


12


14


15


GSQFAYGDHQSPNTAITQMTFLR.3|SPDNKPVWYGLDMNR.3|QSGEYW…


SEN / CTL


P02545


Prelamin-A/C


LMNA


0.11


2.08


3.04e-11


3.92e-11


mitotic nuclear envelope disassembly,mitotic nucle…


structural molecule activity,protein binding


nucleus,nuclear envelope,lamin filament,nucleoplas…


57


85


142


VAVEEVDEEGKFVR.3|VAVEEVDEEGKFVR.2|LQLELSK.2|IRIDSL…


SEN / CTL


P36955


Pigment epithelium-derived factor


SERPINF1


0.04


1.8


0.0000962


0.0000443


kidney development,multicellular organism developm…


serine-type endopeptidase inhibitor activity,prote…


extracellular region,basement membrane,extracellul…


39


20


26


DTDTGALLFIGK.2|LAAAVSNFGYDLYR.2|LAAAVSNFGYDLYR.3|S…


SEN / CTL


P04259


Keratin, type II cytoskeletal 6B


KRT6B


0.03


1.52


0.095


0.0209


cytoskeleton organization,ectoderm development


structural constituent of cytoskeleton,protein bin…


keratin filament,extracellular exosome


21


9


14


YEELQITAGR.2|YEELQITAGR.1|SGFSSISVSR.2|VLDTKWTLLQE…


SEN / CTL


Q9NR12


PDZ and LIM domain protein 7


PDLIM7


-0.01


2.36


0.201


0.0417


ossification,receptor-mediated endocytosis,multice…


protein binding,zinc ion binding


stress fiber,ruffle,nucleus,cytoplasm,cell-cell ju…


9


23


36


VVLEGPAPWGFR.2|VVLEGPAPWGFR.3|VLEEGGFFEEK.2|LQGGKD…


SEN / CTL


P08729


Keratin, type II cytoskeletal 7


KRT7


-0.09


0.77


0.195


0.0406


viral process


structural molecule activity,protein binding


nucleus,cytoplasm,intermediate filament,keratin fi…


12


52


77


LALDIEIATYR.2|VDALNDEINFLR.2|SSRLPDIFEAQIAGLR.3|SS…


SEN / CTL


P02042


P02100


P68871


P69891


P69892


Hemoglobin subunit delta;Hemoglobin subunit epsilon;Hemoglobin subunit beta;Hemoglobin subunit gamma-1;Hemoglobin subunit gamma-2


HBD


HBE1


HBB


HBG1


HBG2


-0.28


0.53


0.112


0.0242


blood coagulation,oxygen transport;blood coagulati…


oxygen transporter activity,iron ion binding,prote…


cytosol,hemoglobin complex,blood microparticle;cyt…


6


1


2


LLVVYPWTQR.2|LLVVYPWTQR.3


SEN / CTL


Q02413


Desmoglein-1


DSG1


-0.41


1.23


0.226


0.0464


cell-cell junction assembly,homophilic cell adhesi…


calcium ion binding,protein binding,toxic substanc…


cytosol,plasma membrane,cytoplasmic side of plasma…


15


21


32


IIRQEPSDSPMFIINR.3|VIAPSSSLPTSLTIHHPR.4|VIAPSSSLPT…


SEN / CTL


P50995


Annexin A11


ANXA11


-0.47


1.14


0.0568


0.0132


phagocytosis,cell cycle,cell division,response to …


calcium ion binding,protein binding,calcium-depend…


nuclear envelope,nucleoplasm,cytoplasm,spindle,mem…


6


29


45


NTPAFFAER.2|GVGTDEAC[CAM]LIEILASR.3|GVGTDEAC[CAM]L…


SEN / CTL


P29279


Connective tissue growth factor


CTGF


-0.55


0.85


0.0269


0.00673


cartilage condensation,ossification,angiogenesis,r…


fibronectin binding,integrin binding,protein bindi…


extracellular region,proteinaceous extracellular m…


9


8


8


DGAPC[CAM]IFGGTVYR.2|C[CAM]PAGVSLVLDGC[CAM]GC[CAM]…


SEN / CTL


P67936


Tropomyosin alpha-4 chain


TPM4


-0.85


2.41


0.102


0.0222


osteoblast differentiation,movement of cell or sub…


actin binding,calcium ion binding,protein binding,…


stress fiber,podosome,cytosol,cytoskeleton,muscle …


18


25


42


KIQALQQQADEAEDRAQGLQR.4|KIQALQQQADEAEDRAQGLQR.3|KI…


SEN / CTL


P02533


Keratin, type I cytoskeletal 14


KRT14


-1.14


1.68


0.0139


0.00374


aging,epidermis development,response to zinc ion,r…


structural constituent of cytoskeleton,protein bin…


nucleus,cytoplasm,cytosol,intermediate filament,ke…


135


50


89


VLDELTLAR.2|ILTATVDNANVLLQIDNAR.3|ILTATVDNANVLLQID…


SEN / CTL


Q93084


Sarcoplasmic/endoplasmic reticulum calcium ATPase 3


ATP2A3


-1.23


1.98


0.101


0.0221


transport,calcium ion transport,cellular calcium i…


calcium-transporting ATPase activity,ATP binding,m…


endoplasmic reticulum,endoplasmic reticulum membra…


9


26


35


SLPSVETLGC[CAM]TSVIC[CAM]SDK.2|SLPSVETLGC[CAM]TSVI…


SEN / CTL


P02538


Keratin, type II cytoskeletal 6A


KRT6A


-1.35


1.41


1.22e-7


8.4e-8


morphogenesis of an epithelium,cytoskeleton organi…


structural constituent of cytoskeleton,protein bin…


nucleus,membrane,keratin filament,extracellular ex…


126


61


85


YEELQVTAGR.2|ADTLTDEINFLR.2|ADTLTDEINFLR.3|QNLEPLF…


SEN / CTL


P08779


Keratin, type I cytoskeletal 16


KRT16


-1.57


1.4


2.14e-9


1.94e-9


morphogenesis of an epithelium,inflammatory respon…


structural constituent of cytoskeleton,protein bin…


nucleus,cytoskeleton,intermediate filament,extrace…


96


25


45


APSTYGGGLSVSSR.2|DAETWFLSK.2|LLEGEDAHLSSQQASGQSYSS…


SEN / CTL


P11055


P12882


Q9UKX2


Myosin-3;Myosin-1;Myosin-2


MYH3


MYH1


MYH2


-1.63


2.06


0.0103


0.00285


skeletal muscle contraction,protein dephosphorylat…


microfilament motor activity,calmodulin binding,AT…


cytosol,muscle myosin complex,sarcomere,myosin fil…


9


3


3


HADSVAELGEQIDNLQR.3|GSSFQTVSALFR.2|LASADIETYLLEK.2


SEN / CTL


P12883


P13533


Myosin-7;Myosin-6


MYH7


MYH6


-1.68


1.58


0.231


0.0472


regulation of the force of heart contraction,regul…


microfilament motor activity,actin binding,protein…


stress fiber,muscle myosin complex,myosin complex,…


3


1


1


IEELEEELEAER.2


SEN / CTL


Q04695


Keratin, type I cytoskeletal 17


KRT17


-1.75


1.86


0.00619


0.00181


signal transduction,epidermis development,positive…


structural constituent of cytoskeleton,MHC class I…


cytoplasm,intermediate filament,extracellular exos…


30


28


43


ALEEANTELEVK.2|LSVEADINGLRR.3|LSVEADINGLRR.2|ILTAT…


[/raw]